F455580

General Info

Members Datasets Scaffolds Average Seq Length
500 300 1000 115

Family's Representative Sequence

Representative Sequence 3300041512|Ga0451853_2154048|Ga0451853_2154048_830_1237
Length 135
Sequence MVNTGSCKGVDYDSGMSKKLVIKVTAGADAPERCSQAFTVAAVAVASGVEVSLWLTGESSWFALPGRAAEFELPHAAPLPDLIDSILAGGRLTLCTQCAARRDITEKDVIEGVRIAGAQVFVQEALGDETQALVY

Samples

Sample ID Description Type Environment
1 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
4 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
5 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
6 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
7 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
8 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
9 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
10 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
11 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
12 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
13 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
14 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
15 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
16 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
17 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
18 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
19 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
20 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
21 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
22 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
24 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
25 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
26 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
27 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
28 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
29 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
30 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
31 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
32 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
33 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
34 3300023436 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.stno.R1 Metatranscriptome Rhizosphere
35 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
54 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
55 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
56 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
57 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
58 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
59 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
60 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
61 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
62 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
63 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
64 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
65 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
66 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
67 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
68 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
69 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
70 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
71 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
72 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
73 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
74 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
75 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
76 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
77 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
78 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
79 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
80 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
81 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
82 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
83 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
84 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
85 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
86 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
87 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
88 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
89 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
90 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
91 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
92 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
93 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
94 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
95 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
96 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
97 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
98 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
99 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
100 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
101 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
102 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
103 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
104 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
105 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
106 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
107 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
108 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
109 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
110 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
111 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
112 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
113 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
114 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
115 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
116 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
117 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
118 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
119 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
120 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
121 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
122 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
123 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
124 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
125 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
126 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
127 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
128 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
129 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
130 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
131 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
132 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
133 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
134 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
135 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
136 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
137 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
138 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
139 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
140 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
141 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
142 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
143 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
144 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
145 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
146 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
147 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
148 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
149 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
150 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
151 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
152 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
153 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
154 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
155 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
156 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
157 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
158 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
159 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
160 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
161 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
162 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
163 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
164 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
165 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
166 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
167 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
168 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
169 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
170 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
171 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
172 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
173 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
174 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
175 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
176 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
177 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
178 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
179 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
180 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
181 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
182 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
183 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
184 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
185 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
200 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
201 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
202 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
203 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
204 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
205 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
206 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
207 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
208 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
209 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
210 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
211 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
212 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
213 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
217 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
218 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
219 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
220 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
221 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
222 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
223 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
224 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
225 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
226 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
227 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
228 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
229 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
230 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
231 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
232 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
233 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
234 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
235 2643221548 Streptomyces sp. Root55 Isolate Unclassified
236 2643221578 Streptomyces sp. Root63 Isolate Unclassified
237 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
238 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
239 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
240 2643221647 Streptomyces sp. Root369 Isolate Unclassified
241 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
242 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
243 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
244 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
245 2684623036 Frankia sp. CgIM4 Isolate Nodule
246 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
247 2710264753 Frankia sp. KB5 Isolate Nodule
248 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
249 2773857922 Frankia sp. CcI49 Isolate Nodule
250 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
251 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
252 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
253 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
254 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
255 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
256 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
257 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
258 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
259 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
260 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
261 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
262 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
263 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
264 2862574272 Streptomyces sp. AcE210 Isolate Nodule
265 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
266 2867369537 Streptomyces sp. Z26 Isolate Unclassified
267 2867428634 Streptomyces sp. RP5T Isolate Unclassified
268 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
269 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
270 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
271 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
272 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
273 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
274 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
275 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
276 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
277 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
278 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
279 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
280 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
281 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
282 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
283 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
284 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
285 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
286 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
287 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
288 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
289 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
290 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
291 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
292 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
293 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
294 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
295 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
296 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
297 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
298 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
299 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere
300 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.2
Metatranscriptomes 0.2
Isolates 13.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.2
Nodule 2
Rhizoplane 1.4
Rhizosphere 84.6
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451853_2154048 3300041512 Bacteria 4123
2 Ga0070683_100540503 3300005329 Bacteria 1114
3 Ga0070660_100394258 3300005339 Bacteria 1144
4 Ga0070659_100000059 3300005366 Bacteria 86977
5 Ga0070681_11099475 3300005458 Bacteria 716
6 Ga0070698_100586515 3300005471 Bacteria 1055
7 Ga0070679_101047644 3300005530 Bacteria 760
8 Ga0070686_101368845 3300005544 Bacteria 593
9 Ga0070665_100708334 3300005548 Bacteria 1020
10 Ga0070664_101214444 3300005564 Bacteria 711
11 Ga0068856_100105884 3300005614 Bacteria 2807
12 Ga0070702_100582243 3300005615 Bacteria 836
13 Ga0068863_100003672 3300005841 Bacteria 15156
14 Ga0081455_10000239 3300005937 Bacteria 71193
15 Ga0081455_10510498 3300005937 Bacteria 805
16 Ga0075363_100043958 3300006048 Bacteria 2364
17 Ga0075363_100051732 3300006048 Bacteria 2191
18 Ga0075428_100674240 3300006844 Bacteria 1102
19 Ga0099826_10204185 3300006948 Bacteria 1079
20 Ga0105251_10003100 3300009011 Bacteria 12353
21 Ga0105250_10199815 3300009092 Bacteria 843
22 Ga0105245_10468510 3300009098 Bacteria 1271
23 Ga0105247_10001043 3300009101 Bacteria 20803
24 Ga0114129_10006514 3300009147 Bacteria 16567
25 Ga0105243_12136101 3300009148 Bacteria 596
26 Ga0105242_12485195 3300009176 Bacteria 566
27 Ga0105249_11322463 3300009553 Bacteria 792
28 Ga0105249_11527822 3300009553 Bacteria 740
29 Ga0105239_10272466 3300010375 Bacteria 1904
30 Ga0105239_10812833 3300010375 Bacteria 1071
31 Ga0105246_10009937 3300011119 Bacteria 5873
32 Ga0105246_10151800 3300011119 Bacteria 1754
33 Ga0157369_10173036 3300013105 Bacteria 2274
34 Ga0157375_10357744 3300013308 Bacteria 1626
35 Ga0157379_10019170 3300014968 Bacteria 6040
36 Ga0182006_1228168 3300015261 Bacteria 613
37 Ga0182007_10012765 3300015262 Bacteria 3224
38 Ga0183367_1005 3300015688 Bacteria 652063
39 Ga0256743_114181 3300023436 Bacteria 691
40 Ga0207710_10000043 3300025900 Bacteria 223494
41 Ga0207652_10762808 3300025921 Bacteria 860
42 Ga0207694_10187089 3300025924 Bacteria 1681
43 Ga0207650_10249358 3300025925 Bacteria 1437
44 Ga0207687_10160178 3300025927 Bacteria 1726
45 Ga0207664_10042448 3300025929 Bacteria 3550
46 Ga0207690_10000044 3300025932 Bacteria 119520
47 Ga0207709_10837350 3300025935 Bacteria 744
48 Ga0207704_10145151 3300025938 Bacteria 1666
49 Ga0207661_10260025 3300025944 Bacteria 1546
50 Ga0207712_11833623 3300025961 Bacteria 543
51 Ga0207640_10937064 3300025981 Bacteria 758
52 Ga0207703_10000047 3300026035 Bacteria 151177
53 Ga0207703_11416470 3300026035 Bacteria 668
54 Ga0207702_10141614 3300026078 Bacteria 2177
55 Ga0207641_10015821 3300026088 Bacteria 6178
56 Ga0207674_10278005 3300026116 Bacteria 1622
57 Ga0207675_100912057 3300026118 Bacteria 895
58 Ga0268266_10099931 3300028379 Bacteria 2555
59 Ga0307517_10004228 3300028786 Bacteria 22138
60 Ga0307515_10469128 3300028794 Bacteria 872
61 Ga0307512_10003998 3300030522 Bacteria 16470
62 Ga0307512_10041750 3300030522 Bacteria 3808
63 Ga0316180_1026849 3300030736 Bacteria 809
64 Ga0307513_10112871 3300031456 Bacteria 2706
65 Ga0307513_10124859 3300031456 Bacteria 2532
66 Ga0307513_10186179 3300031456 Bacteria 1933
67 Ga0307509_10079591 3300031507 Bacteria 3392
68 Ga0307508_10002228 3300031616 Bacteria 20649
69 Ga0307508_10023573 3300031616 Bacteria 5587
70 Ga0307508_10057651 3300031616 Bacteria 3437
71 Ga0307514_10029712 3300031649 Bacteria 4391
72 Ga0307516_10054511 3300031730 Bacteria 3906
73 Ga0307518_10405122 3300031838 Bacteria 758
74 Ga0307410_10094866 3300031852 Bacteria 2126
75 Ga0307407_10149325 3300031903 Bacteria 1517
76 Ga0307412_11355288 3300031911 Bacteria 642
77 Ga0307409_101687354 3300031995 Bacteria 662
78 Ga0307409_102012062 3300031995 Bacteria 607
79 Ga0307416_100105886 3300032002 Bacteria 2463
80 Ga0307507_10238867 3300033179 Bacteria 1192
81 Ga0307510_10061416 3300033180 Bacteria 3853
82 Ga0307510_10062678 3300033180 Bacteria 3797
83 Ga0395899_0990027 3300037312 Bacteria 508
84 Ga0395900_0732425 3300037418 Bacteria 920
85 Ga0395900_1079060 3300037418 Bacteria 721
86 Ga0395898_0033002 3300037466 Bacteria 5168
87 Ga0395898_0057468 3300037466 Bacteria 3791
88 Ga0439436_0000155 3300041404 Bacteria 15924
89 Ga0439436_0109006 3300041404 Bacteria 773
90 Ga0439439_0000634 3300041406 Bacteria 6191
91 Ga0439439_0011159 3300041406 Bacteria 2159
92 Ga0451789_0474917 3300041443 Bacteria 931
93 Ga0451795_1626403 3300041456 Bacteria 1064
94 Ga0451833_1125952 3300041491 Bacteria 619
95 Ga0451837_0705491 3300041494 Bacteria 1296
96 Ga0451841_0359667 3300041498 Bacteria 904
97 Ga0451849_1206378 3300041505 Bacteria 598
98 Ga0451843_0048382 3300041509 Bacteria 628
99 Ga0451853_0504098 3300041512 Bacteria 4847
100 Ga0439433_0013093 3300041999 Bacteria 1821
101 Ga0439442_001474 3300042002 Bacteria 4635
102 Ga0439448_0002169 3300042005 Bacteria 5291
103 Ga0439432_049506 3300042006 Bacteria 1313
104 Ga0439449_0004295 3300042007 Bacteria 5504
105 Ga0439449_0035924 3300042007 Bacteria 1843
106 Ga0439450_007379 3300042008 Bacteria 2012
107 Ga0439455_0003045 3300042012 Bacteria 3149
108 Ga0439462_0116110 3300042015 Bacteria 743
109 Ga0450894_000771 3300042131 Bacteria 5239
110 Ga0450895_023311 3300042132 Bacteria 582
111 Ga0450898_010795 3300042134 Bacteria 1485
112 Ga0450899_004764 3300042135 Bacteria 1455
113 Ga0450899_007649 3300042135 Bacteria 1178
114 Ga0450902_005486 3300042137 Bacteria 1919
115 Ga0450902_062565 3300042137 Bacteria 645
116 Ga0450903_001069 3300042138 Bacteria 5223
117 Ga0450906_000572 3300042145 Bacteria 7803
118 Ga0439458_0002661 3300042157 Bacteria 4308
119 Ga0450908_019314 3300042184 Bacteria 1200
120 Ga0466972_0032858 3300044658 Bacteria 2546
121 Ga0466965_0074196 3300044683 Bacteria 1714
122 Ga0466965_0529922 3300044683 Bacteria 663
123 Ga0466966_0116994 3300044684 Bacteria 1640
124 Ga0466961_0051996 3300044693 Bacteria 2615
125 Ga0466961_0611619 3300044693 Bacteria 655
126 Ga0466964_0624192 3300044706 Bacteria 593
127 Ga0466970_0129956 3300044765 Bacteria 1383
128 Ga0466970_0898827 3300044765 Bacteria 521
129 Ga0466957_0266183 3300044842 Bacteria 1143
130 Ga0466957_0648102 3300044842 Bacteria 742
131 Ga0466960_0001265 3300044901 Bacteria 9156
132 Ga0466967_0048963 3300045976 Bacteria 3694
133 Ga0466967_0675747 3300045976 Bacteria 1022
134 Ga0466967_1187278 3300045976 Bacteria 760
135 Ga0466967_1732690 3300045976 Bacteria 622
136 Ga0495617_012269 3300046452 Bacteria 2919
137 Ga0495617_075405 3300046452 Bacteria 1107
138 Ga0495627_019249 3300046453 Bacteria 2292
139 Ga0495592_0133434 3300046454 Bacteria 1734
140 Ga0495603_0000355 3300046455 Bacteria 24666
141 Ga0495603_0005381 3300046455 Bacteria 7636
142 Ga0495603_0013692 3300046455 Bacteria 4907
143 Ga0495603_0025456 3300046455 Bacteria 3578
144 Ga0495603_0026947 3300046455 Bacteria 3470
145 Ga0495603_0042304 3300046455 Bacteria 2723
146 Ga0495590_0093614 3300046457 Bacteria 1064
147 Ga0495629_0001035 3300046459 Bacteria 22290
148 Ga0495629_0012425 3300046459 Bacteria 6167
149 Ga0495629_0073127 3300046459 Bacteria 2394
150 Ga0495629_0088083 3300046459 Bacteria 2165
151 Ga0495629_0107800 3300046459 Bacteria 1943
152 Ga0495629_0255408 3300046459 Bacteria 1205
153 Ga0495629_0534703 3300046459 Bacteria 788
154 Ga0495638_0420180 3300046460 Bacteria 689
155 Ga0495580_0034883 3300046472 Bacteria 3619
156 Ga0495580_0613473 3300046472 Bacteria 718
157 Ga0495582_0210534 3300046473 Bacteria 1111
158 Ga0495605_0010274 3300046474 Bacteria 5241
159 Ga0495605_0053183 3300046474 Bacteria 1965
160 Ga0495605_0092183 3300046474 Bacteria 1403
161 Ga0495605_0138909 3300046474 Bacteria 1091
162 Ga0495605_0260774 3300046474 Bacteria 740
163 Ga0495639_0013177 3300046475 Bacteria 3567
164 Ga0495639_0682289 3300046475 Bacteria 530
165 Ga0495662_0027626 3300046476 Bacteria 2741
166 Ga0495662_0291089 3300046476 Bacteria 804
167 Ga0495584_0017576 3300046491 Bacteria 3639
168 Ga0495585_0047948 3300046492 Bacteria 2377
169 Ga0495585_0057641 3300046492 Bacteria 2143
170 Ga0495585_0073454 3300046492 Bacteria 1862
171 Ga0495594_0007683 3300046499 Bacteria 5548
172 Ga0495594_0022250 3300046499 Bacteria 3390
173 Ga0495594_0025289 3300046499 Bacteria 3191
174 Ga0495594_0048741 3300046499 Bacteria 2327
175 Ga0495594_0115962 3300046499 Bacteria 1512
176 Ga0495594_0242368 3300046499 Bacteria 1027
177 Ga0495594_0419278 3300046499 Bacteria 761
178 Ga0495594_0565905 3300046499 Bacteria 645
179 Ga0495596_0035561 3300046500 Bacteria 1975
180 Ga0495607_0033112 3300046501 Bacteria 3147
181 Ga0495607_0041200 3300046501 Bacteria 2744
182 Ga0495607_0132503 3300046501 Bacteria 1295
183 Ga0495583_0022351 3300046506 Bacteria 3228
184 Ga0495583_0031018 3300046506 Bacteria 2596
185 Ga0495583_0422830 3300046506 Bacteria 522
186 Ga0495606_0015975 3300046507 Bacteria 5750
187 Ga0495606_0081158 3300046507 Bacteria 2016
188 Ga0495610_0012903 3300046512 Bacteria 4997
189 Ga0495616_0020652 3300046513 Bacteria 3578
190 Ga0495616_0027956 3300046513 Bacteria 2989
191 Ga0495620_0025004 3300046515 Bacteria 2833
192 Ga0495620_0033298 3300046515 Bacteria 2340
193 Ga0495620_0040500 3300046515 Bacteria 2049
194 Ga0495631_0005586 3300046518 Bacteria 6571
195 Ga0495631_0052400 3300046518 Bacteria 1782
196 Ga0495631_0377462 3300046518 Bacteria 603
197 Ga0495637_0019615 3300046520 Bacteria 3123
198 Ga0495643_0002447 3300046522 Bacteria 14701
199 Ga0495648_0050618 3300046524 Bacteria 2536
200 Ga0495648_0196291 3300046524 Bacteria 1014
201 Ga0495648_0205568 3300046524 Bacteria 982
202 Ga0495648_0322249 3300046524 Bacteria 716
203 Ga0495666_0039153 3300046526 Bacteria 2302
204 Ga0495666_0206048 3300046526 Bacteria 903
205 Ga0495666_0416992 3300046526 Bacteria 602
206 Ga0495642_0027750 3300046528 Bacteria 2254
207 Ga0495652_0057838 3300046529 Bacteria 3286
208 Ga0495665_0204517 3300046531 Bacteria 1023
209 Ga0495640_0014735 3300046533 Bacteria 5906
210 Ga0495640_0060833 3300046533 Bacteria 2567
211 Ga0495587_0202755 3300046536 Bacteria 1121
212 Ga0495609_0004311 3300046538 Bacteria 7828
213 Ga0495597_0014308 3300046542 Bacteria 3780
214 Ga0495597_0032677 3300046542 Bacteria 2360
215 Ga0495597_0044276 3300046542 Bacteria 1979
216 Ga0495645_0073144 3300046543 Bacteria 2469
217 Ga0495645_0193973 3300046543 Bacteria 1382
218 Ga0495645_0281313 3300046543 Bacteria 1094
219 Ga0495622_0005411 3300046557 Bacteria 5926
220 Ga0495622_0009272 3300046557 Bacteria 4554
221 Ga0495622_0037771 3300046557 Bacteria 2249
222 Ga0495622_0062222 3300046557 Bacteria 1727
223 Ga0495633_0011090 3300046558 Bacteria 4887
224 Ga0495668_0013288 3300046616 Bacteria 4862
225 Ga0495668_0075558 3300046616 Bacteria 1850
226 Ga0495668_0129673 3300046616 Bacteria 1380
227 Ga0495634_0055037 3300046642 Bacteria 2661
228 Ga0495611_0029713 3300046648 Bacteria 2398
229 Ga0495611_0068683 3300046648 Bacteria 1617
230 Ga0495611_0109730 3300046648 Bacteria 1284
231 Ga0495611_0253151 3300046648 Bacteria 816
232 Ga0495625_0009658 3300046660 Bacteria 8042
233 Ga0495625_0017907 3300046660 Bacteria 5537
234 Ga0495625_0030011 3300046660 Bacteria 4060
235 Ga0495625_0099387 3300046660 Bacteria 2000
236 Ga0495625_0462253 3300046660 Bacteria 782
237 Ga0495625_0510733 3300046660 Bacteria 733
238 Ga0495625_0600712 3300046660 Bacteria 660
239 Ga0495659_0324934 3300046664 Bacteria 654
240 Ga0495661_0158633 3300046665 Bacteria 1216
241 Ga0495588_0037381 3300046674 Bacteria 2467
242 Ga0495588_0038950 3300046674 Bacteria 2420
243 Ga0495588_0064079 3300046674 Bacteria 1906
244 Ga0495588_0139937 3300046674 Bacteria 1278
245 Ga0495588_0198755 3300046674 Bacteria 1059
246 Ga0495657_0000588 3300046675 Bacteria 33293
247 Ga0495623_0016267 3300046679 Bacteria 4805
248 Ga0495613_0001027 3300046689 Bacteria 21287
249 Ga0495613_0436854 3300046689 Bacteria 888
250 Ga0495613_0777053 3300046689 Bacteria 626
251 Ga0495624_0018704 3300046690 Bacteria 4631
252 Ga0495624_0066009 3300046690 Bacteria 2259
253 Ga0495624_0267961 3300046690 Bacteria 1032
254 Ga0495670_0128232 3300046691 Bacteria 1321
255 Ga0495670_0251149 3300046691 Bacteria 943
256 Ga0495671_0200156 3300046692 Bacteria 969
257 Ga0495649_0022709 3300046694 Bacteria 3509
258 Ga0495649_0166280 3300046694 Bacteria 1155
259 Ga0495649_0285403 3300046694 Bacteria 843
260 Ga0495589_0008772 3300046794 Bacteria 5262
261 Ga0495589_0008951 3300046794 Bacteria 5209
262 Ga0495589_0014480 3300046794 Bacteria 4060
263 Ga0495589_0025117 3300046794 Bacteria 3024
264 Ga0495589_0036065 3300046794 Bacteria 2479
265 Ga0495589_0224737 3300046794 Bacteria 881
266 Ga0495600_0113539 3300046809 Bacteria 1764
267 Ga0495600_0115713 3300046809 Bacteria 1745
268 Ga0495660_0010352 3300046810 Bacteria 5423
269 Ga0495660_0347139 3300046810 Bacteria 660
270 Ga0495660_0453544 3300046810 Bacteria 554
271 Ga0495581_0041750 3300047315 Bacteria 2655
272 Ga0495581_0070516 3300047315 Bacteria 2021
273 Ga0495581_0115080 3300047315 Bacteria 1564
274 Ga0495581_0265620 3300047315 Bacteria 1003
275 Ga0495604_0001476 3300047317 Bacteria 19368
276 Ga0495604_0670076 3300047317 Bacteria 660
277 Ga0495636_0000631 3300047318 Bacteria 12908
278 Ga0495636_0004622 3300047318 Bacteria 5400
279 Ga0495636_0101284 3300047318 Bacteria 1260
280 Ga0495636_0478310 3300047318 Bacteria 600
281 Ga0495674_0336411 3300047319 Bacteria 1227
282 Ga0495672_0325643 3300047320 Bacteria 720
283 Ga0495676_0008441 3300047321 Bacteria 9440
284 Ga0495676_0012812 3300047321 Bacteria 7541
285 Ga0495676_0022216 3300047321 Bacteria 5524
286 Ga0495676_0046219 3300047321 Bacteria 3535
287 Ga0495680_0537182 3300047322 Bacteria 789
288 Ga0495683_0039868 3300047323 Bacteria 2373
289 Ga0495683_0138209 3300047323 Bacteria 1144
290 Ga0495683_0148406 3300047323 Bacteria 1093
291 Ga0495683_0209173 3300047323 Bacteria 875
292 Ga0495683_0214181 3300047323 Bacteria 862
293 Ga0495687_010067 3300047443 Bacteria 5217
294 Ga0495687_011644 3300047443 Bacteria 4711
295 Ga0495687_035740 3300047443 Bacteria 2230
296 Ga0495675_0021352 3300047444 Bacteria 4122
297 Ga0495675_0032220 3300047444 Bacteria 3344
298 Ga0495675_0074968 3300047444 Bacteria 2132
299 Ga0495675_0087070 3300047444 Bacteria 1963
300 Ga0495675_0594037 3300047444 Bacteria 628
301 Ga0495679_212738 3300047446 Bacteria 506
302 Ga0495685_000610 3300047447 Bacteria 10956
303 Ga0495685_000804 3300047447 Bacteria 9611
304 Ga0495685_001403 3300047447 Bacteria 7352
305 Ga0495685_005528 3300047447 Bacteria 4125
306 Ga0495685_007022 3300047447 Bacteria 3706
307 Ga0495685_016415 3300047447 Bacteria 2529
308 Ga0495685_023433 3300047447 Bacteria 2126
309 Ga0495685_039510 3300047447 Bacteria 1615
310 Ga0495685_280283 3300047447 Bacteria 525
311 Ga0495673_0196045 3300047469 Bacteria 758
312 Ga0495681_0000726 3300047470 Bacteria 25285
313 Ga0495681_0037966 3300047470 Bacteria 2366
314 Ga0495686_0060485 3300047472 Bacteria 2354
315 Ga0495686_0503488 3300047472 Bacteria 637
316 Ga0495593_0386847 3300047673 Bacteria 700
317 Ga0495614_0000167 3300048089 Bacteria 24146
318 Ga0495614_0043541 3300048089 Bacteria 1925
319 Ga0495614_0048703 3300048089 Bacteria 1817
320 Ga0495614_0538934 3300048089 Bacteria 557
321 Ga0495615_0239980 3300048090 Bacteria 571
322 Ga0495626_0021690 3300048091 Bacteria 3182
323 Ga0496100_0362402 3300048903 Bacteria 1097
324 Ga0496106_0416243 3300048909 Bacteria 1080
325 Ga0496109_0113417 3300048912 Bacteria 2521
326 Ga0496111_0963564 3300048914 Bacteria 612
327 Ga0501031_0043945 3300049568 Bacteria 2915
328 Ga0501031_0048085 3300049568 Bacteria 2781
329 Ga0501031_0100874 3300049568 Bacteria 1883
330 Ga0501031_0149550 3300049568 Bacteria 1525
331 Ga0501031_0242741 3300049568 Bacteria 1171
332 Ga0501031_0582657 3300049568 Bacteria 720
333 Ga0501032_0027355 3300049569 Bacteria 3919
334 Ga0501032_0069941 3300049569 Bacteria 2342
335 Ga0501032_0091464 3300049569 Bacteria 2018
336 Ga0501032_0214234 3300049569 Bacteria 1255
337 Ga0501033_0003052 3300049570 Bacteria 13922
338 Ga0501033_0034958 3300049570 Bacteria 3767
339 Ga0501033_0145988 3300049570 Bacteria 1708
340 Ga0501034_0013801 3300049571 Bacteria 8313
341 Ga0501034_0055011 3300049571 Bacteria 4005
342 Ga0501034_0064144 3300049571 Bacteria 3687
343 Ga0501034_0108452 3300049571 Bacteria 2768
344 Ga0501034_1432840 3300049571 Bacteria 565
345 Ga0501036_0008757 3300049572 Bacteria 8306
346 Ga0501036_0014869 3300049572 Bacteria 6494
347 Ga0501036_0017524 3300049572 Bacteria 5989
348 Ga0501036_0074791 3300049572 Bacteria 2865
349 Ga0501036_0198545 3300049572 Bacteria 1687
350 Ga0501037_0006884 3300049573 Bacteria 8305
351 Ga0501037_0574515 3300049573 Bacteria 759
352 Ga0501037_0674859 3300049573 Bacteria 689
353 Ga0501037_0884958 3300049573 Bacteria 586
354 Ga0501038_0021853 3300049574 Bacteria 5738
355 Ga0501038_0023916 3300049574 Bacteria 5455
356 Ga0501038_0039763 3300049574 Bacteria 4113
357 Ga0501038_0152181 3300049574 Bacteria 1885
358 Ga0501038_0730731 3300049574 Bacteria 740
359 Ga0501040_0009529 3300049576 Bacteria 6334
360 Ga0501040_0048360 3300049576 Bacteria 2907
361 Ga0501041_0006254 3300049577 Bacteria 6961
362 Ga0501042_0132926 3300049578 Bacteria 1793
363 Ga0501043_0008077 3300049579 Bacteria 8306
364 Ga0501043_0036286 3300049579 Bacteria 3877
365 Ga0501043_0071201 3300049579 Bacteria 2731
366 Ga0501043_0162920 3300049579 Bacteria 1742
367 Ga0501046_0162069 3300049580 Bacteria 1681
368 Ga0501047_0023179 3300049581 Bacteria 5960
369 Ga0501047_0037753 3300049581 Bacteria 4671
370 Ga0501047_0040211 3300049581 Bacteria 4523
371 Ga0501047_0053156 3300049581 Bacteria 3916
372 Ga0501047_0053190 3300049581 Bacteria 3914
373 Ga0501047_0076426 3300049581 Bacteria 3222
374 Ga0501047_0080554 3300049581 Bacteria 3129
375 Ga0501047_0135551 3300049581 Bacteria 2342
376 Ga0501047_0328180 3300049581 Bacteria 1369
377 Ga0501048_0326747 3300049582 Bacteria 1093
378 Ga0501067_0010274 3300049583 Bacteria 5178
379 Ga0501067_0268428 3300049583 Bacteria 950
380 Ga0501068_0013203 3300049584 Bacteria 4696
381 Ga0501068_0929631 3300049584 Bacteria 573
382 Ga0501068_1203361 3300049584 Bacteria 502
383 Ga0501069_0009511 3300049585 Bacteria 5130
384 Ga0501069_0773928 3300049585 Bacteria 581
385 Ga0501070_1295485 3300049586 Bacteria 556
386 Ga0501071_0006515 3300049587 Bacteria 7579
387 Ga0501072_0001094 3300049588 Bacteria 20145
388 Ga0501072_0776831 3300049588 Bacteria 751
389 Ga0501073_0056929 3300049589 Bacteria 2733
390 Ga0501074_0016968 3300049590 Bacteria 5282
391 Ga0501075_0367333 3300049591 Bacteria 1097
392 Ga0501076_0433889 3300049592 Bacteria 1081
393 Ga0501225_0054097 3300049705 Bacteria 1122
394 Ga0501079_0035753 3300049741 Bacteria 3824
395 Ga0501083_0016654 3300049744 Bacteria 5137
396 Ga0501282_000836 3300049778 Bacteria 3499
397 Ga0501035_0015824 3300049822 Bacteria 6961
398 Ga0501035_0021531 3300049822 Bacteria 5927
399 Ga0501035_0140259 3300049822 Bacteria 2102
400 Ga0501035_0177746 3300049822 Bacteria 1835
401 Ga0501044_0003080 3300049823 Bacteria 18878
402 Ga0501044_0011659 3300049823 Bacteria 9525
403 Ga0501044_0014528 3300049823 Bacteria 8493
404 Ga0501044_0153507 3300049823 Bacteria 2283
405 Ga0501044_0449966 3300049823 Bacteria 1195
406 Ga0501044_0472009 3300049823 Bacteria 1159
407 Ga0501044_1025586 3300049823 Bacteria 696
408 Ga0501044_1286200 3300049823 Bacteria 598
409 Ga0501045_0180318 3300049824 Bacteria 1574
410 Ga0501045_0351720 3300049824 Bacteria 1097
411 Ga0501212_113710 3300049851 Bacteria 519
412 nmdc:mga03n38_220503_c1 3300050490 Bacteria 990
413 nmdc:mga03n38_63635_c1 3300050490 Bacteria 1686
414 nmdc:mga06z11_9922_c1 3300050494 Bacteria 4034
415 nmdc:mga04h51_2471_c1 3300050495 Bacteria 4395
416 nmdc:mga07m45_572653_c1 3300050496 Bacteria 652
417 nmdc:mga05p37_1858867_c1 3300050507 Bacteria 578
418 nmdc:mga05p37_9549_c1 3300050507 Bacteria 11490
419 nmdc:mga09592_2956_c1 3300050508 Bacteria 13778
420 nmdc:mga0qj67_32411_c1 3300050509 Bacteria 4075
421 nmdc:mga06r32_15241_c1 3300050510 Bacteria 6982
422 nmdc:mga06r32_3598_c1 3300050510 Bacteria 13828
423 Ga0500644_0374475 3300053088 Bacteria 618
424 Ga0500573_0112006 3300053140 Bacteria 1526
425 Ga0500600_0192257 3300053149 Bacteria 970
426 Ga0500634_0308604 3300053161 Bacteria 624
427 Ga0501084_0004488 3300054114 Bacteria 11400
428 Ga0501082_0140722 3300060353 Bacteria 2094
429 Ga0466962_0005279 3300061719 Bacteria 6207
430 Ga0466962_0566214 3300061719 Bacteria 578
431 Ga0530510_0020138 3300061734 Bacteria 4743
432 Ga0530510_0350870 3300061734 Bacteria 1108
433 2554257247 2554235005 Bacteria 6457341
434 2585310188 2582581313 Bacteria 10042643
435 2643765146 2643221548 Bacteria 8053412
436 2643899208 2643221578 Bacteria 9213798
437 2643942458 2643221587 Bacteria 7586415
438 2644017078 2643221601 Bacteria 7493239
439 2644173961 2643221631 Bacteria 8168043
440 2644262516 2643221647 Bacteria 10741251
441 2644403391 2643221673 Bacteria 9196637
442 2644429539 2643221677 Bacteria 7584031
443 2644461015 2643221682 Bacteria 6743283
444 2676201185 2675902999 Bacteria 9438463
445 2686543455 2684623036 Bacteria 5199090
446 2689992226 2687453743 Bacteria 8361025
447 2710603417 2710264753 Bacteria 5455564
448 2774845761 2773857921 Bacteria 9435764
449 2774854028 2773857922 Bacteria 9757215
450 2785343123 2784746763 Bacteria 9783172
451 2785369699 2784746768 Bacteria 10036182
452 2786670783 2786546132 Bacteria 10419719
453 2793979387 2791355406 Bacteria 11364898
454 2808842211 2808606359 Bacteria 9866990
455 2819695584 2818991463 Bacteria 7948711
456 2819741234 2818991472 Bacteria 10089953
457 2831937130 2831935698 Bacteria 5963223
458 2858902739 2858902515 Bacteria 7086037
459 2862179327 2862178590 Bacteria 8583590
460 2862285819 2862281513 Bacteria 9621493
461 2862297012 2862290372 Bacteria 7471434
462 2862391604 2862382967 Bacteria 10317375
463 2862511636 2862507626 Bacteria 9425308
464 2862579072 2862574272 Bacteria 10567477
465 2863404411 2863404153 Bacteria 9672205
466 2867372028 2867369537 Bacteria 6501581
467 2867436904 2867428634 Bacteria 9590268
468 2873155558 2873151551 Bacteria 8625867
469 2877680931 2877676314 Bacteria 9512378
470 2887486553 2887478801 Bacteria 8972725
471 2912719776 2912715099 Bacteria 9460473
472 2918505405 2918501144 Bacteria 8668083
473 2919469373 2919468124 Bacteria 9133025
474 2954386043 2954380949 Bacteria 10050426
475 2954677109 2954673503 Bacteria 9685905
476 2954687047 2954682443 Bacteria 9862841
477 2954696690 2954691527 Bacteria 10720516
478 2954705471 2954701450 Bacteria 10834262
479 2954716042 2954711539 Bacteria 10867210
480 2954725987 2954721474 Bacteria 10456478
481 2954735814 2954731030 Bacteria 10243860
482 2954744923 2954740390 Bacteria 10229294
483 2954754680 2954749733 Bacteria 10366972
484 2966601841 2966598605 Bacteria 7676064
485 2990065937 2990059506 Bacteria 9321252
486 2997604957 2997600082 Bacteria 9896405
487 3006397368 3006393351 Bacteria 6615579
488 3006428848 3006425503 Bacteria 6491253
489 3006500919 3006493962 Bacteria 8825450
490 8008567072 8008558824 Bacteria 10610750
491 8008578736 8008574985 Bacteria 7815457
492 8025418283 8025413630 Bacteria 7014048
493 8047897202 8047893842 Bacteria 11723082
494 8048133541 8048127548 Bacteria 11053136
495 8048361750 8048356638 Bacteria 11044339
496 8048374185 8048369669 Bacteria 11666822
497 8048384041 8048379754 Bacteria 11877923
498 8048412322 8048406513 Bacteria 8936924
499 8056835208 8056829672 Bacteria 9045328
500 8057570560 8057568493 Bacteria 7221719
501 Ga0451853_2154048
502 Ga0070683_100540503
503 Ga0070660_100394258
504 Ga0070659_100000059
505 Ga0070681_11099475
506 Ga0070698_100586515
507 Ga0070679_101047644
508 Ga0070686_101368845
509 Ga0070665_100708334
510 Ga0070664_101214444
511 Ga0068856_100105884
512 Ga0070702_100582243
513 Ga0068863_100003672
514 Ga0081455_10000239
515 Ga0081455_10510498
516 Ga0075363_100043958
517 Ga0075363_100051732
518 Ga0075428_100674240
519 Ga0099826_10204185
520 Ga0105251_10003100
521 Ga0105250_10199815
522 Ga0105245_10468510
523 Ga0105247_10001043
524 Ga0114129_10006514
525 Ga0105243_12136101
526 Ga0105242_12485195
527 Ga0105249_11322463
528 Ga0105249_11527822
529 Ga0105239_10272466
530 Ga0105239_10812833
531 Ga0105246_10009937
532 Ga0105246_10151800
533 Ga0157369_10173036
534 Ga0157375_10357744
535 Ga0157379_10019170
536 Ga0182006_1228168
537 Ga0182007_10012765
538 Ga0183367_1005
539 Ga0256743_114181
540 Ga0207710_10000043
541 Ga0207652_10762808
542 Ga0207694_10187089
543 Ga0207650_10249358
544 Ga0207687_10160178
545 Ga0207664_10042448
546 Ga0207690_10000044
547 Ga0207709_10837350
548 Ga0207704_10145151
549 Ga0207661_10260025
550 Ga0207712_11833623
551 Ga0207640_10937064
552 Ga0207703_10000047
553 Ga0207703_11416470
554 Ga0207702_10141614
555 Ga0207641_10015821
556 Ga0207674_10278005
557 Ga0207675_100912057
558 Ga0268266_10099931
559 Ga0307517_10004228
560 Ga0307515_10469128
561 Ga0307512_10003998
562 Ga0307512_10041750
563 Ga0316180_1026849
564 Ga0307513_10112871
565 Ga0307513_10124859
566 Ga0307513_10186179
567 Ga0307509_10079591
568 Ga0307508_10002228
569 Ga0307508_10023573
570 Ga0307508_10057651
571 Ga0307514_10029712
572 Ga0307516_10054511
573 Ga0307518_10405122
574 Ga0307410_10094866
575 Ga0307407_10149325
576 Ga0307412_11355288
577 Ga0307409_101687354
578 Ga0307409_102012062
579 Ga0307416_100105886
580 Ga0307507_10238867
581 Ga0307510_10061416
582 Ga0307510_10062678
583 Ga0395899_0990027
584 Ga0395900_0732425
585 Ga0395900_1079060
586 Ga0395898_0033002
587 Ga0395898_0057468
588 Ga0439436_0000155
589 Ga0439436_0109006
590 Ga0439439_0000634
591 Ga0439439_0011159
592 Ga0451789_0474917
593 Ga0451795_1626403
594 Ga0451833_1125952
595 Ga0451837_0705491
596 Ga0451841_0359667
597 Ga0451849_1206378
598 Ga0451843_0048382
599 Ga0451853_0504098
600 Ga0439433_0013093
601 Ga0439442_001474
602 Ga0439448_0002169
603 Ga0439432_049506
604 Ga0439449_0004295
605 Ga0439449_0035924
606 Ga0439450_007379
607 Ga0439455_0003045
608 Ga0439462_0116110
609 Ga0450894_000771
610 Ga0450895_023311
611 Ga0450898_010795
612 Ga0450899_004764
613 Ga0450899_007649
614 Ga0450902_005486
615 Ga0450902_062565
616 Ga0450903_001069
617 Ga0450906_000572
618 Ga0439458_0002661
619 Ga0450908_019314
620 Ga0466972_0032858
621 Ga0466965_0074196
622 Ga0466965_0529922
623 Ga0466966_0116994
624 Ga0466961_0051996
625 Ga0466961_0611619
626 Ga0466964_0624192
627 Ga0466970_0129956
628 Ga0466970_0898827
629 Ga0466957_0266183
630 Ga0466957_0648102
631 Ga0466960_0001265
632 Ga0466967_0048963
633 Ga0466967_0675747
634 Ga0466967_1187278
635 Ga0466967_1732690
636 Ga0495617_012269
637 Ga0495617_075405
638 Ga0495627_019249
639 Ga0495592_0133434
640 Ga0495603_0000355
641 Ga0495603_0005381
642 Ga0495603_0013692
643 Ga0495603_0025456
644 Ga0495603_0026947
645 Ga0495603_0042304
646 Ga0495590_0093614
647 Ga0495629_0001035
648 Ga0495629_0012425
649 Ga0495629_0073127
650 Ga0495629_0088083
651 Ga0495629_0107800
652 Ga0495629_0255408
653 Ga0495629_0534703
654 Ga0495638_0420180
655 Ga0495580_0034883
656 Ga0495580_0613473
657 Ga0495582_0210534
658 Ga0495605_0010274
659 Ga0495605_0053183
660 Ga0495605_0092183
661 Ga0495605_0138909
662 Ga0495605_0260774
663 Ga0495639_0013177
664 Ga0495639_0682289
665 Ga0495662_0027626
666 Ga0495662_0291089
667 Ga0495584_0017576
668 Ga0495585_0047948
669 Ga0495585_0057641
670 Ga0495585_0073454
671 Ga0495594_0007683
672 Ga0495594_0022250
673 Ga0495594_0025289
674 Ga0495594_0048741
675 Ga0495594_0115962
676 Ga0495594_0242368
677 Ga0495594_0419278
678 Ga0495594_0565905
679 Ga0495596_0035561
680 Ga0495607_0033112
681 Ga0495607_0041200
682 Ga0495607_0132503
683 Ga0495583_0022351
684 Ga0495583_0031018
685 Ga0495583_0422830
686 Ga0495606_0015975
687 Ga0495606_0081158
688 Ga0495610_0012903
689 Ga0495616_0020652
690 Ga0495616_0027956
691 Ga0495620_0025004
692 Ga0495620_0033298
693 Ga0495620_0040500
694 Ga0495631_0005586
695 Ga0495631_0052400
696 Ga0495631_0377462
697 Ga0495637_0019615
698 Ga0495643_0002447
699 Ga0495648_0050618
700 Ga0495648_0196291
701 Ga0495648_0205568
702 Ga0495648_0322249
703 Ga0495666_0039153
704 Ga0495666_0206048
705 Ga0495666_0416992
706 Ga0495642_0027750
707 Ga0495652_0057838
708 Ga0495665_0204517
709 Ga0495640_0014735
710 Ga0495640_0060833
711 Ga0495587_0202755
712 Ga0495609_0004311
713 Ga0495597_0014308
714 Ga0495597_0032677
715 Ga0495597_0044276
716 Ga0495645_0073144
717 Ga0495645_0193973
718 Ga0495645_0281313
719 Ga0495622_0005411
720 Ga0495622_0009272
721 Ga0495622_0037771
722 Ga0495622_0062222
723 Ga0495633_0011090
724 Ga0495668_0013288
725 Ga0495668_0075558
726 Ga0495668_0129673
727 Ga0495634_0055037
728 Ga0495611_0029713
729 Ga0495611_0068683
730 Ga0495611_0109730
731 Ga0495611_0253151
732 Ga0495625_0009658
733 Ga0495625_0017907
734 Ga0495625_0030011
735 Ga0495625_0099387
736 Ga0495625_0462253
737 Ga0495625_0510733
738 Ga0495625_0600712
739 Ga0495659_0324934
740 Ga0495661_0158633
741 Ga0495588_0037381
742 Ga0495588_0038950
743 Ga0495588_0064079
744 Ga0495588_0139937
745 Ga0495588_0198755
746 Ga0495657_0000588
747 Ga0495623_0016267
748 Ga0495613_0001027
749 Ga0495613_0436854
750 Ga0495613_0777053
751 Ga0495624_0018704
752 Ga0495624_0066009
753 Ga0495624_0267961
754 Ga0495670_0128232
755 Ga0495670_0251149
756 Ga0495671_0200156
757 Ga0495649_0022709
758 Ga0495649_0166280
759 Ga0495649_0285403
760 Ga0495589_0008772
761 Ga0495589_0008951
762 Ga0495589_0014480
763 Ga0495589_0025117
764 Ga0495589_0036065
765 Ga0495589_0224737
766 Ga0495600_0113539
767 Ga0495600_0115713
768 Ga0495660_0010352
769 Ga0495660_0347139
770 Ga0495660_0453544
771 Ga0495581_0041750
772 Ga0495581_0070516
773 Ga0495581_0115080
774 Ga0495581_0265620
775 Ga0495604_0001476
776 Ga0495604_0670076
777 Ga0495636_0000631
778 Ga0495636_0004622
779 Ga0495636_0101284
780 Ga0495636_0478310
781 Ga0495674_0336411
782 Ga0495672_0325643
783 Ga0495676_0008441
784 Ga0495676_0012812
785 Ga0495676_0022216
786 Ga0495676_0046219
787 Ga0495680_0537182
788 Ga0495683_0039868
789 Ga0495683_0138209
790 Ga0495683_0148406
791 Ga0495683_0209173
792 Ga0495683_0214181
793 Ga0495687_010067
794 Ga0495687_011644
795 Ga0495687_035740
796 Ga0495675_0021352
797 Ga0495675_0032220
798 Ga0495675_0074968
799 Ga0495675_0087070
800 Ga0495675_0594037
801 Ga0495679_212738
802 Ga0495685_000610
803 Ga0495685_000804
804 Ga0495685_001403
805 Ga0495685_005528
806 Ga0495685_007022
807 Ga0495685_016415
808 Ga0495685_023433
809 Ga0495685_039510
810 Ga0495685_280283
811 Ga0495673_0196045
812 Ga0495681_0000726
813 Ga0495681_0037966
814 Ga0495686_0060485
815 Ga0495686_0503488
816 Ga0495593_0386847
817 Ga0495614_0000167
818 Ga0495614_0043541
819 Ga0495614_0048703
820 Ga0495614_0538934
821 Ga0495615_0239980
822 Ga0495626_0021690
823 Ga0496100_0362402
824 Ga0496106_0416243
825 Ga0496109_0113417
826 Ga0496111_0963564
827 Ga0501031_0043945
828 Ga0501031_0048085
829 Ga0501031_0100874
830 Ga0501031_0149550
831 Ga0501031_0242741
832 Ga0501031_0582657
833 Ga0501032_0027355
834 Ga0501032_0069941
835 Ga0501032_0091464
836 Ga0501032_0214234
837 Ga0501033_0003052
838 Ga0501033_0034958
839 Ga0501033_0145988
840 Ga0501034_0013801
841 Ga0501034_0055011
842 Ga0501034_0064144
843 Ga0501034_0108452
844 Ga0501034_1432840
845 Ga0501036_0008757
846 Ga0501036_0014869
847 Ga0501036_0017524
848 Ga0501036_0074791
849 Ga0501036_0198545
850 Ga0501037_0006884
851 Ga0501037_0574515
852 Ga0501037_0674859
853 Ga0501037_0884958
854 Ga0501038_0021853
855 Ga0501038_0023916
856 Ga0501038_0039763
857 Ga0501038_0152181
858 Ga0501038_0730731
859 Ga0501040_0009529
860 Ga0501040_0048360
861 Ga0501041_0006254
862 Ga0501042_0132926
863 Ga0501043_0008077
864 Ga0501043_0036286
865 Ga0501043_0071201
866 Ga0501043_0162920
867 Ga0501046_0162069
868 Ga0501047_0023179
869 Ga0501047_0037753
870 Ga0501047_0040211
871 Ga0501047_0053156
872 Ga0501047_0053190
873 Ga0501047_0076426
874 Ga0501047_0080554
875 Ga0501047_0135551
876 Ga0501047_0328180
877 Ga0501048_0326747
878 Ga0501067_0010274
879 Ga0501067_0268428
880 Ga0501068_0013203
881 Ga0501068_0929631
882 Ga0501068_1203361
883 Ga0501069_0009511
884 Ga0501069_0773928
885 Ga0501070_1295485
886 Ga0501071_0006515
887 Ga0501072_0001094
888 Ga0501072_0776831
889 Ga0501073_0056929
890 Ga0501074_0016968
891 Ga0501075_0367333
892 Ga0501076_0433889
893 Ga0501225_0054097
894 Ga0501079_0035753
895 Ga0501083_0016654
896 Ga0501282_000836
897 Ga0501035_0015824
898 Ga0501035_0021531
899 Ga0501035_0140259
900 Ga0501035_0177746
901 Ga0501044_0003080
902 Ga0501044_0011659
903 Ga0501044_0014528
904 Ga0501044_0153507
905 Ga0501044_0449966
906 Ga0501044_0472009
907 Ga0501044_1025586
908 Ga0501044_1286200
909 Ga0501045_0180318
910 Ga0501045_0351720
911 Ga0501212_113710
912 nmdc:mga03n38_220503_c1
913 nmdc:mga03n38_63635_c1
914 nmdc:mga06z11_9922_c1
915 nmdc:mga04h51_2471_c1
916 nmdc:mga07m45_572653_c1
917 nmdc:mga05p37_1858867_c1
918 nmdc:mga05p37_9549_c1
919 nmdc:mga09592_2956_c1
920 nmdc:mga0qj67_32411_c1
921 nmdc:mga06r32_15241_c1
922 nmdc:mga06r32_3598_c1
923 Ga0500644_0374475
924 Ga0500573_0112006
925 Ga0500600_0192257
926 Ga0500634_0308604
927 Ga0501084_0004488
928 Ga0501082_0140722
929 Ga0466962_0005279
930 Ga0466962_0566214
931 Ga0530510_0020138
932 Ga0530510_0350870
933 2554257247
934 2585310188
935 2643765146
936 2643899208
937 2643942458
938 2644017078
939 2644173961
940 2644262516
941 2644403391
942 2644429539
943 2644461015
944 2676201185
945 2686543455
946 2689992226
947 2710603417
948 2774845761
949 2774854028
950 2785343123
951 2785369699
952 2786670783
953 2793979387
954 2808842211
955 2819695584
956 2819741234
957 2831937130
958 2858902739
959 2862179327
960 2862285819
961 2862297012
962 2862391604
963 2862511636
964 2862579072
965 2863404411
966 2867372028
967 2867436904
968 2873155558
969 2877680931
970 2887486553
971 2912719776
972 2918505405
973 2919469373
974 2954386043
975 2954677109
976 2954687047
977 2954696690
978 2954705471
979 2954716042
980 2954725987
981 2954735814
982 2954744923
983 2954754680
984 2966601841
985 2990065937
986 2997604957
987 3006397368
988 3006428848
989 3006500919
990 8008567072
991 8008578736
992 8025418283
993 8047897202
994 8048133541
995 8048361750
996 8048374185
997 8048384041
998 8048412322
999 8056835208
1000 8057570560

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02635

DsrE

DsrE/DsrF-like family

18

129

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1jx7-assembly1.cif.gz_E crystal structure of ychn protein from e.coli 0.8133 3 110
3mc3-assembly1.cif.gz_A crystal structure of dsre/dsrf-like family protein (np_342589.1) from sulfolobus solfataricus at 1.49 a resolution 0.7972 1 110
1jx7-assembly1.cif.gz_E crystal structure of ychn protein from e.coli 0.7936 3 110
3mc3-assembly1.cif.gz_A crystal structure of dsre/dsrf-like family protein (np_342589.1) from sulfolobus solfataricus at 1.49 a resolution 0.7908 1 110
3pnx-assembly2.cif.gz_E crystal structure of a putative sulfurtransferase dsre (swol_2425) from syntrophomonas wolfei str. goettingen at 1.92 a resolution 0.7828 3 110
ID Description Score Start End Superfamily
af_Q58170_143_270_3.40.1260.10 Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like 0.8571 2 104 3.40.1260.10
af_Q6NUS8_20_226_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8238 2 43 3.40.50.2000
af_P0AB52_1_117_3.40.1260.10 Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like 0.8147 3 110 3.40.1260.10
af_Q58396_1_114_3.40.1260.10 Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like 0.8045 4 107 3.40.1260.10
af_Q58170_143_270_3.40.1260.10 Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like 0.8013 2 104 3.40.1260.10
ID Description Score Start End GO Terms
AF-A0A7K2WQB2-F1-model_v4 Sulfur reduction protein DsrE 0.9341 1 110
AF-A0A1D8G2K5-F1-model_v4 DsrE/DsrF-like family protein 0.933 1 110
AF-A0A7H8KVW9-F1-model_v4 DsrE family protein 0.9305 1 110
AF-A0A2N0FI13-F1-model_v4 deleted 0.9299 1 110
AF-A0A0N0MWG2-F1-model_v4 DsrE family protein 0.9297 1 110

Map