F455572

General Info

Members Datasets Scaffolds Average Seq Length
500 252 495 385

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_0945769|Ga0436364_0945769_44_1366
Length 440
Sequence MQIFGVTAMTRSLPPVPLCYILSRGTAAVTDTRKRGIAHVSVLITNIAELITNQPERDASPQPATTGPAGFAAMAGAALVIDQGRVAWTGPASRAPAADELVDAEGRAVLPGFGDSHAHLVFAGERGAEFAARMAGQPYRAGGIRSTVAATRAATDDQLRASLRRLTAEMLVQGITTFECKSGYGLTVADEARGLAIAAEFTAEVTYLGAHVVPPEYAADPVGYVDVVCGPMLAACAPSARWVDVFCERGAFGADEAAAVLAAGRAAGLMARVHAGQLGPGPGVQVAAEAGAASADHCTFLTDADVDALVSTPVVATLLPGVEFSCRHPFPPARRLLDAGATVALATDCNPGSSFTSSMSFCIALAVRDMRMTTQEAVWAATAGGAAALRRADVGHLGVGARADLIMLDAPSHAYLAYRPGAPQITAVWQAGRLAAGSLP

Samples

Sample ID Description Type Environment
1 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
2 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
3 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
4 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified
5 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
75 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
76 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
123 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
124 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
125 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
126 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
127 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
128 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
129 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
130 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
131 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
132 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
133 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
134 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
135 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
136 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
137 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
138 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
139 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
140 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
141 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
142 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
143 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
144 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
145 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
146 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
147 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
148 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
149 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
150 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
151 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
152 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
153 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
154 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
155 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
156 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
157 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
160 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
161 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
162 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
163 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
164 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
165 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
166 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
167 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
168 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
169 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
170 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
171 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
172 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
173 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
174 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
175 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
176 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
177 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
178 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
179 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
180 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
181 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
182 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
183 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
184 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
185 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
186 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
187 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
188 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
189 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
190 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
191 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
192 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
193 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
194 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
195 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
196 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
197 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
198 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
199 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
200 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
201 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
202 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
203 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
204 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
205 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
206 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
207 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
208 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
209 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
210 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
211 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
212 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
213 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
214 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
215 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
216 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
217 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
218 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
219 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
220 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
221 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
222 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
223 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
224 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
225 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
226 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
227 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
228 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
229 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
230 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
231 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
241 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
242 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
243 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
244 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
245 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
246 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
247 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
248 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
249 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
250 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
251 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
252 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.6
Metatranscriptomes 0.4
Isolates 1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.4
Rhizosphere 92.6
Stem 0
Stem Tuber 0
Unclassified 3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10041115 3300005327 Bacteria 3730
2 Ga0070683_100150639 3300005329 Bacteria 2205
3 Ga0070683_100207626 3300005329 Bacteria 1860
4 Ga0070666_10160993 3300005335 Bacteria 1569
5 Ga0070682_100032303 3300005337 Bacteria 3172
6 Ga0070668_100008403 3300005347 Bacteria 7667
7 Ga0070675_100124221 3300005354 Bacteria 2195
8 Ga0070667_100030646 3300005367 Bacteria 4486
9 Ga0070714_100035809 3300005435 Bacteria 4160
10 Ga0070714_100104295 3300005435 Bacteria 2502
11 Ga0070713_100036855 3300005436 Bacteria 3950
12 Ga0070713_100054510 3300005436 Bacteria 3318
13 Ga0070701_10056409 3300005438 Bacteria 2055
14 Ga0070705_100075380 3300005440 Bacteria 2054
15 Ga0070700_100083055 3300005441 Bacteria 2073
16 Ga0070708_100047105 3300005445 Bacteria 3807
17 Ga0070708_100198917 3300005445 Bacteria 1875
18 Ga0070663_100011294 3300005455 Bacteria 5599
19 Ga0070663_100092515 3300005455 Bacteria 2242
20 Ga0070706_100007355 3300005467 Bacteria 10329
21 Ga0070706_100022502 3300005467 Bacteria 5801
22 Ga0070706_100024348 3300005467 Bacteria 5573
23 Ga0070707_100000127 3300005468 Bacteria 71273
24 Ga0070707_100026352 3300005468 Bacteria 5519
25 Ga0070707_100028389 3300005468 Bacteria 5325
26 Ga0070707_100038237 3300005468 Bacteria 4583
27 Ga0070707_100110711 3300005468 Bacteria 2663
28 Ga0070707_100188278 3300005468 Bacteria 2012
29 Ga0070698_100002176 3300005471 Bacteria 21732
30 Ga0070698_100006322 3300005471 Bacteria 12864
31 Ga0070698_100007131 3300005471 Bacteria 12105
32 Ga0070698_100024280 3300005471 Bacteria 6325
33 Ga0070698_100026259 3300005471 Bacteria 6063
34 Ga0070698_100032101 3300005471 Bacteria 5441
35 Ga0070698_100177106 3300005471 Bacteria 2072
36 Ga0070699_100001261 3300005518 Bacteria 23319
37 Ga0070697_100001637 3300005536 Bacteria 17073
38 Ga0068853_100121804 3300005539 Bacteria 2327
39 Ga0068853_100154767 3300005539 Bacteria 2065
40 Ga0070672_100054188 3300005543 Bacteria 3139
41 Ga0070686_100116864 3300005544 Bacteria 1826
42 Ga0070686_100179842 3300005544 Bacteria 1502
43 Ga0070695_100005806 3300005545 Bacteria 7274
44 Ga0070693_100003357 3300005547 Bacteria 7444
45 Ga0070665_100216353 3300005548 Bacteria 1917
46 Ga0070704_100031657 3300005549 Bacteria 3560
47 Ga0068855_100005745 3300005563 Bacteria 15151
48 Ga0068855_100026813 3300005563 Bacteria 6893
49 Ga0068857_100210552 3300005577 Bacteria 1774
50 Ga0068854_100015854 3300005578 Bacteria 5007
51 Ga0068854_100024394 3300005578 Bacteria 4141
52 Ga0068856_100041921 3300005614 Bacteria 4500
53 Ga0068856_100049655 3300005614 Bacteria 4135
54 Ga0070702_100025554 3300005615 Bacteria 3166
55 Ga0068852_100008996 3300005616 Bacteria 7393
56 Ga0068864_100230840 3300005618 Bacteria 1711
57 Ga0068866_10030764 3300005718 Bacteria 2580
58 Ga0068861_100006598 3300005719 Bacteria 7918
59 Ga0068863_100031901 3300005841 Bacteria 5025
60 Ga0068863_100075836 3300005841 Bacteria 3181
61 Ga0081540_1000330 3300005983 Bacteria 49099
62 Ga0081540_1001333 3300005983 Bacteria 21517
63 Ga0081540_1004059 3300005983 Bacteria 11337
64 Ga0070717_10006637 3300006028 Bacteria 8527
65 Ga0070717_10009856 3300006028 Bacteria 7196
66 Ga0070717_10016074 3300006028 Bacteria 5796
67 Ga0070717_10038633 3300006028 Bacteria 3880
68 Ga0070717_10045841 3300006028 Bacteria 3576
69 Ga0070717_10083147 3300006028 Bacteria 2691
70 Ga0070717_10242569 3300006028 Bacteria 1590
71 Ga0070715_10091069 3300006163 Bacteria 1404
72 Ga0070716_100017239 3300006173 Bacteria 3740
73 Ga0097621_100128278 3300006237 Bacteria 2156
74 Ga0068871_100060653 3300006358 Bacteria 3086
75 Ga0075430_100000490 3300006846 Bacteria 29713
76 Ga0075433_10031189 3300006852 Bacteria 4555
77 Ga0075434_100330623 3300006871 Bacteria 1544
78 Ga0075429_100114407 3300006880 Bacteria 2358
79 Ga0068865_100004755 3300006881 Bacteria 8208
80 Ga0105240_10023497 3300009093 Bacteria 8149
81 Ga0105240_10043032 3300009093 Bacteria 5750
82 Ga0105245_10009193 3300009098 Bacteria 8617
83 Ga0105247_10111276 3300009101 Bacteria 1763
84 Ga0114129_10007478 3300009147 Bacteria 15556
85 Ga0105243_10011774 3300009148 Bacteria 6614
86 Ga0105243_10154045 3300009148 Bacteria 1974
87 Ga0105241_10022072 3300009174 Bacteria 4712
88 Ga0105238_10042986 3300009551 Bacteria 4573
89 Ga0105249_10003157 3300009553 Bacteria 14255
90 Ga0105239_10017809 3300010375 Bacteria 7860
91 Ga0105239_10231708 3300010375 Bacteria 2072
92 Ga0105246_10119137 3300011119 Bacteria 1953
93 Ga0157342_1000452 3300012507 Bacteria 2495
94 Ga0157371_10100650 3300013102 Bacteria 2050
95 Ga0157369_10171586 3300013105 Bacteria 2285
96 Ga0157378_10074156 3300013297 Bacteria 3061
97 Ga0163162_10015180 3300013306 Bacteria 7523
98 Ga0157372_10000131 3300013307 Bacteria 82235
99 Ga0163163_10010070 3300014325 Bacteria 8481
100 Ga0157380_10252806 3300014326 Bacteria 1596
101 Ga0157379_10037848 3300014968 Bacteria 4303
102 Ga0206354_10747477 3300020081 Bacteria 1548
103 Ga0206353_11505314 3300020082 Bacteria 1805
104 Ga0213875_10000678 3300021388 Bacteria 26732
105 Ga0224572_1005226 3300024225 Bacteria 2306
106 Ga0207653_10038100 3300025885 Bacteria 1570
107 Ga0207692_10014046 3300025898 Bacteria 3490
108 Ga0207642_10051667 3300025899 Bacteria 1861
109 Ga0207688_10005592 3300025901 Bacteria 6836
110 Ga0207647_10005590 3300025904 Bacteria 9188
111 Ga0207647_10007869 3300025904 Bacteria 7665
112 Ga0207699_10050424 3300025906 Bacteria 2454
113 Ga0207699_10079305 3300025906 Bacteria 2031
114 Ga0207643_10075290 3300025908 Bacteria 1948
115 Ga0207684_10003975 3300025910 Bacteria 14150
116 Ga0207684_10006661 3300025910 Bacteria 10496
117 Ga0207684_10009113 3300025910 Bacteria 8790
118 Ga0207684_10056121 3300025910 Bacteria 3341
119 Ga0207684_10110735 3300025910 Bacteria 2350
120 Ga0207654_10014199 3300025911 Bacteria 4112
121 Ga0207695_10002554 3300025913 Bacteria 26745
122 Ga0207671_10000977 3300025914 Bacteria 35439
123 Ga0207671_10024070 3300025914 Bacteria 4583
124 Ga0207693_10000501 3300025915 Bacteria 35426
125 Ga0207693_10009125 3300025915 Bacteria 8096
126 Ga0207693_10022983 3300025915 Bacteria 4951
127 Ga0207693_10025404 3300025915 Bacteria 4697
128 Ga0207663_10012996 3300025916 Bacteria 4515
129 Ga0207663_10040719 3300025916 Bacteria 2826
130 Ga0207663_10056673 3300025916 Bacteria 2466
131 Ga0207662_10002856 3300025918 Bacteria 8742
132 Ga0207657_10004089 3300025919 Bacteria 15484
133 Ga0207657_10032882 3300025919 Bacteria 4680
134 Ga0207657_10188860 3300025919 Bacteria 1663
135 Ga0207646_10000264 3300025922 Bacteria 71299
136 Ga0207646_10000950 3300025922 Bacteria 37311
137 Ga0207646_10004889 3300025922 Bacteria 14354
138 Ga0207646_10010958 3300025922 Bacteria 8803
139 Ga0207646_10031594 3300025922 Bacteria 4794
140 Ga0207646_10045197 3300025922 Bacteria 3953
141 Ga0207646_10061401 3300025922 Bacteria 3355
142 Ga0207646_10156075 3300025922 Bacteria 2058
143 Ga0207646_10198592 3300025922 Bacteria 1811
144 Ga0207694_10001130 3300025924 Bacteria 23081
145 Ga0207659_10131295 3300025926 Bacteria 1934
146 Ga0207700_10022592 3300025928 Bacteria 4320
147 Ga0207700_10048206 3300025928 Bacteria 3162
148 Ga0207700_10100662 3300025928 Bacteria 2304
149 Ga0207664_10029453 3300025929 Bacteria 4182
150 Ga0207644_10022132 3300025931 Bacteria 4340
151 Ga0207690_10091442 3300025932 Bacteria 2151
152 Ga0207706_10040560 3300025933 Bacteria 4126
153 Ga0207709_10198195 3300025935 Bacteria 1432
154 Ga0207670_10147772 3300025936 Bacteria 1740
155 Ga0207665_10002286 3300025939 Bacteria 12935
156 Ga0207665_10005974 3300025939 Bacteria 8096
157 Ga0207665_10183000 3300025939 Bacteria 1518
158 Ga0207665_10226414 3300025939 Bacteria 1373
159 Ga0207691_10028692 3300025940 Bacteria 5208
160 Ga0207689_10033087 3300025942 Bacteria 4296
161 Ga0207689_10054359 3300025942 Bacteria 3297
162 Ga0207661_10137477 3300025944 Bacteria 2100
163 Ga0207679_10102932 3300025945 Bacteria 2237
164 Ga0207679_10263262 3300025945 Bacteria 1472
165 Ga0207667_10035927 3300025949 Bacteria 5314
166 Ga0207651_10283781 3300025960 Bacteria 1370
167 Ga0207668_10004062 3300025972 Bacteria 8609
168 Ga0207640_10009464 3300025981 Bacteria 5458
169 Ga0207658_10147005 3300025986 Bacteria 1916
170 Ga0207703_10213525 3300026035 Bacteria 1722
171 Ga0207639_10050312 3300026041 Bacteria 3164
172 Ga0207678_10004095 3300026067 Bacteria 13113
173 Ga0207678_10016515 3300026067 Bacteria 6481
174 Ga0207678_10195155 3300026067 Bacteria 1730
175 Ga0207708_10066699 3300026075 Bacteria 2752
176 Ga0207702_10057084 3300026078 Bacteria 3317
177 Ga0207702_10218007 3300026078 Bacteria 1777
178 Ga0207641_10013709 3300026088 Bacteria 6652
179 Ga0207641_10040111 3300026088 Bacteria 3918
180 Ga0207676_10076428 3300026095 Bacteria 2706
181 Ga0207674_10005687 3300026116 Bacteria 14783
182 Ga0207674_10122427 3300026116 Bacteria 2567
183 Ga0207675_100010248 3300026118 Bacteria 8781
184 Ga0207683_10002963 3300026121 Bacteria 14804
185 Ga0207683_10008665 3300026121 Bacteria 8698
186 Ga0268266_10136048 3300028379 Bacteria 2201
187 Ga0268266_10170156 3300028379 Bacteria 1977
188 Ga0265336_10017417 3300028666 Bacteria 2340
189 Ga0265338_10002869 3300028800 Bacteria 25152
190 Ga0265338_10059565 3300028800 Bacteria 3363
191 Ga0307511_10082433 3300030521 Bacteria 2249
192 Ga0265325_10025506 3300031241 Bacteria 3209
193 Ga0265316_10086582 3300031344 Bacteria 2395
194 Ga0265342_10072756 3300031712 Bacteria 2001
195 Ga0307416_100076167 3300032002 Bacteria 2811
196 Ga0307415_100031077 3300032126 Bacteria 3436
197 Ga0307415_100213633 3300032126 Bacteria 1541
198 Ga0316214_1000779 3300033545 Bacteria 3437
199 Ga0373926_0000471 3300035083 Bacteria 10616
200 Ga0373926_0006597 3300035083 Bacteria 3849
201 Ga0373934_0019986 3300035086 Bacteria 2574
202 Ga0373934_0020325 3300035086 Bacteria 2551
203 Ga0373940_0001674 3300035088 Bacteria 4092
204 Ga0373940_0024735 3300035088 Bacteria 1559
205 Ga0373944_0006420 3300035089 Bacteria 3123
206 Ga0373949_0004023 3300035090 Bacteria 3409
207 Ga0373951_0013965 3300035091 Bacteria 1806
208 Ga0373952_0023926 3300035092 Bacteria 1308
209 Ga0373923_0012751 3300035111 Bacteria 3117
210 Ga0373932_0004521 3300035112 Bacteria 3284
211 Ga0373936_0000441 3300035113 Bacteria 13845
212 Ga0373936_0005720 3300035113 Bacteria 4691
213 Ga0373936_0010178 3300035113 Bacteria 3551
214 Ga0373936_0014124 3300035113 Bacteria 3051
215 Ga0373941_0052163 3300035115 Bacteria 1304
216 Ga0373945_0000148 3300035116 Bacteria 17906
217 Ga0373945_0000583 3300035116 Bacteria 10444
218 Ga0373953_0000287 3300035117 Bacteria 13874
219 Ga0373953_0032247 3300035117 Bacteria 2042
220 Ga0373954_0008734 3300035118 Bacteria 4455
221 Ga0373954_0008943 3300035118 Bacteria 4408
222 Ga0373954_0014859 3300035118 Bacteria 3474
223 Ga0373956_0000749 3300035119 Bacteria 13412
224 Ga0373957_0000202 3300035120 Bacteria 15269
225 Ga0373957_0008081 3300035120 Bacteria 3395
226 Ga0373957_0014328 3300035120 Bacteria 2708
227 Ga0373960_0012087 3300035121 Bacteria 2139
228 Ga0373943_0001282 3300035170 Bacteria 11249
229 Ga0373943_0002338 3300035170 Bacteria 8620
230 Ga0373946_0000072 3300035171 Bacteria 26922
231 Ga0373946_0000424 3300035171 Bacteria 13798
232 Ga0373955_0000190 3300035172 Bacteria 25350
233 Ga0373955_0000949 3300035172 Bacteria 12376
234 Ga0373955_0005881 3300035172 Bacteria 5546
235 Ga0373924_0000299 3300035410 Bacteria 15229
236 Ga0373924_0005335 3300035410 Bacteria 4544
237 Ga0373924_0009617 3300035410 Bacteria 3548
238 Ga0373931_0016477 3300035691 Bacteria 3638
239 Ga0373931_0033175 3300035691 Bacteria 2674
240 Ga0373935_0001226 3300035692 Bacteria 14176
241 Ga0373935_0003516 3300035692 Bacteria 9116
242 Ga0373935_0016460 3300035692 Bacteria 4473
243 Ga0373927_0008505 3300035695 Bacteria 6904
244 Ga0373927_0019821 3300035695 Bacteria 4409
245 Ga0373933_0000002 3300035724 Bacteria 151785
246 Ga0373933_0013529 3300035724 Bacteria 4524
247 Ga0373933_0020754 3300035724 Bacteria 3724
248 Ga0373933_0039867 3300035724 Bacteria 2764
249 Ga0373947_0000007 3300035725 Bacteria 192259
250 Ga0373947_0002078 3300035725 Bacteria 12222
251 Ga0373947_0004941 3300035725 Bacteria 7796
252 Ga0373937_0000014 3300036401 Bacteria 151785
253 Ga0373937_0010614 3300036401 Bacteria 8048
254 Ga0373937_0058256 3300036401 Bacteria 3548
255 Ga0373937_0115767 3300036401 Bacteria 2496
256 Ga0373925_0002939 3300037068 Bacteria 13440
257 Ga0373925_0007107 3300037068 Bacteria 8183
258 Ga0373925_0066795 3300037068 Bacteria 2711
259 Ga0373925_0093836 3300037068 Bacteria 2297
260 Ga0373925_0096571 3300037068 Bacteria 2265
261 Ga0373925_0211848 3300037068 Bacteria 1544
262 Ga0395900_0188524 3300037418 Bacteria 2093
263 Ga0395900_0220235 3300037418 Bacteria 1913
264 Ga0395898_0152036 3300037466 Bacteria 2214
265 Ga0436364_0287407 3300037853 Bacteria 132611
266 Ga0436364_0902528 3300037853 Bacteria 3288
267 Ga0436364_0929008 3300037853 Bacteria 3526
268 Ga0436364_0945769 3300037853 Bacteria 3753
269 Ga0395901_0002360 3300038443 Bacteria 19201
270 Ga0436363_0070679 3300039450 Bacteria 3807
271 Ga0466969_0062337 3300044656 Bacteria 1809
272 Ga0466966_0016251 3300044684 Bacteria 4920
273 Ga0466966_0073487 3300044684 Bacteria 2138
274 Ga0466961_0007282 3300044693 Bacteria 7041
275 Ga0466961_0035741 3300044693 Bacteria 3190
276 Ga0466961_0050520 3300044693 Bacteria 2655
277 Ga0466963_0034210 3300044694 Bacteria 3306
278 Ga0466971_0093727 3300044719 Bacteria 1376
279 Ga0466970_0052630 3300044765 Bacteria 2173
280 Ga0466959_0008536 3300045049 Bacteria 7249
281 Ga0466959_0062574 3300045049 Bacteria 2704
282 Ga0466959_0142421 3300045049 Bacteria 1693
283 Ga0466958_0006585 3300045836 Bacteria 6333
284 Ga0466958_0137712 3300045836 Bacteria 1536
285 Ga0466958_0138704 3300045836 Bacteria 1530
286 Ga0466967_0004823 3300045976 Bacteria 9195
287 Ga0466967_0023393 3300045976 Bacteria 5062
288 Ga0466967_0037121 3300045976 Bacteria 4166
289 Ga0466967_0044950 3300045976 Bacteria 3835
290 Ga0466967_0067109 3300045976 Bacteria 3199
291 Ga0466967_0152269 3300045976 Bacteria 2163
292 Ga0495592_0000133 3300046454 Bacteria 66075
293 Ga0495592_0012954 3300046454 Bacteria 6339
294 Ga0495592_0031882 3300046454 Bacteria 3980
295 Ga0495592_0053180 3300046454 Bacteria 3004
296 Ga0495603_0008751 3300046455 Bacteria 6120
297 Ga0495629_0009500 3300046459 Bacteria 7109
298 Ga0495629_0033812 3300046459 Bacteria 3615
299 Ga0495629_0115750 3300046459 Bacteria 1868
300 Ga0495629_0172751 3300046459 Bacteria 1499
301 Ga0495641_0012357 3300046461 Bacteria 4782
302 Ga0495641_0019577 3300046461 Bacteria 3457
303 Ga0495641_0046716 3300046461 Bacteria 1990
304 Ga0495651_0000019 3300046462 Bacteria 120970
305 Ga0495651_0002082 3300046462 Bacteria 15417
306 Ga0495651_0029896 3300046462 Bacteria 4247
307 Ga0495651_0032741 3300046462 Bacteria 4053
308 Ga0495651_0051551 3300046462 Bacteria 3171
309 Ga0495651_0076334 3300046462 Bacteria 2538
310 Ga0495651_0115432 3300046462 Bacteria 1979
311 Ga0495653_0000763 3300046463 Bacteria 24698
312 Ga0495653_0003729 3300046463 Bacteria 12326
313 Ga0495653_0010837 3300046463 Bacteria 7462
314 Ga0495653_0046770 3300046463 Bacteria 3349
315 Ga0495653_0062757 3300046463 Bacteria 2806
316 Ga0495580_0007853 3300046472 Bacteria 8537
317 Ga0495582_0002305 3300046473 Bacteria 10691
318 Ga0495582_0026254 3300046473 Bacteria 3192
319 Ga0495639_0049482 3300046475 Bacteria 1907
320 Ga0495662_0000693 3300046476 Bacteria 15953
321 Ga0495662_0011498 3300046476 Bacteria 4325
322 Ga0495662_0026275 3300046476 Bacteria 2812
323 Ga0495664_0004853 3300046477 Bacteria 7353
324 Ga0495664_0009941 3300046477 Bacteria 5335
325 Ga0495664_0029898 3300046477 Bacteria 3188
326 Ga0495594_0008572 3300046499 Bacteria 5269
327 Ga0495594_0027168 3300046499 Bacteria 3083
328 Ga0495608_0000028 3300046511 Bacteria 151829
329 Ga0495608_0003551 3300046511 Bacteria 11169
330 Ga0495608_0012844 3300046511 Bacteria 5810
331 Ga0495608_0064060 3300046511 Bacteria 2410
332 Ga0495608_0195130 3300046511 Bacteria 1277
333 Ga0495618_0006995 3300046514 Bacteria 6836
334 Ga0495618_0018533 3300046514 Bacteria 4273
335 Ga0495618_0046453 3300046514 Bacteria 2740
336 Ga0495628_0000371 3300046516 Bacteria 41228
337 Ga0495628_0101212 3300046516 Bacteria 2223
338 Ga0495630_0010707 3300046517 Bacteria 6623
339 Ga0495630_0056581 3300046517 Bacteria 2938
340 Ga0495666_0023132 3300046526 Bacteria 3074
341 Ga0495666_0030526 3300046526 Bacteria 2644
342 Ga0495666_0033640 3300046526 Bacteria 2503
343 Ga0495652_0000031 3300046529 Bacteria 151765
344 Ga0495652_0019012 3300046529 Bacteria 6121
345 Ga0495652_0024788 3300046529 Bacteria 5308
346 Ga0495652_0037456 3300046529 Bacteria 4208
347 Ga0495652_0065090 3300046529 Bacteria 3064
348 Ga0495652_0080130 3300046529 Bacteria 2698
349 Ga0495665_0000374 3300046531 Bacteria 22530
350 Ga0495665_0001587 3300046531 Bacteria 12157
351 Ga0495665_0025175 3300046531 Bacteria 3197
352 Ga0495640_0010592 3300046533 Bacteria 7111
353 Ga0495640_0016873 3300046533 Bacteria 5456
354 Ga0495640_0044467 3300046533 Bacteria 3087
355 Ga0495640_0088913 3300046533 Bacteria 2041
356 Ga0495586_0030293 3300046535 Bacteria 2895
357 Ga0495587_0000023 3300046536 Bacteria 151763
358 Ga0495587_0013228 3300046536 Bacteria 5187
359 Ga0495587_0021197 3300046536 Bacteria 4007
360 Ga0495587_0033842 3300046536 Bacteria 3083
361 Ga0495587_0048004 3300046536 Bacteria 2530
362 Ga0495587_0051454 3300046536 Bacteria 2435
363 Ga0495645_0010578 3300046543 Bacteria 6475
364 Ga0495645_0039761 3300046543 Bacteria 3429
365 Ga0495645_0129180 3300046543 Bacteria 1773
366 Ga0495667_0000054 3300046559 Bacteria 105009
367 Ga0495667_0013775 3300046559 Bacteria 5461
368 Ga0495667_0022223 3300046559 Bacteria 4275
369 Ga0495667_0023474 3300046559 Bacteria 4155
370 Ga0495667_0025829 3300046559 Bacteria 3956
371 Ga0495667_0050509 3300046559 Bacteria 2745
372 Ga0495634_0015009 3300046642 Bacteria 5570
373 Ga0495634_0017630 3300046642 Bacteria 5093
374 Ga0495634_0021812 3300046642 Bacteria 4520
375 Ga0495635_0007204 3300046663 Bacteria 7770
376 Ga0495635_0008106 3300046663 Bacteria 7340
377 Ga0495635_0008450 3300046663 Bacteria 7191
378 Ga0495635_0016145 3300046663 Bacteria 5213
379 Ga0495635_0051729 3300046663 Bacteria 2830
380 Ga0495588_0025884 3300046674 Bacteria 2927
381 Ga0495657_0000022 3300046675 Bacteria 151837
382 Ga0495657_0026800 3300046675 Bacteria 4077
383 Ga0495657_0045565 3300046675 Bacteria 2975
384 Ga0495599_0000700 3300046678 Bacteria 18940
385 Ga0495599_0017884 3300046678 Bacteria 4413
386 Ga0495599_0022040 3300046678 Bacteria 3976
387 Ga0495599_0031907 3300046678 Bacteria 3306
388 Ga0495599_0039315 3300046678 Bacteria 2972
389 Ga0495623_0000416 3300046679 Bacteria 28025
390 Ga0495623_0005330 3300046679 Bacteria 8421
391 Ga0495623_0014675 3300046679 Bacteria 5067
392 Ga0495623_0110218 3300046679 Bacteria 1669
393 Ga0495646_0021508 3300046680 Bacteria 4073
394 Ga0495646_0031658 3300046680 Bacteria 3295
395 Ga0495646_0068460 3300046680 Bacteria 2095
396 Ga0495658_0050177 3300046683 Bacteria 2359
397 Ga0495613_0002417 3300046689 Bacteria 14105
398 Ga0495613_0039932 3300046689 Bacteria 3477
399 Ga0495624_0012474 3300046690 Bacteria 5805
400 Ga0495624_0054377 3300046690 Bacteria 2524
401 Ga0495600_0006882 3300046809 Bacteria 6935
402 Ga0495600_0018292 3300046809 Bacteria 4462
403 Ga0495600_0033354 3300046809 Bacteria 3342
404 Ga0495600_0033516 3300046809 Bacteria 3334
405 Ga0495581_0000753 3300047315 Bacteria 17183
406 Ga0495581_0020178 3300047315 Bacteria 3869
407 Ga0495581_0032089 3300047315 Bacteria 3041
408 Ga0495604_0000022 3300047317 Bacteria 151744
409 Ga0495604_0012990 3300047317 Bacteria 6638
410 Ga0495604_0019904 3300047317 Bacteria 5367
411 Ga0495604_0026901 3300047317 Bacteria 4577
412 Ga0495604_0083109 3300047317 Bacteria 2394
413 Ga0495674_0003658 3300047319 Bacteria 14959
414 Ga0495674_0015213 3300047319 Bacteria 7197
415 Ga0495674_0061064 3300047319 Bacteria 3286
416 Ga0495674_0062787 3300047319 Bacteria 3233
417 Ga0495674_0091466 3300047319 Bacteria 2598
418 Ga0495676_0038301 3300047321 Bacteria 3982
419 Ga0495680_0000271 3300047322 Bacteria 57595
420 Ga0495680_0002758 3300047322 Bacteria 17724
421 Ga0495680_0009913 3300047322 Bacteria 8539
422 Ga0495680_0010980 3300047322 Bacteria 8049
423 Ga0495680_0013531 3300047322 Bacteria 7113
424 Ga0495680_0045461 3300047322 Bacteria 3466
425 Ga0495680_0052762 3300047322 Bacteria 3168
426 Ga0495680_0064387 3300047322 Bacteria 2811
427 Ga0495675_0025084 3300047444 Bacteria 3802
428 Ga0495675_0032010 3300047444 Bacteria 3357
429 Ga0495675_0054708 3300047444 Bacteria 2532
430 Ga0495684_0003694 3300047471 Bacteria 11931
431 Ga0495684_0038657 3300047471 Bacteria 3658
432 Ga0495593_0006697 3300047673 Bacteria 6745
433 Ga0495593_0013816 3300047673 Bacteria 4599
434 Ga0495593_0030163 3300047673 Bacteria 2968
435 Ga0495602_0000390 3300048088 Bacteria 41015
436 Ga0495602_0102740 3300048088 Bacteria 2341
437 Ga0495602_0114839 3300048088 Bacteria 2179
438 Ga0495602_0121313 3300048088 Bacteria 2102
439 Ga0495614_0007306 3300048089 Bacteria 4923
440 Ga0495614_0008545 3300048089 Bacteria 4551
441 Ga0496100_0085072 3300048903 Bacteria 2145
442 Ga0496101_0022577 3300048904 Bacteria 4334
443 Ga0496101_0188143 3300048904 Bacteria 1592
444 Ga0496102_0176082 3300048905 Bacteria 2014
445 Ga0496104_0003915 3300048907 Bacteria 12894
446 Ga0496105_0027798 3300048908 Bacteria 4623
447 Ga0496105_0124581 3300048908 Bacteria 2124
448 Ga0496107_0063658 3300048910 Bacteria 2673
449 Ga0496107_0074401 3300048910 Bacteria 2471
450 Ga0496107_0076863 3300048910 Bacteria 2432
451 Ga0496108_0028194 3300048911 Bacteria 4645
452 Ga0496108_0029769 3300048911 Bacteria 4524
453 Ga0496108_0173919 3300048911 Bacteria 1863
454 Ga0496109_0015203 3300048912 Bacteria 6700
455 Ga0496109_0088322 3300048912 Bacteria 2865
456 Ga0496112_0011097 3300048915 Bacteria 8210
457 Ga0496112_0060943 3300048915 Bacteria 3718
458 Ga0496112_0093698 3300048915 Bacteria 2973
459 Ga0496112_0270162 3300048915 Bacteria 1649
460 Ga0496113_0090576 3300048916 Bacteria 2356
461 Ga0496114_0097258 3300048917 Bacteria 2507
462 Ga0496114_0166947 3300048917 Bacteria 1917
463 Ga0496123_0009845 3300048926 Bacteria 8536
464 Ga0496126_0000003 3300048929 Bacteria 961576
465 Ga0501032_0002085 3300049569 Bacteria 15782
466 Ga0501034_0010058 3300049571 Bacteria 9877
467 Ga0501036_0004173 3300049572 Bacteria 11636
468 Ga0501036_0231089 3300049572 Bacteria 1552
469 Ga0501037_0000875 3300049573 Bacteria 22490
470 Ga0501038_0001314 3300049574 Bacteria 22601
471 Ga0501038_0002113 3300049574 Bacteria 18433
472 Ga0501038_0014492 3300049574 Bacteria 7185
473 Ga0501039_0001151 3300049575 Bacteria 19497
474 Ga0501042_0004370 3300049578 Bacteria 9020
475 Ga0501043_0004823 3300049579 Bacteria 10912
476 Ga0501047_0002021 3300049581 Bacteria 19429
477 Ga0501069_0023088 3300049585 Bacteria 3389
478 Ga0501070_0004495 3300049586 Bacteria 11972
479 Ga0501074_0016493 3300049590 Bacteria 5361
480 Ga0501044_0075581 3300049823 Bacteria 3420
481 Ga0501044_0110823 3300049823 Bacteria 2753
482 nmdc:mga09592_10880_c1 3300050508 Bacteria 7404
483 nmdc:mga0qj67_813_c1 3300050509 Bacteria 21266
484 nmdc:mga0n895_21202_c1 3300050512 Bacteria 6071
485 nmdc:mga0rr50_17868_c1 3300050513 Bacteria 4749
486 nmdc:mga08x19_53689_c1 3300050514 Bacteria 2593
487 nmdc:mga0a205_13908_c1 3300050515 Bacteria 7503
488 nmdc:mga0a205_42248_c1 3300050515 Bacteria 4392
489 Ga0495601_0119184 3300053077 Bacteria 1713
490 Ga0495595_0003523 3300053084 Bacteria 6212
491 Ga0495595_0036767 3300053084 Bacteria 2223
492 Ga0495619_0001215 3300053085 Bacteria 16882
493 Ga0495619_0025700 3300053085 Bacteria 3784
494 Ga0495619_0027736 3300053085 Bacteria 3651
495 Ga0495619_0088179 3300053085 Bacteria 2098

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045976 Ga0466967_0023393 Ga0466967_0023393_1208_2356 339
2 3300005983 Ga0081540_1001333 Ga0081540_10013336 343
3 3300005539 Ga0068853_100154767 Ga0068853_1001547671 344
4 3300025885 Ga0207653_10038100 Ga0207653_100381001 344
5 3300025899 Ga0207642_10051667 Ga0207642_100516671 344
6 3300025919 Ga0207657_10004089 Ga0207657_100040899 344
7 3300025936 Ga0207670_10147772 Ga0207670_101477722 344
8 3300037068 Ga0373925_0093836 Ga0373925_0093836_744_1940 350
9 3300012507 Ga0157342_1000452 Ga0157342_10004523 352
10 3300037068 Ga0373925_0211848 Ga0373925_0211848_37_1233 352
11 3300037853 Ga0436364_0902528 Ga0436364_0902528_1338_2522 352
12 3300005329 Ga0070683_100150639 Ga0070683_1001506393 353
13 3300005335 Ga0070666_10160993 Ga0070666_101609931 353
14 3300006852 Ga0075433_10031189 Ga0075433_100311892 353
15 3300020082 Ga0206353_11505314 Ga0206353_115053141 353
16 3300006237 Ga0097621_100128278 Ga0097621_1001282783 355
17 3300006358 Ga0068871_100060653 Ga0068871_1000606531 355
18 3300013297 Ga0157378_10074156 Ga0157378_100741561 355
19 3300025918 Ga0207662_10002856 Ga0207662_100028569 355
20 3300025942 Ga0207689_10033087 Ga0207689_100330873 355
21 3300025960 Ga0207651_10283781 Ga0207651_102837811 355
22 3300026078 Ga0207702_10218007 Ga0207702_102180072 355
23 3300026121 Ga0207683_10002963 Ga0207683_1000296314 355
24 3300046499 Ga0495594_0027168 Ga0495594_0027168_1387_2526 355
25 3300048911 Ga0496108_0173919 Ga0496108_0173919_159_1373 355
26 3300046543 Ga0495645_0129180 Ga0495645_0129180_593_1717 357
27 3300046514 Ga0495618_0046453 Ga0495618_0046453_972_2186 358
28 3300020081 Ga0206354_10747477 Ga0206354_107474771 359
29 3300025945 Ga0207679_10263262 Ga0207679_102632622 359
30 3300009101 Ga0105247_10111276 Ga0105247_101112762 360
31 3300025939 Ga0207665_10226414 Ga0207665_102264141 361
32 3300035117 Ga0373953_0000287 Ga0373953_0000287_10510_11715 361
33 3300035118 Ga0373954_0008734 Ga0373954_0008734_1312_2517 361
34 3300035119 Ga0373956_0000749 Ga0373956_0000749_376_1581 361
35 3300035120 Ga0373957_0000202 Ga0373957_0000202_5055_6260 361
36 3300035172 Ga0373955_0000190 Ga0373955_0000190_6678_7883 361
37 3300035410 Ga0373924_0000299 Ga0373924_0000299_11312_12517 361
38 3300035724 Ga0373933_0000002 Ga0373933_0000002_37199_38404 361
39 3300036401 Ga0373937_0000014 Ga0373937_0000014_113382_114587 361
40 3300046454 Ga0495592_0000133 Ga0495592_0000133_37199_38404 361
41 3300046462 Ga0495651_0000019 Ga0495651_0000019_113382_114587 361
42 3300046463 Ga0495653_0000763 Ga0495653_0000763_7777_8982 361
43 3300046511 Ga0495608_0000028 Ga0495608_0000028_37191_38396 361
44 3300046516 Ga0495628_0000371 Ga0495628_0000371_19138_20343 361
45 3300046529 Ga0495652_0000031 Ga0495652_0000031_37179_38384 361
46 3300046536 Ga0495587_0000023 Ga0495587_0000023_113360_114565 361
47 3300046559 Ga0495667_0000054 Ga0495667_0000054_37191_38396 361
48 3300046675 Ga0495657_0000022 Ga0495657_0000022_37199_38404 361
49 3300046678 Ga0495599_0000700 Ga0495599_0000700_2653_3858 361
50 3300046679 Ga0495623_0000416 Ga0495623_0000416_672_1877 361
51 3300046809 Ga0495600_0006882 Ga0495600_0006882_1366_2571 361
52 3300047317 Ga0495604_0000022 Ga0495604_0000022_37176_38381 361
53 3300047322 Ga0495680_0000271 Ga0495680_0000271_19192_20397 361
54 3300047444 Ga0495675_0025084 Ga0495675_0025084_2458_3663 361
55 3300048088 Ga0495602_0000390 Ga0495602_0000390_37199_38404 361
56 3300053084 Ga0495595_0003523 Ga0495595_0003523_3546_4751 361
57 3300006028 Ga0070717_10038633 Ga0070717_100386332 362
58 3300011119 Ga0105246_10119137 Ga0105246_101191371 363
59 3300046663 Ga0495635_0051729 Ga0495635_0051729_76_1287 363
60 3300005544 Ga0070686_100179842 Ga0070686_1001798421 364
61 3300005618 Ga0068864_100230840 Ga0068864_1002308401 364
62 3300006871 Ga0075434_100330623 Ga0075434_1003306231 364
63 3300014326 Ga0157380_10252806 Ga0157380_102528061 364
64 3300025939 Ga0207665_10183000 Ga0207665_101830001 364
65 3300025986 Ga0207658_10147005 Ga0207658_101470052 364
66 3300033545 Ga0316214_1000779 Ga0316214_10007793 364
67 3300005468 Ga0070707_100038237 Ga0070707_1000382373 365
68 3300025922 Ga0207646_10031594 Ga0207646_100315943 365
69 3300044684 Ga0466966_0016251 Ga0466966_0016251_898_2037 365
70 3300045049 Ga0466959_0008536 Ga0466959_0008536_5665_6804 365
71 3300045836 Ga0466958_0006585 Ga0466958_0006585_3887_5026 365
72 3300045836 Ga0466958_0138704 Ga0466958_0138704_181_1320 365
73 3300047319 Ga0495674_0015213 Ga0495674_0015213_1231_2472 365
74 3300005543 Ga0070672_100054188 Ga0070672_1000541882 366
75 3300009551 Ga0105238_10042986 Ga0105238_100429865 366
76 3300025919 Ga0207657_10188860 Ga0207657_101888602 366
77 3300035118 Ga0373954_0008943 Ga0373954_0008943_1459_2673 366
78 3300035120 Ga0373957_0008081 Ga0373957_0008081_877_2091 366
79 3300035172 Ga0373955_0000949 Ga0373955_0000949_9685_10899 366
80 3300035724 Ga0373933_0020754 Ga0373933_0020754_1219_2433 366
81 3300046454 Ga0495592_0053180 Ga0495592_0053180_308_1522 366
82 3300046462 Ga0495651_0029896 Ga0495651_0029896_133_1347 366
83 3300046476 Ga0495662_0026275 Ga0495662_0026275_390_1604 366
84 3300046477 Ga0495664_0004853 Ga0495664_0004853_3805_5019 366
85 3300046511 Ga0495608_0012844 Ga0495608_0012844_1614_2828 366
86 3300046529 Ga0495652_0019012 Ga0495652_0019012_2984_4198 366
87 3300046533 Ga0495640_0044467 Ga0495640_0044467_1307_2521 366
88 3300046536 Ga0495587_0033842 Ga0495587_0033842_431_1645 366
89 3300046543 Ga0495645_0039761 Ga0495645_0039761_1660_2874 366
90 3300046559 Ga0495667_0013775 Ga0495667_0013775_2281_3495 366
91 3300046642 Ga0495634_0017630 Ga0495634_0017630_342_1556 366
92 3300046675 Ga0495657_0026800 Ga0495657_0026800_305_1519 366
93 3300046678 Ga0495599_0039315 Ga0495599_0039315_1431_2645 366
94 3300046679 Ga0495623_0014675 Ga0495623_0014675_1349_2563 366
95 3300046809 Ga0495600_0033354 Ga0495600_0033354_1660_2874 366
96 3300047317 Ga0495604_0019904 Ga0495604_0019904_1135_2349 366
97 3300047673 Ga0495593_0013816 Ga0495593_0013816_2562_3776 366
98 3300048088 Ga0495602_0121313 Ga0495602_0121313_143_1357 366
99 3300035724 Ga0373933_0013529 Ga0373933_0013529_2069_3265 367
100 3300036401 Ga0373937_0058256 Ga0373937_0058256_2089_3285 367
101 3300046462 Ga0495651_0002082 Ga0495651_0002082_3039_4235 367
102 3300046511 Ga0495608_0003551 Ga0495608_0003551_1377_2573 367
103 3300046529 Ga0495652_0037456 Ga0495652_0037456_1125_2321 367
104 3300046533 Ga0495640_0088913 Ga0495640_0088913_812_2008 367
105 3300046536 Ga0495587_0013228 Ga0495587_0013228_1577_2773 367
106 3300046559 Ga0495667_0025829 Ga0495667_0025829_937_2133 367
107 3300046663 Ga0495635_0008450 Ga0495635_0008450_2938_4134 367
108 3300046678 Ga0495599_0017884 Ga0495599_0017884_1538_2734 367
109 3300046680 Ga0495646_0031658 Ga0495646_0031658_1433_2629 367
110 3300046809 Ga0495600_0033516 Ga0495600_0033516_321_1517 367
111 3300047317 Ga0495604_0026901 Ga0495604_0026901_3269_4465 367
112 3300047322 Ga0495680_0002758 Ga0495680_0002758_7832_9028 367
113 3300047444 Ga0495675_0054708 Ga0495675_0054708_397_1593 367
114 3300047471 Ga0495684_0038657 Ga0495684_0038657_659_1855 367
115 3300053085 Ga0495619_0025700 Ga0495619_0025700_1745_2941 367
116 3300005471 Ga0070698_100007131 Ga0070698_1000071319 368
117 3300035086 Ga0373934_0020325 Ga0373934_0020325_1282_2448 368
118 3300035113 Ga0373936_0010178 Ga0373936_0010178_179_1345 368
119 3300046463 Ga0495653_0003729 Ga0495653_0003729_9193_10359 368
120 3300046679 Ga0495623_0110218 Ga0495623_0110218_380_1546 368
121 iso_pu_bacteria 2857737099 2857738246 368
122 3300021388 Ga0213875_10000678 Ga0213875_1000067815 369
123 3300037853 Ga0436364_0287407 Ga0436364_0287407_15922_17124 369
124 3300005548 Ga0070665_100216353 Ga0070665_1002163532 370
125 3300005841 Ga0068863_100031901 Ga0068863_1000319013 370
126 3300025933 Ga0207706_10040560 Ga0207706_100405604 370
127 3300026088 Ga0207641_10013709 Ga0207641_100137095 370
128 3300026095 Ga0207676_10076428 Ga0207676_100764282 370
129 3300028379 Ga0268266_10170156 Ga0268266_101701562 370
130 3300035113 Ga0373936_0005720 Ga0373936_0005720_2910_4109 370
131 3300037853 Ga0436364_0929008 Ga0436364_0929008_1304_2542 370
132 3300048915 Ga0496112_0060943 Ga0496112_0060943_1644_2783 370
133 3300048915 Ga0496112_0093698 Ga0496112_0093698_861_2000 370
134 3300026116 Ga0207674_10005687 Ga0207674_100056871 371
135 iso_pu_bacteria 2643221961 2645721224 371
136 iso_pu_bacteria 2643221962 2645724765 371
137 3300009148 Ga0105243_10154045 Ga0105243_101540452 372
138 3300025935 Ga0207709_10198195 Ga0207709_101981951 372
139 3300035083 Ga0373926_0000471 Ga0373926_0000471_6566_7765 372
140 3300035111 Ga0373923_0012751 Ga0373923_0012751_58_1257 372
141 3300035116 Ga0373945_0000583 Ga0373945_0000583_2397_3596 372
142 3300035170 Ga0373943_0002338 Ga0373943_0002338_6926_8125 372
143 3300035171 Ga0373946_0000072 Ga0373946_0000072_12673_13872 372
144 3300035172 Ga0373955_0005881 Ga0373955_0005881_3620_4819 372
145 3300035410 Ga0373924_0005335 Ga0373924_0005335_2535_3734 372
146 3300035692 Ga0373935_0003516 Ga0373935_0003516_1352_2551 372
147 3300035695 Ga0373927_0008505 Ga0373927_0008505_390_1589 372
148 3300035725 Ga0373947_0002078 Ga0373947_0002078_10412_11611 372
149 3300037068 Ga0373925_0002939 Ga0373925_0002939_5316_6515 372
150 3300046454 Ga0495592_0031882 Ga0495592_0031882_2054_3253 372
151 3300046455 Ga0495603_0008751 Ga0495603_0008751_4545_5744 372
152 3300046459 Ga0495629_0009500 Ga0495629_0009500_5559_6758 372
153 3300046461 Ga0495641_0012357 Ga0495641_0012357_2232_3431 372
154 3300046462 Ga0495651_0051551 Ga0495651_0051551_657_1856 372
155 3300046463 Ga0495653_0046770 Ga0495653_0046770_1150_2349 372
156 3300046472 Ga0495580_0007853 Ga0495580_0007853_595_1794 372
157 3300046473 Ga0495582_0002305 Ga0495582_0002305_8938_10137 372
158 3300046475 Ga0495639_0049482 Ga0495639_0049482_524_1723 372
159 3300046476 Ga0495662_0000693 Ga0495662_0000693_13403_14602 372
160 3300046477 Ga0495664_0029898 Ga0495664_0029898_840_2039 372
161 3300046499 Ga0495594_0008572 Ga0495594_0008572_527_1726 372
162 3300046514 Ga0495618_0018533 Ga0495618_0018533_1316_2515 372
163 3300046526 Ga0495666_0030526 Ga0495666_0030526_105_1304 372
164 3300046531 Ga0495665_0000374 Ga0495665_0000374_10473_11672 372
165 3300046533 Ga0495640_0016873 Ga0495640_0016873_2906_4105 372
166 3300046535 Ga0495586_0030293 Ga0495586_0030293_1150_2349 372
167 3300046536 Ga0495587_0051454 Ga0495587_0051454_810_2021 372
168 3300046543 Ga0495645_0010578 Ga0495645_0010578_4620_5819 372
169 3300046642 Ga0495634_0015009 Ga0495634_0015009_768_1967 372
170 3300046663 Ga0495635_0007204 Ga0495635_0007204_3666_4865 372
171 3300046678 Ga0495599_0031907 Ga0495599_0031907_1352_2551 372
172 3300046680 Ga0495646_0021508 Ga0495646_0021508_962_2161 372
173 3300046689 Ga0495613_0002417 Ga0495613_0002417_656_1855 372
174 3300046690 Ga0495624_0054377 Ga0495624_0054377_838_2037 372
175 3300047315 Ga0495581_0000753 Ga0495581_0000753_9059_10258 372
176 3300047317 Ga0495604_0083109 Ga0495604_0083109_318_1529 372
177 3300047319 Ga0495674_0062787 Ga0495674_0062787_1149_2348 372
178 3300047322 Ga0495680_0013531 Ga0495680_0013531_2310_3509 372
179 3300047471 Ga0495684_0003694 Ga0495684_0003694_3807_5006 372
180 3300048089 Ga0495614_0007306 Ga0495614_0007306_3439_4638 372
181 3300053085 Ga0495619_0088179 Ga0495619_0088179_352_1551 372
182 3300005435 Ga0070714_100035809 Ga0070714_1000358092 373
183 3300005337 Ga0070682_100032303 Ga0070682_1000323033 374
184 3300005347 Ga0070668_100008403 Ga0070668_1000084036 374
185 3300005354 Ga0070675_100124221 Ga0070675_1001242212 374
186 3300005367 Ga0070667_100030646 Ga0070667_1000306463 374
187 3300005436 Ga0070713_100036855 Ga0070713_1000368553 374
188 3300005438 Ga0070701_10056409 Ga0070701_100564092 374
189 3300005440 Ga0070705_100075380 Ga0070705_1000753802 374
190 3300005441 Ga0070700_100083055 Ga0070700_1000830552 374
191 3300005539 Ga0068853_100121804 Ga0068853_1001218042 374
192 3300005544 Ga0070686_100116864 Ga0070686_1001168641 374
193 3300005545 Ga0070695_100005806 Ga0070695_1000058069 374
194 3300005547 Ga0070693_100003357 Ga0070693_1000033579 374
195 3300005549 Ga0070704_100031657 Ga0070704_1000316573 374
196 3300005563 Ga0068855_100005745 Ga0068855_1000057456 374
197 3300005578 Ga0068854_100024394 Ga0068854_1000243943 374
198 3300005614 Ga0068856_100041921 Ga0068856_1000419213 374
199 3300005615 Ga0070702_100025554 Ga0070702_1000255543 374
200 3300005718 Ga0068866_10030764 Ga0068866_100307642 374
201 3300005719 Ga0068861_100006598 Ga0068861_1000065983 374
202 3300005841 Ga0068863_100075836 Ga0068863_1000758363 374
203 3300006173 Ga0070716_100017239 Ga0070716_1000172393 374
204 3300006881 Ga0068865_100004755 Ga0068865_1000047554 374
205 3300009093 Ga0105240_10023497 Ga0105240_100234978 374
206 3300009098 Ga0105245_10009193 Ga0105245_100091933 374
207 3300009148 Ga0105243_10011774 Ga0105243_100117748 374
208 3300010375 Ga0105239_10017809 Ga0105239_100178093 374
209 3300013105 Ga0157369_10171586 Ga0157369_101715863 374
210 3300013306 Ga0163162_10015180 Ga0163162_1001518010 374
211 3300014325 Ga0163163_10010070 Ga0163163_100100707 374
212 3300014968 Ga0157379_10037848 Ga0157379_100378483 374
213 3300025901 Ga0207688_10005592 Ga0207688_100055922 374
214 3300025908 Ga0207643_10075290 Ga0207643_100752902 374
215 3300025914 Ga0207671_10024070 Ga0207671_100240705 374
216 3300025915 Ga0207693_10000501 Ga0207693_1000050129 374
217 3300025916 Ga0207663_10040719 Ga0207663_100407192 374
218 3300025919 Ga0207657_10032882 Ga0207657_100328822 374
219 3300025926 Ga0207659_10131295 Ga0207659_101312952 374
220 3300025931 Ga0207644_10022132 Ga0207644_100221323 374
221 3300025932 Ga0207690_10091442 Ga0207690_100914422 374
222 3300025939 Ga0207665_10002286 Ga0207665_100022869 374
223 3300025940 Ga0207691_10028692 Ga0207691_100286924 374
224 3300025942 Ga0207689_10054359 Ga0207689_100543592 374
225 3300025972 Ga0207668_10004062 Ga0207668_100040623 374
226 3300026035 Ga0207703_10213525 Ga0207703_102135252 374
227 3300026067 Ga0207678_10004095 Ga0207678_100040958 374
228 3300026075 Ga0207708_10066699 Ga0207708_100666992 374
229 3300026078 Ga0207702_10057084 Ga0207702_100570843 374
230 3300026088 Ga0207641_10040111 Ga0207641_100401112 374
231 3300026118 Ga0207675_100010248 Ga0207675_1000102489 374
232 3300026121 Ga0207683_10008665 Ga0207683_100086655 374
233 3300035083 Ga0373926_0006597 Ga0373926_0006597_146_1312 374
234 3300035088 Ga0373940_0024735 Ga0373940_0024735_50_1195 374
235 3300035089 Ga0373944_0006420 Ga0373944_0006420_1816_2982 374
236 3300035092 Ga0373952_0023926 Ga0373952_0023926_46_1191 374
237 3300035113 Ga0373936_0000441 Ga0373936_0000441_5364_6530 374
238 3300035116 Ga0373945_0000148 Ga0373945_0000148_4266_5432 374
239 3300035170 Ga0373943_0001282 Ga0373943_0001282_8330_9496 374
240 3300035171 Ga0373946_0000424 Ga0373946_0000424_158_1324 374
241 3300035691 Ga0373931_0016477 Ga0373931_0016477_1640_2785 374
242 3300035692 Ga0373935_0016460 Ga0373935_0016460_3216_4382 374
243 3300035695 Ga0373927_0019821 Ga0373927_0019821_1532_2698 374
244 3300035725 Ga0373947_0004941 Ga0373947_0004941_1165_2331 374
245 3300037068 Ga0373925_0007107 Ga0373925_0007107_5005_6171 374
246 3300046459 Ga0495629_0172751 Ga0495629_0172751_79_1317 374
247 3300046463 Ga0495653_0010837 Ga0495653_0010837_1817_2983 374
248 3300046476 Ga0495662_0011498 Ga0495662_0011498_201_1367 374
249 3300046477 Ga0495664_0009941 Ga0495664_0009941_209_1375 374
250 3300046514 Ga0495618_0006995 Ga0495618_0006995_5359_6525 374
251 3300046517 Ga0495630_0010707 Ga0495630_0010707_3939_5105 374
252 3300046529 Ga0495652_0024788 Ga0495652_0024788_2802_3968 374
253 3300046559 Ga0495667_0022223 Ga0495667_0022223_1796_2962 374
254 3300046663 Ga0495635_0008106 Ga0495635_0008106_1838_3004 374
255 3300046678 Ga0495599_0022040 Ga0495599_0022040_467_1633 374
256 3300046690 Ga0495624_0012474 Ga0495624_0012474_166_1332 374
257 3300047319 Ga0495674_0003658 Ga0495674_0003658_4434_5600 374
258 3300047321 Ga0495676_0038301 Ga0495676_0038301_1862_3028 374
259 3300047322 Ga0495680_0010980 Ga0495680_0010980_2492_3658 374
260 3300048904 Ga0496101_0188143 Ga0496101_0188143_337_1482 374
261 3300048907 Ga0496104_0003915 Ga0496104_0003915_8467_9612 374
262 3300048908 Ga0496105_0027798 Ga0496105_0027798_1892_3037 374
263 3300048910 Ga0496107_0063658 Ga0496107_0063658_567_1712 374
264 3300048911 Ga0496108_0029769 Ga0496108_0029769_3161_4306 374
265 3300048912 Ga0496109_0015203 Ga0496109_0015203_682_1827 374
266 3300048915 Ga0496112_0011097 Ga0496112_0011097_3119_4264 374
267 3300048917 Ga0496114_0097258 Ga0496114_0097258_213_1358 374
268 3300050513 nmdc:mga0rr50_17868_c1 nmdc:mga0rr50_17868_c1_2463_3608 374
269 3300050514 nmdc:mga08x19_53689_c1 nmdc:mga08x19_53689_c1_991_2136 374
270 3300050515 nmdc:mga0a205_13908_c1 nmdc:mga0a205_13908_c1_2572_3717 374
271 3300005467 Ga0070706_100022502 Ga0070706_1000225026 375
272 3300005468 Ga0070707_100188278 Ga0070707_1001882782 375
273 3300025922 Ga0207646_10004889 Ga0207646_100048896 375
274 3300028666 Ga0265336_10017417 Ga0265336_100174172 375
275 3300028800 Ga0265338_10002869 Ga0265338_100028696 375
276 3300045976 Ga0466967_0152269 Ga0466967_0152269_969_2138 375
277 iso_pu_bacteria 2558860112 2558907896 375
278 3300035724 Ga0373933_0039867 Ga0373933_0039867_643_1809 376
279 3300046663 Ga0495635_0016145 Ga0495635_0016145_1034_2200 376
280 3300047322 Ga0495680_0045461 Ga0495680_0045461_672_1838 376
281 iso_pu_bacteria 2870782633 2870786154 376
282 3300045976 Ga0466967_0044950 Ga0466967_0044950_1676_2854 377
283 3300046462 Ga0495651_0115432 Ga0495651_0115432_153_1337 377
284 3300046536 Ga0495587_0048004 Ga0495587_0048004_572_1756 377
285 3300047322 Ga0495680_0052762 Ga0495680_0052762_1967_3151 377
286 3300035086 Ga0373934_0019986 Ga0373934_0019986_1181_2440 378
287 3300036401 Ga0373937_0010614 Ga0373937_0010614_4305_5564 378
288 3300037418 Ga0395900_0188524 Ga0395900_0188524_741_1898 378
289 3300037466 Ga0395898_0152036 Ga0395898_0152036_701_1858 378
290 3300038443 Ga0395901_0002360 Ga0395901_0002360_6590_7747 378
291 3300044694 Ga0466963_0034210 Ga0466963_0034210_1109_2278 378
292 3300048088 Ga0495602_0114839 Ga0495602_0114839_147_1406 378
293 3300005455 Ga0070663_100092515 Ga0070663_1000925152 379
294 3300026067 Ga0207678_10195155 Ga0207678_101951552 379
295 3300049571 Ga0501034_0010058 Ga0501034_0010058_6545_7723 379
296 3300049572 Ga0501036_0004173 Ga0501036_0004173_3753_4931 379
297 3300049574 Ga0501038_0001314 Ga0501038_0001314_5680_6858 379
298 3300049578 Ga0501042_0004370 Ga0501042_0004370_5789_6967 379
299 3300049581 Ga0501047_0002021 Ga0501047_0002021_14924_16102 379
300 3300049590 Ga0501074_0016493 Ga0501074_0016493_3576_4754 379
301 3300049823 Ga0501044_0075581 Ga0501044_0075581_2184_3362 379
302 3300030521 Ga0307511_10082433 Ga0307511_100824332 380
303 3300005468 Ga0070707_100028389 Ga0070707_1000283891 381
304 3300005983 Ga0081540_1004059 Ga0081540_10040591 381
305 3300009553 Ga0105249_10003157 Ga0105249_100031579 381
306 3300013102 Ga0157371_10100650 Ga0157371_101006502 381
307 3300013307 Ga0157372_10000131 Ga0157372_1000013110 381
308 3300025922 Ga0207646_10061401 Ga0207646_100614014 381
309 3300044693 Ga0466961_0050520 Ga0466961_0050520_922_2100 381
310 3300045049 Ga0466959_0142421 Ga0466959_0142421_10_1188 381
311 3300048915 Ga0496112_0270162 Ga0496112_0270162_291_1436 381
312 3300048916 Ga0496113_0090576 Ga0496113_0090576_254_1399 381
313 3300005468 Ga0070707_100026352 Ga0070707_1000263526 382
314 3300005471 Ga0070698_100024280 Ga0070698_1000242806 382
315 3300005577 Ga0068857_100210552 Ga0068857_1002105522 382
316 3300006028 Ga0070717_10045841 Ga0070717_100458413 382
317 3300006163 Ga0070715_10091069 Ga0070715_100910691 382
318 3300006880 Ga0075429_100114407 Ga0075429_1001144072 382
319 3300009147 Ga0114129_10007478 Ga0114129_100074782 382
320 3300025915 Ga0207693_10022983 Ga0207693_100229833 382
321 3300025915 Ga0207693_10025404 Ga0207693_100254042 382
322 3300025916 Ga0207663_10012996 Ga0207663_100129963 382
323 3300025922 Ga0207646_10198592 Ga0207646_101985922 382
324 3300026116 Ga0207674_10122427 Ga0207674_101224272 382
325 3300028800 Ga0265338_10059565 Ga0265338_100595652 382
326 3300031241 Ga0265325_10025506 Ga0265325_100255063 382
327 3300031344 Ga0265316_10086582 Ga0265316_100865822 382
328 3300031712 Ga0265342_10072756 Ga0265342_100727562 382
329 3300037068 Ga0373925_0096571 Ga0373925_0096571_313_1494 382
330 3300039450 Ga0436363_0070679 Ga0436363_0070679_2286_3467 382
331 3300045976 Ga0466967_0004823 Ga0466967_0004823_7930_9096 382
332 3300045976 Ga0466967_0037121 Ga0466967_0037121_2377_3525 382
333 3300046459 Ga0495629_0033812 Ga0495629_0033812_2282_3481 382
334 3300046461 Ga0495641_0019577 Ga0495641_0019577_635_1834 382
335 3300046517 Ga0495630_0056581 Ga0495630_0056581_255_1454 382
336 3300046526 Ga0495666_0033640 Ga0495666_0033640_697_1896 382
337 3300046531 Ga0495665_0025175 Ga0495665_0025175_233_1432 382
338 3300046642 Ga0495634_0021812 Ga0495634_0021812_1230_2429 382
339 3300046674 Ga0495588_0025884 Ga0495588_0025884_1025_2221 382
340 3300046683 Ga0495658_0050177 Ga0495658_0050177_849_2048 382
341 3300046689 Ga0495613_0039932 Ga0495613_0039932_488_1687 382
342 3300047315 Ga0495581_0020178 Ga0495581_0020178_2049_3248 382
343 3300047319 Ga0495674_0061064 Ga0495674_0061064_1481_2680 382
344 3300047673 Ga0495593_0030163 Ga0495593_0030163_410_1609 382
345 3300048089 Ga0495614_0008545 Ga0495614_0008545_2946_4145 382
346 3300048926 Ga0496123_0009845 Ga0496123_0009845_2660_3817 382
347 3300048929 Ga0496126_0000003 Ga0496126_0000003_32677_33831 382
348 3300050508 nmdc:mga09592_10880_c1 nmdc:mga09592_10880_c1_1136_2284 382
349 3300053085 Ga0495619_0027736 Ga0495619_0027736_2348_3505 382
350 3300005445 Ga0070708_100047105 Ga0070708_1000471053 383
351 3300005445 Ga0070708_100198917 Ga0070708_1001989172 383
352 3300005467 Ga0070706_100007355 Ga0070706_1000073555 383
353 3300005468 Ga0070707_100000127 Ga0070707_1000001276 383
354 3300005468 Ga0070707_100110711 Ga0070707_1001107112 383
355 3300005471 Ga0070698_100002176 Ga0070698_1000021766 383
356 3300005518 Ga0070699_100001261 Ga0070699_1000012616 383
357 3300005536 Ga0070697_100001637 Ga0070697_10000163714 383
358 3300006028 Ga0070717_10009856 Ga0070717_100098568 383
359 3300006028 Ga0070717_10083147 Ga0070717_100831472 383
360 3300006028 Ga0070717_10242569 Ga0070717_102425691 383
361 3300025910 Ga0207684_10006661 Ga0207684_100066615 383
362 3300025910 Ga0207684_10110735 Ga0207684_101107352 383
363 3300025922 Ga0207646_10000264 Ga0207646_1000026458 383
364 3300025922 Ga0207646_10010958 Ga0207646_100109582 383
365 3300025922 Ga0207646_10045197 Ga0207646_100451972 383
366 3300035113 Ga0373936_0014124 Ga0373936_0014124_568_1779 383
367 3300035117 Ga0373953_0032247 Ga0373953_0032247_263_1474 383
368 3300035118 Ga0373954_0014859 Ga0373954_0014859_881_2092 383
369 3300035120 Ga0373957_0014328 Ga0373957_0014328_520_1731 383
370 3300035410 Ga0373924_0009617 Ga0373924_0009617_962_2173 383
371 3300037068 Ga0373925_0066795 Ga0373925_0066795_461_1672 383
372 3300044656 Ga0466969_0062337 Ga0466969_0062337_32_1183 383
373 3300044693 Ga0466961_0007282 Ga0466961_0007282_5664_6818 383
374 3300044765 Ga0466970_0052630 Ga0466970_0052630_175_1326 383
375 3300046454 Ga0495592_0012954 Ga0495592_0012954_1372_2583 383
376 3300046459 Ga0495629_0115750 Ga0495629_0115750_102_1313 383
377 3300046461 Ga0495641_0046716 Ga0495641_0046716_738_1949 383
378 3300046462 Ga0495651_0076334 Ga0495651_0076334_1193_2404 383
379 3300046463 Ga0495653_0062757 Ga0495653_0062757_753_1964 383
380 3300046473 Ga0495582_0026254 Ga0495582_0026254_1719_2930 383
381 3300046511 Ga0495608_0064060 Ga0495608_0064060_1065_2276 383
382 3300046516 Ga0495628_0101212 Ga0495628_0101212_750_1961 383
383 3300046526 Ga0495666_0023132 Ga0495666_0023132_1274_2485 383
384 3300046529 Ga0495652_0080130 Ga0495652_0080130_95_1258 383
385 3300046531 Ga0495665_0001587 Ga0495665_0001587_1303_2514 383
386 3300046533 Ga0495640_0010592 Ga0495640_0010592_4952_6163 383
387 3300046536 Ga0495587_0021197 Ga0495587_0021197_2662_3873 383
388 3300046559 Ga0495667_0023474 Ga0495667_0023474_896_2107 383
389 3300046675 Ga0495657_0045565 Ga0495657_0045565_948_2159 383
390 3300046679 Ga0495623_0005330 Ga0495623_0005330_5911_7122 383
391 3300046680 Ga0495646_0068460 Ga0495646_0068460_750_1961 383
392 3300046809 Ga0495600_0018292 Ga0495600_0018292_2288_3499 383
393 3300047315 Ga0495581_0032089 Ga0495581_0032089_1079_2290 383
394 3300047319 Ga0495674_0091466 Ga0495674_0091466_1253_2464 383
395 3300047322 Ga0495680_0064387 Ga0495680_0064387_1406_2617 383
396 3300047444 Ga0495675_0032010 Ga0495675_0032010_1193_2404 383
397 3300047673 Ga0495593_0006697 Ga0495593_0006697_4176_5387 383
398 3300049585 Ga0501069_0023088 Ga0501069_0023088_568_1719 383
399 3300053077 Ga0495601_0119184 Ga0495601_0119184_80_1243 383
400 3300053084 Ga0495595_0036767 Ga0495595_0036767_58_1269 383
401 3300053085 Ga0495619_0001215 Ga0495619_0001215_14312_15523 383
402 3300005329 Ga0070683_100207626 Ga0070683_1002076261 384
403 3300005436 Ga0070713_100054510 Ga0070713_1000545103 384
404 3300005467 Ga0070706_100024348 Ga0070706_1000243483 384
405 3300005471 Ga0070698_100006322 Ga0070698_1000063224 384
406 3300005471 Ga0070698_100026259 Ga0070698_1000262595 384
407 3300005471 Ga0070698_100032101 Ga0070698_1000321013 384
408 3300005471 Ga0070698_100177106 Ga0070698_1001771062 384
409 3300005983 Ga0081540_1000330 Ga0081540_100033036 384
410 3300006028 Ga0070717_10006637 Ga0070717_100066371 384
411 3300006028 Ga0070717_10016074 Ga0070717_100160745 384
412 3300006846 Ga0075430_100000490 Ga0075430_10000049017 384
413 3300024225 Ga0224572_1005226 Ga0224572_10052262 384
414 3300025898 Ga0207692_10014046 Ga0207692_100140462 384
415 3300025904 Ga0207647_10005590 Ga0207647_100055904 384
416 3300025906 Ga0207699_10050424 Ga0207699_100504242 384
417 3300025910 Ga0207684_10003975 Ga0207684_100039758 384
418 3300025910 Ga0207684_10009113 Ga0207684_100091135 384
419 3300025910 Ga0207684_10056121 Ga0207684_100561212 384
420 3300025922 Ga0207646_10000950 Ga0207646_1000095025 384
421 3300025922 Ga0207646_10156075 Ga0207646_101560753 384
422 3300025928 Ga0207700_10022592 Ga0207700_100225923 384
423 3300025929 Ga0207664_10029453 Ga0207664_100294533 384
424 3300025944 Ga0207661_10137477 Ga0207661_101374772 384
425 3300025945 Ga0207679_10102932 Ga0207679_101029322 384
426 3300032002 Ga0307416_100076167 Ga0307416_1000761673 384
427 3300032126 Ga0307415_100031077 Ga0307415_1000310772 384
428 3300032126 Ga0307415_100213633 Ga0307415_1002136332 384
429 3300035112 Ga0373932_0004521 Ga0373932_0004521_1605_2810 384
430 3300036401 Ga0373937_0115767 Ga0373937_0115767_912_2150 384
431 3300037418 Ga0395900_0220235 Ga0395900_0220235_686_1852 384
432 3300037853 Ga0436364_0945769 Ga0436364_0945769_44_1366 384
433 3300044719 Ga0466971_0093727 Ga0466971_0093727_25_1191 384
434 3300045976 Ga0466967_0067109 Ga0466967_0067109_1182_2351 384
435 3300046462 Ga0495651_0032741 Ga0495651_0032741_2457_3695 384
436 3300046511 Ga0495608_0195130 Ga0495608_0195130_27_1265 384
437 3300046529 Ga0495652_0065090 Ga0495652_0065090_1797_3035 384
438 3300046559 Ga0495667_0050509 Ga0495667_0050509_756_1994 384
439 3300047317 Ga0495604_0012990 Ga0495604_0012990_3458_4696 384
440 3300047322 Ga0495680_0009913 Ga0495680_0009913_3621_4859 384
441 3300048088 Ga0495602_0102740 Ga0495602_0102740_357_1595 384
442 3300050509 nmdc:mga0qj67_813_c1 nmdc:mga0qj67_813_c1_12700_13872 384
443 3300005614 Ga0068856_100049655 Ga0068856_1000496553 385
444 3300025915 Ga0207693_10009125 Ga0207693_100091256 385
445 3300025916 Ga0207663_10056673 Ga0207663_100566733 385
446 3300025928 Ga0207700_10048206 Ga0207700_100482061 385
447 3300025928 Ga0207700_10100662 Ga0207700_101006621 385
448 3300025939 Ga0207665_10005974 Ga0207665_100059746 385
449 3300035088 Ga0373940_0001674 Ga0373940_0001674_527_1741 385
450 3300035090 Ga0373949_0004023 Ga0373949_0004023_694_1908 385
451 3300035091 Ga0373951_0013965 Ga0373951_0013965_546_1760 385
452 3300035115 Ga0373941_0052163 Ga0373941_0052163_46_1260 385
453 3300035121 Ga0373960_0012087 Ga0373960_0012087_802_2016 385
454 3300035691 Ga0373931_0033175 Ga0373931_0033175_205_1419 385
455 3300035692 Ga0373935_0001226 Ga0373935_0001226_4559_5809 385
456 3300035725 Ga0373947_0000007 Ga0373947_0000007_116910_118160 385
457 3300044684 Ga0466966_0073487 Ga0466966_0073487_291_1475 385
458 3300044693 Ga0466961_0035741 Ga0466961_0035741_1733_2917 385
459 3300045049 Ga0466959_0062574 Ga0466959_0062574_423_1607 385
460 3300045836 Ga0466958_0137712 Ga0466958_0137712_48_1226 385
461 3300048903 Ga0496100_0085072 Ga0496100_0085072_477_1670 385
462 3300048904 Ga0496101_0022577 Ga0496101_0022577_2731_3924 385
463 3300048905 Ga0496102_0176082 Ga0496102_0176082_359_1573 385
464 3300048908 Ga0496105_0124581 Ga0496105_0124581_786_2000 385
465 3300048910 Ga0496107_0074401 Ga0496107_0074401_71_1285 385
466 3300048910 Ga0496107_0076863 Ga0496107_0076863_1033_2226 385
467 3300048911 Ga0496108_0028194 Ga0496108_0028194_1624_2838 385
468 3300048912 Ga0496109_0088322 Ga0496109_0088322_1507_2721 385
469 3300048917 Ga0496114_0166947 Ga0496114_0166947_588_1781 385
470 3300049569 Ga0501032_0002085 Ga0501032_0002085_9544_10737 385
471 3300049572 Ga0501036_0231089 Ga0501036_0231089_218_1411 385
472 3300049573 Ga0501037_0000875 Ga0501037_0000875_4342_5535 385
473 3300049574 Ga0501038_0002113 Ga0501038_0002113_8472_9665 385
474 3300049574 Ga0501038_0014492 Ga0501038_0014492_3986_5179 385
475 3300049575 Ga0501039_0001151 Ga0501039_0001151_9536_10729 385
476 3300049579 Ga0501043_0004823 Ga0501043_0004823_8445_9638 385
477 3300049586 Ga0501070_0004495 Ga0501070_0004495_9290_10483 385
478 3300049823 Ga0501044_0110823 Ga0501044_0110823_483_1676 385
479 3300050512 nmdc:mga0n895_21202_c1 nmdc:mga0n895_21202_c1_1992_3206 385
480 3300050515 nmdc:mga0a205_42248_c1 nmdc:mga0a205_42248_c1_2045_3259 385
481 3300005327 Ga0070658_10041115 Ga0070658_100411153 387
482 3300005435 Ga0070714_100104295 Ga0070714_1001042952 387
483 3300005455 Ga0070663_100011294 Ga0070663_1000112944 387
484 3300005563 Ga0068855_100026813 Ga0068855_1000268135 387
485 3300005578 Ga0068854_100015854 Ga0068854_1000158542 387
486 3300005616 Ga0068852_100008996 Ga0068852_1000089964 387
487 3300009093 Ga0105240_10043032 Ga0105240_100430322 387
488 3300009174 Ga0105241_10022072 Ga0105241_100220724 387
489 3300010375 Ga0105239_10231708 Ga0105239_102317082 387
490 3300025904 Ga0207647_10007869 Ga0207647_100078692 387
491 3300025906 Ga0207699_10079305 Ga0207699_100793051 387
492 3300025911 Ga0207654_10014199 Ga0207654_100141993 387
493 3300025913 Ga0207695_10002554 Ga0207695_100025544 387
494 3300025914 Ga0207671_10000977 Ga0207671_1000097727 387
495 3300025924 Ga0207694_10001130 Ga0207694_1000113017 387
496 3300025949 Ga0207667_10035927 Ga0207667_100359272 387
497 3300025981 Ga0207640_10009464 Ga0207640_100094643 387
498 3300026041 Ga0207639_10050312 Ga0207639_100503121 387
499 3300026067 Ga0207678_10016515 Ga0207678_100165155 387
500 3300028379 Ga0268266_10136048 Ga0268266_101360482 387

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07969

Amidohydro_3

Amidohydrolase family

139

435

0.76

PF01979

Amidohydro_1

Amidohydrolase family

108

436

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
2puz-assembly1.cif.gz_B crystal structure of imidazolonepropionase from agrobacterium tumefaciens with bound product n-formimino-l-glutamate 0.9467 3 387
2g3f-assembly1.cif.gz_A crystal structure of imidazolonepropionase complexed with imidazole-4-acetic acid sodium salt, a substrate homologue 0.9451 4 386
2puz-assembly1.cif.gz_B crystal structure of imidazolonepropionase from agrobacterium tumefaciens with bound product n-formimino-l-glutamate 0.9396 3 387
2oof-assembly1.cif.gz_A the crystal structure of 4-imidazolone-5-propanoate amidohydrolase from environmental sample 0.9383 4 385
2g3f-assembly1.cif.gz_A crystal structure of imidazolonepropionase complexed with imidazole-4-acetic acid sodium salt, a substrate homologue 0.9332 4 386
ID Description Score Start End Superfamily
af_Q22419_88_385_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9519 63 342 3.20.20.140
af_Q4CLJ4_1_196_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9464 157 340 3.20.20.140
2g3fA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9413 63 342 3.20.20.140
2q09A02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9326 63 340 3.20.20.140
af_Q22419_88_385_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8931 63 342 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A6B3G3J1-F1-model_v4 Imidazolonepropionase (EC 3.5.2.7) 0.9981 155 260 GO:0005737
GO:0019556
GO:0046872
GO:0050480
AF-A0A6J5ZNT4-F1-model_v4 imidazolonepropionase (EC 3.5.2.7) 0.9974 225 386 GO:0005737
GO:0019556
GO:0046872
GO:0050480
AF-A0A838HBX0-F1-model_v4 imidazolonepropionase (EC 3.5.2.7) 0.9973 96 387 GO:0005737
GO:0019556
GO:0046872
GO:0050480
AF-A0A4D4KZ58-F1-model_v4 imidazolonepropionase (EC 3.5.2.7) 0.9972 177 386 GO:0005737
GO:0019556
GO:0046872
GO:0050480
AF-A0A1J5PVM0-F1-model_v4 imidazolonepropionase (EC 3.5.2.7) 0.9964 164 381 GO:0005737
GO:0019556
GO:0046872
GO:0050480

Feature Viewer

pLDDT pTM Quality
94.23 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map