F455549

General Info

Members Datasets Scaffolds Average Seq Length
500 197 1000 211

Family's Representative Sequence

Representative Sequence 3300025927|Ga0207687_10182046|Ga0207687_101820462
Length 237
Sequence MAKPEIRSEGDAFREAFARRGAEPALMPDERRFYETPATGPRCSAPAALRNREPIAEVLADWLPASGLVLEIASGTGEHAVYFAERFPALEWQPSDIHPDALASIADWRETAALPNLRPPVAVDASAADWPIGRADAVLSINMLHISPWASAIGLVAGADRLLAAGAPLILYGPWLKDDIETAPSNWDFDADLKRRDPAWGLRRVEEFAAEAEPRGFTLHAVRSMPANNLMMLWRKT

Samples

Sample ID Description Type Environment
1 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
51 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
132 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
133 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
134 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
135 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
136 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
137 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
138 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
139 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
142 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
143 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
144 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
145 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
146 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
147 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
148 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
149 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
150 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
151 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
152 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
153 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
154 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
155 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
156 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
157 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
158 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
159 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
160 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
161 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
162 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
163 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
164 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
165 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
166 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
167 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
168 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
169 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
170 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
171 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
172 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
173 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
174 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
175 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
176 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
177 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
178 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
179 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
180 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
181 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
182 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
183 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
184 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
185 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
186 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
187 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
188 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
189 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
190 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
191 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
192 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
193 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
194 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
195 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
196 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
197 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.2
Nodule 0
Rhizoplane 2.8
Rhizosphere 94.4
Stem 0
Stem Tuber 0
Unclassified 11.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207687_10182046 3300025927 Bacteria 1629
2 JGI24737J22298_10002168 3300001990 Bacteria 6998
3 JGI24735J21928_10000970 3300002067 Bacteria 10261
4 JGI24735J21928_10001752 3300002067 Bacteria 7650
5 Ga0070676_10336060 3300005328 Unclassified 1034
6 Ga0070683_100006972 3300005329 Bacteria 9504
7 Ga0070683_100142351 3300005329 Bacteria 2272
8 Ga0070690_100057848 3300005330 Bacteria 2488
9 Ga0070670_100042083 3300005331 Bacteria 3926
10 Ga0070670_100057432 3300005331 Bacteria 3341
11 Ga0070670_100098802 3300005331 Bacteria 2512
12 Ga0070666_10042216 3300005335 Bacteria 3050
13 Ga0070680_100614424 3300005336 Bacteria 933
14 Ga0070682_100003586 3300005337 Bacteria 8594
15 Ga0070682_100085170 3300005337 Bacteria 2056
16 Ga0068868_100016418 3300005338 Bacteria 5498
17 Ga0068868_100798821 3300005338 Bacteria 851
18 Ga0070660_100003337 3300005339 Bacteria 11034
19 Ga0070660_100122986 3300005339 Bacteria 2072
20 Ga0070660_100606564 3300005339 Bacteria 915
21 Ga0070660_100787246 3300005339 Bacteria 799
22 Ga0070689_100129833 3300005340 Unclassified 2020
23 Ga0070691_10032882 3300005341 Bacteria 2438
24 Ga0070687_100197970 3300005343 Unclassified 1215
25 Ga0070661_100004629 3300005344 Bacteria 9467
26 Ga0070661_100006539 3300005344 Bacteria 8041
27 Ga0070661_100031892 3300005344 Bacteria 3812
28 Ga0070661_100081257 3300005344 Bacteria 2392
29 Ga0070661_100203724 3300005344 Bacteria 1513
30 Ga0070661_100462670 3300005344 Bacteria 1010
31 Ga0070661_100538971 3300005344 Bacteria 938
32 Ga0070668_100026457 3300005347 Bacteria 4403
33 Ga0070668_100434768 3300005347 Bacteria 1126
34 Ga0070669_100303345 3300005353 Bacteria 1285
35 Ga0070669_100740099 3300005353 Bacteria 832
36 Ga0070675_100004996 3300005354 Bacteria 10127
37 Ga0070671_100000937 3300005355 Bacteria 21358
38 Ga0070671_100049394 3300005355 Bacteria 3500
39 Ga0070671_100177954 3300005355 Bacteria 1800
40 Ga0070673_100003681 3300005364 Bacteria 9603
41 Ga0070673_100127197 3300005364 Bacteria 2133
42 Ga0070673_100445251 3300005364 Unclassified 1164
43 Ga0070659_100000952 3300005366 Bacteria 21291
44 Ga0070659_100031512 3300005366 Bacteria 4107
45 Ga0070659_100052634 3300005366 Bacteria 3203
46 Ga0070659_100095295 3300005366 Bacteria 2390
47 Ga0070659_100651509 3300005366 Bacteria 908
48 Ga0070667_100066388 3300005367 Bacteria 3065
49 Ga0070667_100527452 3300005367 Bacteria 1084
50 Ga0070714_100035760 3300005435 Bacteria 4163
51 Ga0070714_100040484 3300005435 Bacteria 3928
52 Ga0070714_100171822 3300005435 Bacteria 1967
53 Ga0070714_100178880 3300005435 Bacteria 1929
54 Ga0070713_100912752 3300005436 Bacteria 845
55 Ga0070663_100007719 3300005455 Bacteria 6569
56 Ga0070663_100102619 3300005455 Bacteria 2137
57 Ga0070663_100117035 3300005455 Unclassified 2009
58 Ga0070663_100123393 3300005455 Bacteria 1959
59 Ga0070663_100291658 3300005455 Bacteria 1303
60 Ga0070663_100344242 3300005455 Bacteria 1205
61 Ga0070678_100007633 3300005456 Bacteria 6428
62 Ga0070678_100019296 3300005456 Bacteria 4442
63 Ga0070678_100038828 3300005456 Bacteria 3354
64 Ga0070678_100366100 3300005456 Unclassified 1243
65 Ga0070662_100019918 3300005457 Bacteria 4565
66 Ga0070662_100046234 3300005457 Bacteria 3127
67 Ga0070662_100197718 3300005457 Bacteria 1593
68 Ga0070662_100417702 3300005457 Bacteria 1109
69 Ga0070681_10252056 3300005458 Bacteria 1678
70 Ga0068867_100055922 3300005459 Bacteria 2918
71 Ga0068867_100080125 3300005459 Bacteria 2458
72 Ga0068867_101056239 3300005459 Bacteria 739
73 Ga0070679_100012704 3300005530 Bacteria 8055
74 Ga0070679_100138052 3300005530 Bacteria 2419
75 Ga0070679_100454789 3300005530 Bacteria 1225
76 Ga0070684_100064378 3300005535 Bacteria 3216
77 Ga0068853_100073208 3300005539 Bacteria 2986
78 Ga0068853_100284820 3300005539 Bacteria 1524
79 Ga0068853_100381987 3300005539 Unclassified 1315
80 Ga0070672_100043774 3300005543 Bacteria 3455
81 Ga0070672_100180386 3300005543 Bacteria 1759
82 Ga0070672_100566843 3300005543 Unclassified 987
83 Ga0070686_100102478 3300005544 Unclassified 1936
84 Ga0070693_100088745 3300005547 Unclassified 1860
85 Ga0070665_100038981 3300005548 Bacteria 4777
86 Ga0070665_100041076 3300005548 Bacteria 4648
87 Ga0070665_100061754 3300005548 Bacteria 3757
88 Ga0070665_101388606 3300005548 Unclassified 711
89 Ga0068855_100028425 3300005563 Bacteria 6689
90 Ga0068855_100253785 3300005563 Bacteria 1961
91 Ga0068855_100381148 3300005563 Bacteria 1548
92 Ga0068855_100477501 3300005563 Bacteria 1357
93 Ga0068855_100618402 3300005563 Bacteria 1166
94 Ga0070664_100077575 3300005564 Bacteria 2856
95 Ga0070664_100121519 3300005564 Bacteria 2287
96 Ga0070664_100137483 3300005564 Unclassified 2149
97 Ga0070664_100554081 3300005564 Bacteria 1063
98 Ga0070664_101075374 3300005564 Unclassified 757
99 Ga0068857_100003820 3300005577 Bacteria 12676
100 Ga0068857_100029415 3300005577 Bacteria 4848
101 Ga0068857_100052081 3300005577 Bacteria 3632
102 Ga0068857_100229060 3300005577 Bacteria 1699
103 Ga0068857_100954456 3300005577 Bacteria 824
104 Ga0068854_100011462 3300005578 Bacteria 5776
105 Ga0068854_100056060 3300005578 Bacteria 2839
106 Ga0068854_100185323 3300005578 Unclassified 1628
107 Ga0068854_100305241 3300005578 Bacteria 1289
108 Ga0068854_100331467 3300005578 Bacteria 1240
109 Ga0068856_100045325 3300005614 Bacteria 4330
110 Ga0068856_100052005 3300005614 Bacteria 4039
111 Ga0068856_100158969 3300005614 Bacteria 2270
112 Ga0068856_100706817 3300005614 Bacteria 1028
113 Ga0068852_100006300 3300005616 Bacteria 8565
114 Ga0068852_100008088 3300005616 Bacteria 7717
115 Ga0068852_100013457 3300005616 Bacteria 6264
116 Ga0068852_100891117 3300005616 Bacteria 906
117 Ga0068852_100904117 3300005616 Unclassified 900
118 Ga0068859_100379209 3300005617 Bacteria 1510
119 Ga0068859_100443309 3300005617 Unclassified 1395
120 Ga0068866_10036624 3300005718 Bacteria 2405
121 Ga0068851_10007169 3300005834 Bacteria 5110
122 Ga0068851_10058885 3300005834 Bacteria 1964
123 Ga0068851_10080838 3300005834 Bacteria 1697
124 Ga0068851_10133700 3300005834 Unclassified 1343
125 Ga0068863_100005172 3300005841 Bacteria 12867
126 Ga0068863_100014937 3300005841 Bacteria 7458
127 Ga0068863_100028414 3300005841 Bacteria 5340
128 Ga0068863_100291612 3300005841 Bacteria 1581
129 Ga0068858_100057107 3300005842 Bacteria 3607
130 Ga0068858_100146766 3300005842 Bacteria 2216
131 Ga0068862_100002736 3300005844 Bacteria 15475
132 Ga0068862_100007485 3300005844 Bacteria 9052
133 Ga0075367_10016341 3300006178 Bacteria 4053
134 Ga0075369_10015223 3300006186 Bacteria 3084
135 Ga0097621_100004831 3300006237 Bacteria 9440
136 Ga0097621_100051812 3300006237 Bacteria 3341
137 Ga0068871_100004873 3300006358 Bacteria 9375
138 Ga0068871_100007517 3300006358 Bacteria 7792
139 Ga0068871_100425210 3300006358 Bacteria 1187
140 Ga0068865_100003386 3300006881 Bacteria 9547
141 Ga0068865_100030645 3300006881 Bacteria 3579
142 Ga0097620_100379192 3300006931 Bacteria 1510
143 Ga0097620_100443313 3300006931 Unclassified 1395
144 Ga0105240_10009782 3300009093 Bacteria 13538
145 Ga0105240_10408465 3300009093 Bacteria 1528
146 Ga0111539_10695653 3300009094 Bacteria 1183
147 Ga0105245_10015439 3300009098 Bacteria 6659
148 Ga0105247_10138504 3300009101 Bacteria 1592
149 Ga0105243_10080718 3300009148 Bacteria 2654
150 Ga0105241_10057130 3300009174 Bacteria 2993
151 Ga0105241_10526533 3300009174 Bacteria 1058
152 Ga0105242_10076365 3300009176 Bacteria 2793
153 Ga0105242_10982424 3300009176 Unclassified 851
154 Ga0105248_10010355 3300009177 Bacteria 10266
155 Ga0105248_10021208 3300009177 Bacteria 7198
156 Ga0105248_10051256 3300009177 Bacteria 4631
157 Ga0105248_10228777 3300009177 Bacteria 2093
158 Ga0105248_10569094 3300009177 Bacteria 1278
159 Ga0105237_10010455 3300009545 Bacteria 9867
160 Ga0105238_10002513 3300009551 Bacteria 18352
161 Ga0105238_10064919 3300009551 Bacteria 3651
162 Ga0105239_10033734 3300010375 Bacteria 5620
163 Ga0105239_10151161 3300010375 Bacteria 2591
164 Ga0105246_10006278 3300011119 Bacteria 7255
165 Ga0105246_10124754 3300011119 Bacteria 1914
166 Ga0105246_10294108 3300011119 Unclassified 1308
167 Ga0157373_10018364 3300013100 Bacteria 5093
168 Ga0157373_10289177 3300013100 Bacteria 1162
169 Ga0157373_10391405 3300013100 Bacteria 995
170 Ga0157373_10642690 3300013100 Unclassified 774
171 Ga0157371_10016811 3300013102 Bacteria 5448
172 Ga0157371_10027751 3300013102 Bacteria 4103
173 Ga0157371_10088011 3300013102 Bacteria 2199
174 Ga0157370_10165632 3300013104 Bacteria 2055
175 Ga0157370_10170519 3300013104 Bacteria 2023
176 Ga0157370_10190328 3300013104 Bacteria 1905
177 Ga0157369_10008794 3300013105 Bacteria 11571
178 Ga0157369_10026544 3300013105 Bacteria 6424
179 Ga0157369_10029795 3300013105 Bacteria 6028
180 Ga0157369_10136161 3300013105 Bacteria 2600
181 Ga0157374_10017303 3300013296 Bacteria 6343
182 Ga0157374_10158088 3300013296 Bacteria 2207
183 Ga0157378_10525314 3300013297 Unclassified 1186
184 Ga0163162_10028848 3300013306 Bacteria 5493
185 Ga0163162_10184079 3300013306 Bacteria 2215
186 Ga0157372_10004040 3300013307 Bacteria 15730
187 Ga0157372_10173744 3300013307 Bacteria 2493
188 Ga0157372_11235210 3300013307 Unclassified 863
189 Ga0157375_10007221 3300013308 Bacteria 9716
190 Ga0163163_10003678 3300014325 Bacteria 13053
191 Ga0163163_10037594 3300014325 Bacteria 4711
192 Ga0157377_10100018 3300014745 Bacteria 1726
193 Ga0157379_10107078 3300014968 Bacteria 2510
194 Ga0157376_10026624 3300014969 Bacteria 4573
195 Ga0163161_10161400 3300017792 Bacteria 1709
196 Ga0207697_10006030 3300025315 Bacteria 5544
197 Ga0207697_10038268 3300025315 Bacteria 1966
198 Ga0207656_10033899 3300025321 Bacteria 2129
199 Ga0207656_10089451 3300025321 Unclassified 1395
200 Ga0207656_10108500 3300025321 Bacteria 1280
201 Ga0207688_10024027 3300025901 Bacteria 3342
202 Ga0207688_10045051 3300025901 Bacteria 2460
203 Ga0207680_10025100 3300025903 Bacteria 3283
204 Ga0207680_10188038 3300025903 Bacteria 1400
205 Ga0207647_10002263 3300025904 Bacteria 14665
206 Ga0207647_10022661 3300025904 Unclassified 4168
207 Ga0207647_10097113 3300025904 Bacteria 1752
208 Ga0207647_10152481 3300025904 Bacteria 1350
209 Ga0207645_10044751 3300025907 Bacteria 2831
210 Ga0207645_10171115 3300025907 Bacteria 1424
211 Ga0207643_10270991 3300025908 Bacteria 1050
212 Ga0207705_10011549 3300025909 Bacteria 6387
213 Ga0207705_10105297 3300025909 Bacteria 2079
214 Ga0207707_10022651 3300025912 Bacteria 5493
215 Ga0207707_10046847 3300025912 Unclassified 3766
216 Ga0207707_10425814 3300025912 Bacteria 1137
217 Ga0207707_10536269 3300025912 Bacteria 995
218 Ga0207695_10063905 3300025913 Bacteria 3792
219 Ga0207695_10513539 3300025913 Bacteria 1080
220 Ga0207671_10015467 3300025914 Bacteria 5971
221 Ga0207660_10144721 3300025917 Unclassified 1820
222 Ga0207657_10002867 3300025919 Bacteria 18531
223 Ga0207657_10014121 3300025919 Bacteria 7814
224 Ga0207657_10026494 3300025919 Bacteria 5327
225 Ga0207657_10028130 3300025919 Bacteria 5135
226 Ga0207657_10064559 3300025919 Bacteria 3124
227 Ga0207657_10079248 3300025919 Bacteria 2764
228 Ga0207649_10006009 3300025920 Bacteria 6588
229 Ga0207649_10010089 3300025920 Bacteria 5182
230 Ga0207649_10010403 3300025920 Bacteria 5111
231 Ga0207649_10399623 3300025920 Bacteria 1028
232 Ga0207652_10128149 3300025921 Unclassified 2262
233 Ga0207652_10172658 3300025921 Bacteria 1940
234 Ga0207681_10379541 3300025923 Bacteria 1137
235 Ga0207694_10001011 3300025924 Bacteria 24528
236 Ga0207650_10387141 3300025925 Unclassified 1155
237 Ga0207659_10012945 3300025926 Bacteria 5328
238 Ga0207659_10295554 3300025926 Bacteria 1328
239 Ga0207687_10176273 3300025927 Bacteria 1653
240 Ga0207700_10259096 3300025928 Unclassified 1488
241 Ga0207664_10029928 3300025929 Bacteria 4153
242 Ga0207644_10017158 3300025931 Bacteria 4883
243 Ga0207644_10054196 3300025931 Bacteria 2887
244 Ga0207644_10335200 3300025931 Unclassified 1225
245 Ga0207644_10339824 3300025931 Unclassified 1217
246 Ga0207690_10001891 3300025932 Bacteria 12848
247 Ga0207690_10010570 3300025932 Bacteria 5492
248 Ga0207690_10073461 3300025932 Bacteria 2365
249 Ga0207690_10214714 3300025932 Bacteria 1469
250 Ga0207690_10228318 3300025932 Bacteria 1428
251 Ga0207690_10528466 3300025932 Bacteria 957
252 Ga0207706_10007955 3300025933 Bacteria 9789
253 Ga0207706_10019863 3300025933 Bacteria 6039
254 Ga0207706_10029276 3300025933 Bacteria 4917
255 Ga0207706_10036172 3300025933 Bacteria 4387
256 Ga0207706_10152015 3300025933 Bacteria 2036
257 Ga0207706_10338427 3300025933 Bacteria 1309
258 Ga0207669_10150722 3300025937 Unclassified 1628
259 Ga0207704_10022398 3300025938 Bacteria 3384
260 Ga0207691_10015708 3300025940 Bacteria 7197
261 Ga0207691_10087624 3300025940 Bacteria 2793
262 Ga0207711_10010388 3300025941 Bacteria 7730
263 Ga0207711_10031455 3300025941 Bacteria 4480
264 Ga0207711_10049678 3300025941 Bacteria 3591
265 Ga0207711_10551013 3300025941 Bacteria 1076
266 Ga0207661_10027360 3300025944 Bacteria 4355
267 Ga0207661_10207778 3300025944 Unclassified 1724
268 Ga0207679_10004621 3300025945 Bacteria 8574
269 Ga0207679_10042481 3300025945 Bacteria 3268
270 Ga0207679_10128933 3300025945 Bacteria 2026
271 Ga0207679_10483153 3300025945 Unclassified 1103
272 Ga0207667_10024498 3300025949 Bacteria 6625
273 Ga0207667_10039888 3300025949 Bacteria 5001
274 Ga0207667_10207557 3300025949 Bacteria 2008
275 Ga0207667_10412714 3300025949 Bacteria 1374
276 Ga0207667_10512052 3300025949 Bacteria 1216
277 Ga0207651_10002905 3300025960 Bacteria 8275
278 Ga0207651_10015209 3300025960 Bacteria 4465
279 Ga0207651_10015584 3300025960 Bacteria 4423
280 Ga0207651_10226955 3300025960 Bacteria 1513
281 Ga0207668_10002897 3300025972 Bacteria 10066
282 Ga0207668_10562232 3300025972 Bacteria 989
283 Ga0207640_10047489 3300025981 Unclassified 2769
284 Ga0207640_10100534 3300025981 Unclassified 2026
285 Ga0207640_10226523 3300025981 Bacteria 1435
286 Ga0207640_10262771 3300025981 Bacteria 1346
287 Ga0207640_10475837 3300025981 Bacteria 1035
288 Ga0207640_10544236 3300025981 Unclassified 974
289 Ga0207658_10028700 3300025986 Bacteria 3922
290 Ga0207658_10112917 3300025986 Bacteria 2152
291 Ga0207658_10266697 3300025986 Bacteria 1461
292 Ga0207658_10340944 3300025986 Bacteria 1302
293 Ga0207658_10693031 3300025986 Bacteria 920
294 Ga0207677_10759619 3300026023 Bacteria 865
295 Ga0207703_10091207 3300026035 Bacteria 2562
296 Ga0207639_10000144 3300026041 Bacteria 53312
297 Ga0207639_10068559 3300026041 Bacteria 2764
298 Ga0207639_10088892 3300026041 Bacteria 2467
299 Ga0207639_10311645 3300026041 Unclassified 1394
300 Ga0207678_10004202 3300026067 Bacteria 12924
301 Ga0207678_10005267 3300026067 Bacteria 11583
302 Ga0207678_10007936 3300026067 Bacteria 9360
303 Ga0207678_10021689 3300026067 Bacteria 5633
304 Ga0207678_10032731 3300026067 Bacteria 4531
305 Ga0207678_10227214 3300026067 Bacteria 1598
306 Ga0207678_10303906 3300026067 Bacteria 1371
307 Ga0207678_10693789 3300026067 Bacteria 896
308 Ga0207678_11120931 3300026067 Unclassified 697
309 Ga0207702_10023021 3300026078 Bacteria 5167
310 Ga0207702_10097792 3300026078 Bacteria 2584
311 Ga0207702_10115920 3300026078 Bacteria 2390
312 Ga0207641_10052946 3300026088 Bacteria 3438
313 Ga0207641_10075483 3300026088 Bacteria 2911
314 Ga0207641_10298296 3300026088 Unclassified 1521
315 Ga0207641_10724710 3300026088 Bacteria 980
316 Ga0207648_10006581 3300026089 Bacteria 11535
317 Ga0207648_10019428 3300026089 Bacteria 6133
318 Ga0207676_10221961 3300026095 Bacteria 1684
319 Ga0207676_10260478 3300026095 Bacteria 1566
320 Ga0207676_10337782 3300026095 Unclassified 1388
321 Ga0207674_10000057 3300026116 Bacteria 113117
322 Ga0207674_10003393 3300026116 Bacteria 19537
323 Ga0207674_10005506 3300026116 Bacteria 15034
324 Ga0207674_10009490 3300026116 Bacteria 11111
325 Ga0207683_10004023 3300026121 Bacteria 12713
326 Ga0207683_10012311 3300026121 Bacteria 7302
327 Ga0207683_10012433 3300026121 Bacteria 7263
328 Ga0207683_10012456 3300026121 Bacteria 7257
329 Ga0207683_10136735 3300026121 Bacteria 2206
330 Ga0207698_10004897 3300026142 Bacteria 8212
331 Ga0207698_10018006 3300026142 Bacteria 4804
332 Ga0207698_10041945 3300026142 Bacteria 3414
333 Ga0207698_10055286 3300026142 Bacteria 3058
334 Ga0268266_10002013 3300028379 Bacteria 22668
335 Ga0268266_10018502 3300028379 Bacteria 5936
336 Ga0268266_10024236 3300028379 Bacteria 5163
337 Ga0268266_10029757 3300028379 Bacteria 4640
338 Ga0268266_11098552 3300028379 Unclassified 769
339 Ga0268265_10001537 3300028380 Bacteria 19180
340 Ga0268265_10004432 3300028380 Bacteria 9747
341 Ga0268265_10038772 3300028380 Bacteria 3507
342 Ga0268265_10273897 3300028380 Bacteria 1507
343 Ga0268265_10450354 3300028380 Bacteria 1202
344 Ga0268265_10526239 3300028380 Bacteria 1118
345 Ga0268264_10005564 3300028381 Bacteria 10670
346 Ga0268264_10314538 3300028381 Bacteria 1478
347 Ga0265327_10015529 3300031251 Bacteria 4906
348 Ga0307408_100025201 3300031548 Bacteria 4071
349 Ga0307408_100196689 3300031548 Bacteria 1628
350 Ga0307405_10074031 3300031731 Bacteria 2201
351 Ga0307405_10168796 3300031731 Bacteria 1558
352 Ga0307405_10204897 3300031731 Unclassified 1435
353 Ga0307405_10345874 3300031731 Bacteria 1145
354 Ga0307413_10008329 3300031824 Bacteria 4888
355 Ga0307413_10127491 3300031824 Bacteria 1735
356 Ga0307410_10000614 3300031852 Bacteria 14673
357 Ga0307410_10066022 3300031852 Bacteria 2491
358 Ga0307410_10202646 3300031852 Bacteria 1516
359 Ga0307406_10059334 3300031901 Bacteria 2462
360 Ga0307406_10195834 3300031901 Bacteria 1483
361 Ga0307406_10201192 3300031901 Bacteria 1466
362 Ga0307406_10612982 3300031901 Bacteria 899
363 Ga0307406_10696068 3300031901 Bacteria 848
364 Ga0307407_10101289 3300031903 Bacteria 1788
365 Ga0307407_10185926 3300031903 Bacteria 1381
366 Ga0307407_10245632 3300031903 Unclassified 1223
367 Ga0307407_10283749 3300031903 Bacteria 1148
368 Ga0307412_10033726 3300031911 Bacteria 3256
369 Ga0307412_10050639 3300031911 Bacteria 2741
370 Ga0307412_10238717 3300031911 Unclassified 1404
371 Ga0307412_10256957 3300031911 Bacteria 1359
372 Ga0307412_10259968 3300031911 Bacteria 1353
373 Ga0307412_10280147 3300031911 Bacteria 1309
374 Ga0307409_100002345 3300031995 Bacteria 9844
375 Ga0307409_100021488 3300031995 Bacteria 4425
376 Ga0307409_100140444 3300031995 Bacteria 2080
377 Ga0307409_100206303 3300031995 Bacteria 1762
378 Ga0307409_100238145 3300031995 Bacteria 1655
379 Ga0307409_100266374 3300031995 Bacteria 1575
380 Ga0307409_100315552 3300031995 Bacteria 1461
381 Ga0307409_100440131 3300031995 Bacteria 1255
382 Ga0307409_100502753 3300031995 Bacteria 1181
383 Ga0307416_100021972 3300032002 Bacteria 4594
384 Ga0307416_100097899 3300032002 Bacteria 2542
385 Ga0307416_100309933 3300032002 Bacteria 1574
386 Ga0307416_101178250 3300032002 Bacteria 871
387 Ga0307416_101336062 3300032002 Bacteria 823
388 Ga0307414_10008663 3300032004 Bacteria 5789
389 Ga0307414_10232308 3300032004 Unclassified 1521
390 Ga0307414_10552590 3300032004 Bacteria 1026
391 Ga0307411_10004802 3300032005 Bacteria 6548
392 Ga0307411_10037301 3300032005 Bacteria 3055
393 Ga0307411_10037779 3300032005 Bacteria 3039
394 Ga0307411_10092422 3300032005 Bacteria 2116
395 Ga0307411_10152649 3300032005 Bacteria 1718
396 Ga0307411_10264913 3300032005 Bacteria 1359
397 Ga0307411_10532042 3300032005 Bacteria 999
398 Ga0307415_100013573 3300032126 Bacteria 4758
399 Ga0307415_100024585 3300032126 Bacteria 3763
400 Ga0307415_100035911 3300032126 Bacteria 3241
401 Ga0307415_100204606 3300032126 Bacteria 1569
402 Ga0307415_100212140 3300032126 Unclassified 1545
403 Ga0307415_100357183 3300032126 Bacteria 1232
404 Ga0373944_0062091 3300035089 Bacteria 1201
405 Ga0373943_0004664 3300035170 Bacteria 6200
406 Ga0373946_0043752 3300035171 Bacteria 1846
407 Ga0373931_0046406 3300035691 Bacteria 2297
408 Ga0373935_0013577 3300035692 Bacteria 4917
409 Ga0395899_0114866 3300037312 Bacteria 1933
410 Ga0395899_0151648 3300037312 Bacteria 1642
411 Ga0395900_0006197 3300037418 Bacteria 12487
412 Ga0395900_0019372 3300037418 Bacteria 6941
413 Ga0395900_0040753 3300037418 Bacteria 4786
414 Ga0395900_0174227 3300037418 Bacteria 2188
415 Ga0395900_0218076 3300037418 Unclassified 1924
416 Ga0395900_0232058 3300037418 Bacteria 1855
417 Ga0395900_0297592 3300037418 Unclassified 1601
418 Ga0395900_0319838 3300037418 Bacteria 1532
419 Ga0395900_0360580 3300037418 Unclassified 1425
420 Ga0395898_0045014 3300037466 Bacteria 4339
421 Ga0395898_0055495 3300037466 Bacteria 3864
422 Ga0395898_0233707 3300037466 Bacteria 1753
423 Ga0395898_0422737 3300037466 Bacteria 1270
424 Ga0395898_0952617 3300037466 Bacteria 795
425 Ga0395905_0000092 3300037471 Bacteria 149300
426 Ga0395905_0003469 3300037471 Bacteria 16851
427 Ga0395905_0024814 3300037471 Bacteria 5658
428 Ga0395905_0039004 3300037471 Bacteria 4456
429 Ga0395905_0040395 3300037471 Bacteria 4376
430 Ga0395905_0050081 3300037471 Bacteria 3914
431 Ga0395905_0081486 3300037471 Bacteria 3033
432 Ga0395905_0189656 3300037471 Bacteria 1928
433 Ga0395905_0244827 3300037471 Bacteria 1675
434 Ga0395905_0322554 3300037471 Bacteria 1434
435 Ga0395905_0355129 3300037471 Bacteria 1358
436 Ga0395905_0440472 3300037471 Bacteria 1200
437 Ga0395905_0445309 3300037471 Bacteria 1193
438 Ga0395905_0494086 3300037471 Bacteria 1123
439 Ga0395901_0011987 3300038443 Bacteria 8794
440 Ga0395901_0036652 3300038443 Bacteria 5069
441 Ga0395901_0286331 3300038443 Bacteria 1711
442 Ga0395901_0309465 3300038443 Bacteria 1636
443 Ga0395901_0707042 3300038443 Bacteria 1005
444 Ga0436365_0322176 3300039437 Bacteria 7475
445 Ga0436361_0660318 3300039447 Bacteria 3715
446 Ga0439465_0123478 3300041413 Bacteria 909
447 Ga0451853_2762972 3300041512 Unclassified 902
448 Ga0439448_0004694 3300042005 Bacteria 3868
449 Ga0439449_0011892 3300042007 Bacteria 3273
450 Ga0439458_0005460 3300042157 Bacteria 2859
451 Ga0439459_0015582 3300042438 Bacteria 1395
452 Ga0466966_0038656 3300044684 Bacteria 3075
453 Ga0466966_0250367 3300044684 Bacteria 1067
454 Ga0466963_0084378 3300044694 Archaea 2155
455 Ga0466957_0061683 3300044842 Bacteria 2302
456 Ga0466959_0039602 3300045049 Unclassified 3483
457 Ga0466958_0242934 3300045836 Unclassified 1151
458 Ga0466958_0332691 3300045836 Unclassified 977
459 Ga0466967_0004245 3300045976 Bacteria 9621
460 Ga0466967_0010489 3300045976 Bacteria 6955
461 Ga0466967_0021721 3300045976 Bacteria 5221
462 Ga0466967_0187074 3300045976 Bacteria 1956
463 Ga0495606_0133090 3300046507 Bacteria 1476
464 Ga0495606_0223889 3300046507 Bacteria 1058
465 Ga0495642_0135259 3300046528 Bacteria 1062
466 Ga0495621_0000006 3300046539 Bacteria 44306
467 Ga0495633_0110854 3300046558 Unclassified 1272
468 Ga0495633_0126986 3300046558 Bacteria 1180
469 Ga0495668_0041143 3300046616 Bacteria 2576
470 Ga0495668_0090417 3300046616 Bacteria 1677
471 Ga0495669_0000385 3300046684 Bacteria 22116
472 Ga0495669_0002242 3300046684 Bacteria 7930
473 Ga0495669_0009485 3300046684 Bacteria 4105
474 Ga0495670_0000226 3300046691 Bacteria 25540
475 Ga0495677_0013315 3300047445 Bacteria 2993
476 Ga0496101_0055732 3300048904 Bacteria 2856
477 Ga0496102_0052842 3300048905 Bacteria 3703
478 Ga0496104_0185041 3300048907 Bacteria 1994
479 Ga0496106_0370551 3300048909 Unclassified 1151
480 Ga0496108_0025304 3300048911 Bacteria 4890
481 Ga0496109_0416380 3300048912 Unclassified 1269
482 Ga0496109_0473275 3300048912 Bacteria 1183
483 Ga0496110_0012390 3300048913 Bacteria 7010
484 Ga0496112_0011522 3300048915 Bacteria 8078
485 Ga0496112_0868648 3300048915 Bacteria 825
486 Ga0496113_0002278 3300048916 Bacteria 11074
487 Ga0496114_0000019 3300048917 Bacteria 244365
488 Ga0496114_0036993 3300048917 Bacteria 4036
489 Ga0496115_0037736 3300048918 Bacteria 3830
490 Ga0496124_0231520 3300048927 Bacteria 1381
491 nmdc:mga06z11_283706_c1 3300050494 Bacteria 981
492 Ga0500643_000137 3300053087 Bacteria 74194
493 Ga0500618_060196 3300053125 Bacteria 854
494 Ga0500559_0037429 3300053136 Bacteria 2103
495 Ga0500590_139999 3300053148 Bacteria 1107
496 Ga0500604_0017108 3300053151 Bacteria 2002
497 Ga0500624_000100 3300053157 Bacteria 41296
498 Ga0500636_0013614 3300053177 Bacteria 4778
499 Ga0500661_001005 3300055283 Bacteria 5297
500 Ga0466962_0066814 3300061719 Bacteria 1717
501 Ga0207687_10182046
502 JGI24737J22298_10002168
503 JGI24735J21928_10000970
504 JGI24735J21928_10001752
505 Ga0070676_10336060
506 Ga0070683_100006972
507 Ga0070683_100142351
508 Ga0070690_100057848
509 Ga0070670_100042083
510 Ga0070670_100057432
511 Ga0070670_100098802
512 Ga0070666_10042216
513 Ga0070680_100614424
514 Ga0070682_100003586
515 Ga0070682_100085170
516 Ga0068868_100016418
517 Ga0068868_100798821
518 Ga0070660_100003337
519 Ga0070660_100122986
520 Ga0070660_100606564
521 Ga0070660_100787246
522 Ga0070689_100129833
523 Ga0070691_10032882
524 Ga0070687_100197970
525 Ga0070661_100004629
526 Ga0070661_100006539
527 Ga0070661_100031892
528 Ga0070661_100081257
529 Ga0070661_100203724
530 Ga0070661_100462670
531 Ga0070661_100538971
532 Ga0070668_100026457
533 Ga0070668_100434768
534 Ga0070669_100303345
535 Ga0070669_100740099
536 Ga0070675_100004996
537 Ga0070671_100000937
538 Ga0070671_100049394
539 Ga0070671_100177954
540 Ga0070673_100003681
541 Ga0070673_100127197
542 Ga0070673_100445251
543 Ga0070659_100000952
544 Ga0070659_100031512
545 Ga0070659_100052634
546 Ga0070659_100095295
547 Ga0070659_100651509
548 Ga0070667_100066388
549 Ga0070667_100527452
550 Ga0070714_100035760
551 Ga0070714_100040484
552 Ga0070714_100171822
553 Ga0070714_100178880
554 Ga0070713_100912752
555 Ga0070663_100007719
556 Ga0070663_100102619
557 Ga0070663_100117035
558 Ga0070663_100123393
559 Ga0070663_100291658
560 Ga0070663_100344242
561 Ga0070678_100007633
562 Ga0070678_100019296
563 Ga0070678_100038828
564 Ga0070678_100366100
565 Ga0070662_100019918
566 Ga0070662_100046234
567 Ga0070662_100197718
568 Ga0070662_100417702
569 Ga0070681_10252056
570 Ga0068867_100055922
571 Ga0068867_100080125
572 Ga0068867_101056239
573 Ga0070679_100012704
574 Ga0070679_100138052
575 Ga0070679_100454789
576 Ga0070684_100064378
577 Ga0068853_100073208
578 Ga0068853_100284820
579 Ga0068853_100381987
580 Ga0070672_100043774
581 Ga0070672_100180386
582 Ga0070672_100566843
583 Ga0070686_100102478
584 Ga0070693_100088745
585 Ga0070665_100038981
586 Ga0070665_100041076
587 Ga0070665_100061754
588 Ga0070665_101388606
589 Ga0068855_100028425
590 Ga0068855_100253785
591 Ga0068855_100381148
592 Ga0068855_100477501
593 Ga0068855_100618402
594 Ga0070664_100077575
595 Ga0070664_100121519
596 Ga0070664_100137483
597 Ga0070664_100554081
598 Ga0070664_101075374
599 Ga0068857_100003820
600 Ga0068857_100029415
601 Ga0068857_100052081
602 Ga0068857_100229060
603 Ga0068857_100954456
604 Ga0068854_100011462
605 Ga0068854_100056060
606 Ga0068854_100185323
607 Ga0068854_100305241
608 Ga0068854_100331467
609 Ga0068856_100045325
610 Ga0068856_100052005
611 Ga0068856_100158969
612 Ga0068856_100706817
613 Ga0068852_100006300
614 Ga0068852_100008088
615 Ga0068852_100013457
616 Ga0068852_100891117
617 Ga0068852_100904117
618 Ga0068859_100379209
619 Ga0068859_100443309
620 Ga0068866_10036624
621 Ga0068851_10007169
622 Ga0068851_10058885
623 Ga0068851_10080838
624 Ga0068851_10133700
625 Ga0068863_100005172
626 Ga0068863_100014937
627 Ga0068863_100028414
628 Ga0068863_100291612
629 Ga0068858_100057107
630 Ga0068858_100146766
631 Ga0068862_100002736
632 Ga0068862_100007485
633 Ga0075367_10016341
634 Ga0075369_10015223
635 Ga0097621_100004831
636 Ga0097621_100051812
637 Ga0068871_100004873
638 Ga0068871_100007517
639 Ga0068871_100425210
640 Ga0068865_100003386
641 Ga0068865_100030645
642 Ga0097620_100379192
643 Ga0097620_100443313
644 Ga0105240_10009782
645 Ga0105240_10408465
646 Ga0111539_10695653
647 Ga0105245_10015439
648 Ga0105247_10138504
649 Ga0105243_10080718
650 Ga0105241_10057130
651 Ga0105241_10526533
652 Ga0105242_10076365
653 Ga0105242_10982424
654 Ga0105248_10010355
655 Ga0105248_10021208
656 Ga0105248_10051256
657 Ga0105248_10228777
658 Ga0105248_10569094
659 Ga0105237_10010455
660 Ga0105238_10002513
661 Ga0105238_10064919
662 Ga0105239_10033734
663 Ga0105239_10151161
664 Ga0105246_10006278
665 Ga0105246_10124754
666 Ga0105246_10294108
667 Ga0157373_10018364
668 Ga0157373_10289177
669 Ga0157373_10391405
670 Ga0157373_10642690
671 Ga0157371_10016811
672 Ga0157371_10027751
673 Ga0157371_10088011
674 Ga0157370_10165632
675 Ga0157370_10170519
676 Ga0157370_10190328
677 Ga0157369_10008794
678 Ga0157369_10026544
679 Ga0157369_10029795
680 Ga0157369_10136161
681 Ga0157374_10017303
682 Ga0157374_10158088
683 Ga0157378_10525314
684 Ga0163162_10028848
685 Ga0163162_10184079
686 Ga0157372_10004040
687 Ga0157372_10173744
688 Ga0157372_11235210
689 Ga0157375_10007221
690 Ga0163163_10003678
691 Ga0163163_10037594
692 Ga0157377_10100018
693 Ga0157379_10107078
694 Ga0157376_10026624
695 Ga0163161_10161400
696 Ga0207697_10006030
697 Ga0207697_10038268
698 Ga0207656_10033899
699 Ga0207656_10089451
700 Ga0207656_10108500
701 Ga0207688_10024027
702 Ga0207688_10045051
703 Ga0207680_10025100
704 Ga0207680_10188038
705 Ga0207647_10002263
706 Ga0207647_10022661
707 Ga0207647_10097113
708 Ga0207647_10152481
709 Ga0207645_10044751
710 Ga0207645_10171115
711 Ga0207643_10270991
712 Ga0207705_10011549
713 Ga0207705_10105297
714 Ga0207707_10022651
715 Ga0207707_10046847
716 Ga0207707_10425814
717 Ga0207707_10536269
718 Ga0207695_10063905
719 Ga0207695_10513539
720 Ga0207671_10015467
721 Ga0207660_10144721
722 Ga0207657_10002867
723 Ga0207657_10014121
724 Ga0207657_10026494
725 Ga0207657_10028130
726 Ga0207657_10064559
727 Ga0207657_10079248
728 Ga0207649_10006009
729 Ga0207649_10010089
730 Ga0207649_10010403
731 Ga0207649_10399623
732 Ga0207652_10128149
733 Ga0207652_10172658
734 Ga0207681_10379541
735 Ga0207694_10001011
736 Ga0207650_10387141
737 Ga0207659_10012945
738 Ga0207659_10295554
739 Ga0207687_10176273
740 Ga0207700_10259096
741 Ga0207664_10029928
742 Ga0207644_10017158
743 Ga0207644_10054196
744 Ga0207644_10335200
745 Ga0207644_10339824
746 Ga0207690_10001891
747 Ga0207690_10010570
748 Ga0207690_10073461
749 Ga0207690_10214714
750 Ga0207690_10228318
751 Ga0207690_10528466
752 Ga0207706_10007955
753 Ga0207706_10019863
754 Ga0207706_10029276
755 Ga0207706_10036172
756 Ga0207706_10152015
757 Ga0207706_10338427
758 Ga0207669_10150722
759 Ga0207704_10022398
760 Ga0207691_10015708
761 Ga0207691_10087624
762 Ga0207711_10010388
763 Ga0207711_10031455
764 Ga0207711_10049678
765 Ga0207711_10551013
766 Ga0207661_10027360
767 Ga0207661_10207778
768 Ga0207679_10004621
769 Ga0207679_10042481
770 Ga0207679_10128933
771 Ga0207679_10483153
772 Ga0207667_10024498
773 Ga0207667_10039888
774 Ga0207667_10207557
775 Ga0207667_10412714
776 Ga0207667_10512052
777 Ga0207651_10002905
778 Ga0207651_10015209
779 Ga0207651_10015584
780 Ga0207651_10226955
781 Ga0207668_10002897
782 Ga0207668_10562232
783 Ga0207640_10047489
784 Ga0207640_10100534
785 Ga0207640_10226523
786 Ga0207640_10262771
787 Ga0207640_10475837
788 Ga0207640_10544236
789 Ga0207658_10028700
790 Ga0207658_10112917
791 Ga0207658_10266697
792 Ga0207658_10340944
793 Ga0207658_10693031
794 Ga0207677_10759619
795 Ga0207703_10091207
796 Ga0207639_10000144
797 Ga0207639_10068559
798 Ga0207639_10088892
799 Ga0207639_10311645
800 Ga0207678_10004202
801 Ga0207678_10005267
802 Ga0207678_10007936
803 Ga0207678_10021689
804 Ga0207678_10032731
805 Ga0207678_10227214
806 Ga0207678_10303906
807 Ga0207678_10693789
808 Ga0207678_11120931
809 Ga0207702_10023021
810 Ga0207702_10097792
811 Ga0207702_10115920
812 Ga0207641_10052946
813 Ga0207641_10075483
814 Ga0207641_10298296
815 Ga0207641_10724710
816 Ga0207648_10006581
817 Ga0207648_10019428
818 Ga0207676_10221961
819 Ga0207676_10260478
820 Ga0207676_10337782
821 Ga0207674_10000057
822 Ga0207674_10003393
823 Ga0207674_10005506
824 Ga0207674_10009490
825 Ga0207683_10004023
826 Ga0207683_10012311
827 Ga0207683_10012433
828 Ga0207683_10012456
829 Ga0207683_10136735
830 Ga0207698_10004897
831 Ga0207698_10018006
832 Ga0207698_10041945
833 Ga0207698_10055286
834 Ga0268266_10002013
835 Ga0268266_10018502
836 Ga0268266_10024236
837 Ga0268266_10029757
838 Ga0268266_11098552
839 Ga0268265_10001537
840 Ga0268265_10004432
841 Ga0268265_10038772
842 Ga0268265_10273897
843 Ga0268265_10450354
844 Ga0268265_10526239
845 Ga0268264_10005564
846 Ga0268264_10314538
847 Ga0265327_10015529
848 Ga0307408_100025201
849 Ga0307408_100196689
850 Ga0307405_10074031
851 Ga0307405_10168796
852 Ga0307405_10204897
853 Ga0307405_10345874
854 Ga0307413_10008329
855 Ga0307413_10127491
856 Ga0307410_10000614
857 Ga0307410_10066022
858 Ga0307410_10202646
859 Ga0307406_10059334
860 Ga0307406_10195834
861 Ga0307406_10201192
862 Ga0307406_10612982
863 Ga0307406_10696068
864 Ga0307407_10101289
865 Ga0307407_10185926
866 Ga0307407_10245632
867 Ga0307407_10283749
868 Ga0307412_10033726
869 Ga0307412_10050639
870 Ga0307412_10238717
871 Ga0307412_10256957
872 Ga0307412_10259968
873 Ga0307412_10280147
874 Ga0307409_100002345
875 Ga0307409_100021488
876 Ga0307409_100140444
877 Ga0307409_100206303
878 Ga0307409_100238145
879 Ga0307409_100266374
880 Ga0307409_100315552
881 Ga0307409_100440131
882 Ga0307409_100502753
883 Ga0307416_100021972
884 Ga0307416_100097899
885 Ga0307416_100309933
886 Ga0307416_101178250
887 Ga0307416_101336062
888 Ga0307414_10008663
889 Ga0307414_10232308
890 Ga0307414_10552590
891 Ga0307411_10004802
892 Ga0307411_10037301
893 Ga0307411_10037779
894 Ga0307411_10092422
895 Ga0307411_10152649
896 Ga0307411_10264913
897 Ga0307411_10532042
898 Ga0307415_100013573
899 Ga0307415_100024585
900 Ga0307415_100035911
901 Ga0307415_100204606
902 Ga0307415_100212140
903 Ga0307415_100357183
904 Ga0373944_0062091
905 Ga0373943_0004664
906 Ga0373946_0043752
907 Ga0373931_0046406
908 Ga0373935_0013577
909 Ga0395899_0114866
910 Ga0395899_0151648
911 Ga0395900_0006197
912 Ga0395900_0019372
913 Ga0395900_0040753
914 Ga0395900_0174227
915 Ga0395900_0218076
916 Ga0395900_0232058
917 Ga0395900_0297592
918 Ga0395900_0319838
919 Ga0395900_0360580
920 Ga0395898_0045014
921 Ga0395898_0055495
922 Ga0395898_0233707
923 Ga0395898_0422737
924 Ga0395898_0952617
925 Ga0395905_0000092
926 Ga0395905_0003469
927 Ga0395905_0024814
928 Ga0395905_0039004
929 Ga0395905_0040395
930 Ga0395905_0050081
931 Ga0395905_0081486
932 Ga0395905_0189656
933 Ga0395905_0244827
934 Ga0395905_0322554
935 Ga0395905_0355129
936 Ga0395905_0440472
937 Ga0395905_0445309
938 Ga0395905_0494086
939 Ga0395901_0011987
940 Ga0395901_0036652
941 Ga0395901_0286331
942 Ga0395901_0309465
943 Ga0395901_0707042
944 Ga0436365_0322176
945 Ga0436361_0660318
946 Ga0439465_0123478
947 Ga0451853_2762972
948 Ga0439448_0004694
949 Ga0439449_0011892
950 Ga0439458_0005460
951 Ga0439459_0015582
952 Ga0466966_0038656
953 Ga0466966_0250367
954 Ga0466963_0084378
955 Ga0466957_0061683
956 Ga0466959_0039602
957 Ga0466958_0242934
958 Ga0466958_0332691
959 Ga0466967_0004245
960 Ga0466967_0010489
961 Ga0466967_0021721
962 Ga0466967_0187074
963 Ga0495606_0133090
964 Ga0495606_0223889
965 Ga0495642_0135259
966 Ga0495621_0000006
967 Ga0495633_0110854
968 Ga0495633_0126986
969 Ga0495668_0041143
970 Ga0495668_0090417
971 Ga0495669_0000385
972 Ga0495669_0002242
973 Ga0495669_0009485
974 Ga0495670_0000226
975 Ga0495677_0013315
976 Ga0496101_0055732
977 Ga0496102_0052842
978 Ga0496104_0185041
979 Ga0496106_0370551
980 Ga0496108_0025304
981 Ga0496109_0416380
982 Ga0496109_0473275
983 Ga0496110_0012390
984 Ga0496112_0011522
985 Ga0496112_0868648
986 Ga0496113_0002278
987 Ga0496114_0000019
988 Ga0496114_0036993
989 Ga0496115_0037736
990 Ga0496124_0231520
991 nmdc:mga06z11_283706_c1
992 Ga0500643_000137
993 Ga0500618_060196
994 Ga0500559_0037429
995 Ga0500590_139999
996 Ga0500604_0017108
997 Ga0500624_000100
998 Ga0500636_0013614
999 Ga0500661_001005
1000 Ga0466962_0066814

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06080

DUF938

Protein of unknown function (DUF938)

42

236

0.98

PF13649

Methyltransf_25

Methyltransferase domain

69

166

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
8tjj-assembly2.cif.gz_B sam-dependent methyltransferase redm bound to sam 0.8825 19 210
8tji-assembly1.cif.gz_A sam-dependent methyltransferase redm, apo 0.8723 21 210
8tjj-assembly1.cif.gz_D sam-dependent methyltransferase redm bound to sam 0.8709 21 210
8tjk-assembly1.cif.gz_A sam-dependent methyltransferase redm bound to sah 0.8707 21 210
8tji-assembly1.cif.gz_B sam-dependent methyltransferase redm, apo 0.8689 21 210
ID Description Score Start End Superfamily
af_Q7YWR7_1_204_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9599 18 210 3.40.50.150
af_Q9VLF6_13_218_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9503 16 206 3.40.50.150
af_Q7ZVJ8_3_201_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9493 18 209 3.40.50.150
af_Q7ZVJ8_3_201_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9122 18 209 3.40.50.150
af_Q66I74_7_186_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9055 26 190 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A7C2YJB0-F1-model_v4 DUF938 domain-containing protein 0.9895 18 211
AF-A0A4Q6A702-F1-model_v4 deleted 0.9788 16 175
AF-A0A3C1II58-F1-model_v4 Methyltransferase 0.9738 33 104 GO:0008168
GO:0032259
AF-A0A4Q2Z977-F1-model_v4 DUF938 domain-containing protein 0.9731 16 120
AF-A0A0S8EZW2-F1-model_v4 SAM-dependent methyltransferase 0.9729 12 95 GO:0008168
GO:0032259

Map