F455480

General Info

Members Datasets Scaffolds Average Seq Length
500 238 497 213

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100777906|Ga0070683_1007779061
Length 232
Sequence MHFAKKIKPYISCYILKQSNMKQALAMFLGLALLSCNSPRHASGGGWISLFDGKSLDGWKVGENAATFSVENGTIVAHGNTAHLFYEGPVKDHNFKNFEFRAEVMTEPGSNSGIYFHTQYQESGWPAKGYEVQVNNSHTDWRRTGSLYAVQDVKEVYVKDNEWFTESFSVQGKRVIIKINDKVVVDYTEPDNVQRPADMAGRIISSGTFALQGHDPKSKVYFKNIMVKPLAD

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2738541284 Pedobacter sp. YR016 Isolate Unclassified
3 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
13 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
15 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
103 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
104 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
105 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
106 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
107 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
108 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
162 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
163 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
164 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
165 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
167 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
168 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
169 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
171 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
172 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
173 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
174 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
175 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
176 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
177 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
178 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
179 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
180 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
181 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
182 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
183 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
184 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
185 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
186 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
187 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
188 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
189 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
190 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
191 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
192 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
193 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
194 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
195 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
196 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
197 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
198 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
199 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
200 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
201 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
202 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
203 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
204 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
205 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
206 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
207 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
208 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
209 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
210 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
211 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
212 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
213 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
214 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
215 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
216 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
217 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
218 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
219 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
220 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
221 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
222 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
223 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
224 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
225 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
226 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
227 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
228 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
229 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
230 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
231 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
232 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
233 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
234 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
235 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
236 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
237 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
238 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.2
Metatranscriptomes 0.2
Isolates 0.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4
Nodule 0
Rhizoplane 0.4
Rhizosphere 91.8
Stem 0
Stem Tuber 0
Unclassified 3.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2501798 2162886007 Bacteria 21095
2 JGI24740J21852_10002490 3300001979 Bacteria 8328
3 JGI25154J39366_1000004 3300002738 Bacteria 346460
4 JGI25157J39369_1004662 3300002741 Bacteria 2421
5 JGI25153J46596_10006708 3300003215 Bacteria 5784
6 rootH2_10059235 3300003320 Bacteria 2884
7 rootL2_10188889 3300003322 Bacteria 3891
8 rootH1_10019571 3300003323 Bacteria 69396
9 rootH1_10310217 3300003323 Bacteria 1575
10 rootH1_10355285 3300003323 Bacteria 1845
11 JGI25160J50197_1000262 3300003354 Bacteria 39642
12 Ga0065165_1015676 3300005262 Unclassified 2880
13 Ga0065714_10002496 3300005288 Bacteria 29584
14 Ga0065714_10002543 3300005288 Bacteria 26352
15 Ga0065714_10171218 3300005288 Unclassified 1003
16 Ga0065704_10000311 3300005289 Bacteria 44852
17 Ga0065712_10135094 3300005290 Bacteria 1506
18 Ga0065712_10156186 3300005290 Bacteria 1333
19 Ga0070676_10004069 3300005328 Bacteria 7685
20 Ga0070676_10205712 3300005328 Bacteria 1293
21 Ga0070676_10209040 3300005328 Unclassified 1283
22 Ga0070683_100000032 3300005329 Bacteria 148421
23 Ga0070683_100008834 3300005329 Bacteria 8573
24 Ga0070683_100013048 3300005329 Bacteria 7235
25 Ga0070683_100226186 3300005329 Bacteria 1778
26 Ga0070683_100233559 3300005329 Bacteria 1748
27 Ga0070683_100777906 3300005329 Bacteria 917
28 Ga0070690_100007222 3300005330 Bacteria 6355
29 Ga0070670_100156413 3300005331 Unclassified 1974
30 Ga0070670_100170237 3300005331 Bacteria 1889
31 Ga0070677_10060125 3300005333 Bacteria 1565
32 Ga0068869_100023644 3300005334 Bacteria 4249
33 Ga0068869_100035767 3300005334 Bacteria 3522
34 Ga0068869_100118590 3300005334 Bacteria 2021
35 Ga0068869_100402446 3300005334 Bacteria 1126
36 Ga0070666_10359519 3300005335 Bacteria 1043
37 Ga0070680_100000574 3300005336 Bacteria 25244
38 Ga0070680_100658430 3300005336 Bacteria 900
39 Ga0070682_100057834 3300005337 Bacteria 2444
40 Ga0068868_100010436 3300005338 Bacteria 6724
41 Ga0068868_100035751 3300005338 Unclassified 3841
42 Ga0068868_100071892 3300005338 Bacteria 2759
43 Ga0068868_100488601 3300005338 Bacteria 1076
44 Ga0070660_100018625 3300005339 Bacteria 5077
45 Ga0070660_100120862 3300005339 Unclassified 2090
46 Ga0070660_100226888 3300005339 Bacteria 1519
47 Ga0070689_100010273 3300005340 Bacteria 6671
48 Ga0070691_10046084 3300005341 Bacteria 2070
49 Ga0070661_100002222 3300005344 Bacteria 13309
50 Ga0070661_100014290 3300005344 Bacteria 5594
51 Ga0070692_10276050 3300005345 Bacteria 1016
52 Ga0070668_100045115 3300005347 Unclassified 3382
53 Ga0070669_100417100 3300005353 Bacteria 1101
54 Ga0070669_100610699 3300005353 Bacteria 914
55 Ga0070669_100782177 3300005353 Bacteria 810
56 Ga0070675_100072153 3300005354 Bacteria 2866
57 Ga0070675_100080788 3300005354 Unclassified 2710
58 Ga0070671_100052932 3300005355 Unclassified 3375
59 Ga0070671_100148714 3300005355 Unclassified 1977
60 Ga0070673_100128559 3300005364 Bacteria 2122
61 Ga0070673_100574110 3300005364 Unclassified 1026
62 Ga0070688_100004828 3300005365 Bacteria 7049
63 Ga0070688_100423238 3300005365 Unclassified 990
64 Ga0070659_100386476 3300005366 Unclassified 1179
65 Ga0070667_100071844 3300005367 Bacteria 2948
66 Ga0070667_100126408 3300005367 Bacteria 2228
67 Ga0070667_100214534 3300005367 Bacteria 1712
68 Ga0070667_100261006 3300005367 Unclassified 1551
69 Ga0070701_10294002 3300005438 Bacteria 996
70 Ga0070678_100004536 3300005456 Bacteria 7886
71 Ga0070662_100016001 3300005457 Bacteria 5032
72 Ga0070662_100025345 3300005457 Bacteria 4094
73 Ga0070662_100029055 3300005457 Unclassified 3855
74 Ga0070681_10009703 3300005458 Bacteria 9472
75 Ga0070681_10427218 3300005458 Bacteria 1237
76 Ga0070681_10464983 3300005458 Bacteria 1177
77 Ga0068867_100126754 3300005459 Bacteria 1979
78 Ga0068867_100161117 3300005459 Unclassified 1769
79 Ga0068867_100239464 3300005459 Bacteria 1471
80 Ga0068867_100501009 3300005459 Bacteria 1044
81 Ga0068867_100601607 3300005459 Bacteria 959
82 Ga0070679_100009153 3300005530 Bacteria 9348
83 Ga0070684_100000422 3300005535 Bacteria 29069
84 Ga0070684_100009871 3300005535 Bacteria 7543
85 Ga0070684_100039649 3300005535 Unclassified 4053
86 Ga0070684_100056383 3300005535 Bacteria 3429
87 Ga0070684_101159246 3300005535 Bacteria 727
88 Ga0068853_100011876 3300005539 Bacteria 7082
89 Ga0068853_100012841 3300005539 Bacteria 6824
90 Ga0068853_100190351 3300005539 Bacteria 1864
91 Ga0068853_100290906 3300005539 Bacteria 1508
92 Ga0070672_100083983 3300005543 Unclassified 2557
93 Ga0070672_100264629 3300005543 Bacteria 1451
94 Ga0070693_100002542 3300005547 Bacteria 8409
95 Ga0070665_100000052 3300005548 Bacteria 245694
96 Ga0070665_100233349 3300005548 Bacteria 1840
97 Ga0070665_100273624 3300005548 Bacteria 1690
98 Ga0068855_100001484 3300005563 Bacteria 29347
99 Ga0068855_100008453 3300005563 Bacteria 12448
100 Ga0068855_100071156 3300005563 Unclassified 4045
101 Ga0068855_100197527 3300005563 Bacteria 2266
102 Ga0068855_100539440 3300005563 Unclassified 1264
103 Ga0070664_100004434 3300005564 Bacteria 11274
104 Ga0070664_100026953 3300005564 Bacteria 4773
105 Ga0070664_100780964 3300005564 Unclassified 892
106 Ga0068857_100003159 3300005577 Bacteria 13659
107 Ga0068857_100007830 3300005577 Bacteria 9213
108 Ga0068857_100512648 3300005577 Bacteria 1127
109 Ga0068857_100745445 3300005577 Bacteria 933
110 Ga0068854_100066288 3300005578 Bacteria 2628
111 Ga0068854_100077915 3300005578 Unclassified 2440
112 Ga0068854_100095067 3300005578 Bacteria 2224
113 Ga0068854_100596849 3300005578 Unclassified 942
114 Ga0068856_100043907 3300005614 Bacteria 4397
115 Ga0068856_100071295 3300005614 Bacteria 3439
116 Ga0068856_100378912 3300005614 Bacteria 1434
117 Ga0068852_100000133 3300005616 Bacteria 49905
118 Ga0068852_100080028 3300005616 Unclassified 2896
119 Ga0068852_100114590 3300005616 Bacteria 2456
120 Ga0068852_100146048 3300005616 Bacteria 2194
121 Ga0068852_100251361 3300005616 Unclassified 1694
122 Ga0068852_100573828 3300005616 Unclassified 1130
123 Ga0068852_100805980 3300005616 Unclassified 953
124 Ga0068852_100932008 3300005616 Unclassified 886
125 Ga0068859_100095821 3300005617 Bacteria 3020
126 Ga0068859_100316110 3300005617 Bacteria 1655
127 Ga0068859_100511275 3300005617 Bacteria 1296
128 Ga0068859_100530798 3300005617 Unclassified 1272
129 Ga0068864_100014595 3300005618 Bacteria 6525
130 Ga0068864_100398276 3300005618 Bacteria 1308
131 Ga0068866_10013684 3300005718 Bacteria 3566
132 Ga0068866_10063241 3300005718 Bacteria 1928
133 Ga0068861_100227496 3300005719 Bacteria 1580
134 Ga0068861_100551983 3300005719 Bacteria 1050
135 Ga0068851_10213629 3300005834 Unclassified 1081
136 Ga0068870_10059020 3300005840 Unclassified 2056
137 Ga0068870_10199014 3300005840 Bacteria 1214
138 Ga0068863_100099225 3300005841 Unclassified 2767
139 Ga0068863_100132948 3300005841 Unclassified 2376
140 Ga0068863_100392118 3300005841 Bacteria 1357
141 Ga0068858_100154013 3300005842 Bacteria 2162
142 Ga0068858_100192716 3300005842 Unclassified 1926
143 Ga0068858_100322834 3300005842 Bacteria 1476
144 Ga0068860_100000053 3300005843 Bacteria 207331
145 Ga0068860_100004189 3300005843 Bacteria 14780
146 Ga0068860_100029346 3300005843 Bacteria 5289
147 Ga0068860_100416102 3300005843 Bacteria 1332
148 Ga0068862_100234581 3300005844 Bacteria 1666
149 Ga0075366_10189183 3300006195 Bacteria 1251
150 Ga0097621_100034425 3300006237 Bacteria 4041
151 Ga0097621_100144029 3300006237 Bacteria 2038
152 Ga0068871_100039162 3300006358 Bacteria 3791
153 Ga0068871_100310912 3300006358 Bacteria 1385
154 Ga0075434_100732832 3300006871 Bacteria 1006
155 Ga0068865_100056852 3300006881 Bacteria 2727
156 Ga0097620_100095820 3300006931 Bacteria 3020
157 Ga0097620_100316125 3300006931 Bacteria 1655
158 Ga0097620_100511331 3300006931 Bacteria 1296
159 Ga0097620_100530799 3300006931 Unclassified 1272
160 Ga0105240_10000374 3300009093 Bacteria 83962
161 Ga0105240_10003960 3300009093 Bacteria 22876
162 Ga0105240_10006979 3300009093 Bacteria 16495
163 Ga0105240_10015176 3300009093 Bacteria 10485
164 Ga0105240_10019264 3300009093 Bacteria 9120
165 Ga0105240_10033479 3300009093 Bacteria 6638
166 Ga0105240_10080900 3300009093 Bacteria 3994
167 Ga0105240_10199019 3300009093 Unclassified 2349
168 Ga0105240_10208233 3300009093 Unclassified 2287
169 Ga0111539_10005613 3300009094 Bacteria 16226
170 Ga0105245_10453702 3300009098 Unclassified 1291
171 Ga0105247_10068402 3300009101 Bacteria 2214
172 Ga0114129_10830904 3300009147 Unclassified 1176
173 Ga0105243_10429567 3300009148 Bacteria 1234
174 Ga0105241_10000197 3300009174 Bacteria 45395
175 Ga0105241_10000206 3300009174 Bacteria 44346
176 Ga0105241_10095504 3300009174 Bacteria 2353
177 Ga0105241_10113208 3300009174 Unclassified 2175
178 Ga0105241_10183846 3300009174 Bacteria 1736
179 Ga0105241_10339992 3300009174 Bacteria 1300
180 Ga0105241_10712370 3300009174 Bacteria 917
181 Ga0105241_10725494 3300009174 Bacteria 909
182 Ga0105242_10026899 3300009176 Bacteria 4563
183 Ga0105242_10369412 3300009176 Bacteria 1330
184 Ga0105242_10675900 3300009176 Bacteria 1007
185 Ga0105248_10419931 3300009177 Bacteria 1506
186 Ga0105237_10001923 3300009545 Bacteria 26509
187 Ga0105237_10008783 3300009545 Bacteria 10899
188 Ga0105237_10013215 3300009545 Bacteria 8660
189 Ga0105237_10164201 3300009545 Bacteria 2219
190 Ga0105237_11281811 3300009545 Bacteria 739
191 Ga0105238_10001819 3300009551 Bacteria 21399
192 Ga0105238_10073362 3300009551 Bacteria 3417
193 Ga0105238_10398391 3300009551 Bacteria 1369
194 Ga0105238_10864322 3300009551 Bacteria 922
195 Ga0105249_10016054 3300009553 Bacteria 6637
196 Ga0105249_10021631 3300009553 Bacteria 5759
197 Ga0105249_10025411 3300009553 Bacteria 5332
198 Ga0105249_10171771 3300009553 Unclassified 2103
199 Ga0105249_10727349 3300009553 Bacteria 1054
200 Ga0105239_10015738 3300010375 Bacteria 8371
201 Ga0105239_10027456 3300010375 Bacteria 6267
202 Ga0105239_10237239 3300010375 Bacteria 2047
203 Ga0105239_10386503 3300010375 Unclassified 1583
204 Ga0105239_10403631 3300010375 Bacteria 1547
205 Ga0105246_10968797 3300011119 Bacteria 768
206 Ga0157373_10000058 3300013100 Bacteria 95865
207 Ga0157373_10028849 3300013100 Unclassified 4002
208 Ga0157373_10566010 3300013100 Bacteria 825
209 Ga0157371_10006159 3300013102 Bacteria 9955
210 Ga0157371_10010914 3300013102 Bacteria 7044
211 Ga0157371_10064520 3300013102 Bacteria 2595
212 Ga0157371_10375483 3300013102 Bacteria 1037
213 Ga0157370_10013436 3300013104 Bacteria 8434
214 Ga0157370_10066994 3300013104 Bacteria 3394
215 Ga0157370_10147059 3300013104 Bacteria 2194
216 Ga0157370_10379610 3300013104 Bacteria 1302
217 Ga0157369_10006223 3300013105 Bacteria 13851
218 Ga0157369_10053300 3300013105 Unclassified 4373
219 Ga0157374_10002879 3300013296 Bacteria 14436
220 Ga0157374_10047959 3300013296 Unclassified 3962
221 Ga0157374_10091498 3300013296 Bacteria 2901
222 Ga0157374_10201959 3300013296 Unclassified 1947
223 Ga0157374_10968818 3300013296 Unclassified 869
224 Ga0157378_10015602 3300013297 Bacteria 6653
225 Ga0157378_10018747 3300013297 Bacteria 6083
226 Ga0157378_10036067 3300013297 Bacteria 4376
227 Ga0157378_10104265 3300013297 Bacteria 2592
228 Ga0157378_10756064 3300013297 Bacteria 995
229 Ga0163162_10000805 3300013306 Bacteria 29123
230 Ga0163162_10004351 3300013306 Bacteria 13631
231 Ga0163162_10004939 3300013306 Bacteria 12853
232 Ga0163162_10027232 3300013306 Bacteria 5652
233 Ga0163162_10034594 3300013306 Bacteria 5029
234 Ga0163162_10107831 3300013306 Bacteria 2881
235 Ga0163162_11080663 3300013306 Bacteria 909
236 Ga0157372_10023091 3300013307 Bacteria 6740
237 Ga0157372_10059200 3300013307 Bacteria 4284
238 Ga0157372_10108884 3300013307 Bacteria 3172
239 Ga0157372_10237401 3300013307 Unclassified 2115
240 Ga0157372_10247344 3300013307 Bacteria 2069
241 Ga0157372_10599802 3300013307 Bacteria 1284
242 Ga0157375_10011110 3300013308 Bacteria 7941
243 Ga0157375_10039372 3300013308 Bacteria 4549
244 Ga0157375_10039655 3300013308 Bacteria 4534
245 Ga0157375_10069782 3300013308 Bacteria 3521
246 Ga0157375_10082663 3300013308 Unclassified 3254
247 Ga0157375_10152999 3300013308 Bacteria 2444
248 Ga0157375_10425536 3300013308 Unclassified 1494
249 Ga0157375_11481612 3300013308 Bacteria 801
250 Ga0163163_10010845 3300014325 Bacteria 8231
251 Ga0163163_10196373 3300014325 Bacteria 2066
252 Ga0157380_10002002 3300014326 Bacteria 13580
253 Ga0157380_10194637 3300014326 Bacteria 1793
254 Ga0182008_10000004 3300014497 Bacteria 436804
255 Ga0157377_10002686 3300014745 Bacteria 7898
256 Ga0157377_10062308 3300014745 Bacteria 2134
257 Ga0157377_10200076 3300014745 Bacteria 1268
258 Ga0157379_10008743 3300014968 Bacteria 8827
259 Ga0157379_10032956 3300014968 Bacteria 4620
260 Ga0157379_10491145 3300014968 Unclassified 1137
261 Ga0157376_10106476 3300014969 Bacteria 2460
262 Ga0157376_10185297 3300014969 Unclassified 1905
263 Ga0163161_10027360 3300017792 Bacteria 4044
264 Ga0163161_10167202 3300017792 Bacteria 1680
265 Ga0163161_10498208 3300017792 Bacteria 991
266 Ga0213876_10002215 3300021384 Bacteria 11472
267 Ga0207425_1020384 3300025245 Unclassified 1418
268 Ga0209646_1000025 3300025246 Bacteria 406493
269 Ga0209026_1000097 3300025250 Bacteria 163212
270 Ga0209758_1048041 3300025297 Unclassified 1521
271 Ga0207426_1000059 3300025302 Bacteria 363842
272 Ga0207426_1000261 3300025302 Bacteria 112697
273 Ga0207426_1054798 3300025302 Bacteria 1171
274 Ga0207656_10034575 3300025321 Unclassified 2111
275 Ga0207682_10306823 3300025893 Bacteria 744
276 Ga0207642_10121820 3300025899 Unclassified 1347
277 Ga0207642_10242678 3300025899 Bacteria 1018
278 Ga0207688_10045158 3300025901 Bacteria 2457
279 Ga0207680_10075084 3300025903 Unclassified 2107
280 Ga0207680_10401745 3300025903 Bacteria 968
281 Ga0207647_10054388 3300025904 Unclassified 2463
282 Ga0207647_10065513 3300025904 Bacteria 2205
283 Ga0207647_10069841 3300025904 Bacteria 2123
284 Ga0207685_10145778 3300025905 Bacteria 1066
285 Ga0207645_10021411 3300025907 Unclassified 4216
286 Ga0207643_10005611 3300025908 Bacteria 6705
287 Ga0207643_10190500 3300025908 Bacteria 1245
288 Ga0207705_10509140 3300025909 Bacteria 935
289 Ga0207654_10001449 3300025911 Bacteria 12583
290 Ga0207654_10086156 3300025911 Bacteria 1903
291 Ga0207707_10000111 3300025912 Bacteria 82165
292 Ga0207707_10365024 3300025912 Bacteria 1243
293 Ga0207695_10000089 3300025913 Bacteria 273463
294 Ga0207695_10001662 3300025913 Bacteria 35831
295 Ga0207695_10003216 3300025913 Bacteria 23250
296 Ga0207695_10019725 3300025913 Bacteria 7752
297 Ga0207695_10036952 3300025913 Bacteria 5273
298 Ga0207695_10057403 3300025913 Unclassified 4044
299 Ga0207695_10190997 3300025913 Bacteria 1965
300 Ga0207671_10004464 3300025914 Bacteria 13365
301 Ga0207671_10008896 3300025914 Bacteria 8454
302 Ga0207671_10009121 3300025914 Bacteria 8332
303 Ga0207671_10151413 3300025914 Bacteria 1792
304 Ga0207671_10698706 3300025914 Bacteria 807
305 Ga0207660_10001012 3300025917 Bacteria 18631
306 Ga0207660_10451857 3300025917 Bacteria 1039
307 Ga0207662_10201766 3300025918 Bacteria 1288
308 Ga0207657_10045316 3300025919 Bacteria 3861
309 Ga0207657_10332935 3300025919 Bacteria 1199
310 Ga0207657_10454608 3300025919 Bacteria 1005
311 Ga0207649_10001181 3300025920 Bacteria 15722
312 Ga0207649_10017069 3300025920 Bacteria 4109
313 Ga0207652_10000538 3300025921 Bacteria 38475
314 Ga0207681_10202137 3300025923 Bacteria 1526
315 Ga0207681_10610546 3300025923 Bacteria 902
316 Ga0207694_10008159 3300025924 Bacteria 7915
317 Ga0207694_10064293 3300025924 Bacteria 2860
318 Ga0207694_10151617 3300025924 Bacteria 1868
319 Ga0207694_10294202 3300025924 Bacteria 1336
320 Ga0207659_10117390 3300025926 Bacteria 2033
321 Ga0207644_10156458 3300025931 Unclassified 1768
322 Ga0207644_10311069 3300025931 Bacteria 1272
323 Ga0207690_10007964 3300025932 Bacteria 6291
324 Ga0207690_10307925 3300025932 Bacteria 1241
325 Ga0207706_10012444 3300025933 Bacteria 7752
326 Ga0207706_10044031 3300025933 Unclassified 3956
327 Ga0207706_10061219 3300025933 Bacteria 3315
328 Ga0207686_10038692 3300025934 Bacteria 2888
329 Ga0207704_10150380 3300025938 Unclassified 1642
330 Ga0207704_10205999 3300025938 Bacteria 1443
331 Ga0207691_10014495 3300025940 Bacteria 7517
332 Ga0207691_10044820 3300025940 Bacteria 4069
333 Ga0207691_10094865 3300025940 Bacteria 2669
334 Ga0207691_10124551 3300025940 Unclassified 2281
335 Ga0207691_10522563 3300025940 Bacteria 1007
336 Ga0207689_10004379 3300025942 Bacteria 12848
337 Ga0207689_10017089 3300025942 Bacteria 6140
338 Ga0207689_10043961 3300025942 Unclassified 3693
339 Ga0207689_10131641 3300025942 Bacteria 2058
340 Ga0207689_10220887 3300025942 Bacteria 1565
341 Ga0207661_10000020 3300025944 Bacteria 216011
342 Ga0207661_10002666 3300025944 Bacteria 12274
343 Ga0207661_10060332 3300025944 Unclassified 3060
344 Ga0207679_10000909 3300025945 Bacteria 18903
345 Ga0207679_10207346 3300025945 Bacteria 1641
346 Ga0207667_10000014 3300025949 Bacteria 421261
347 Ga0207667_10002521 3300025949 Bacteria 22800
348 Ga0207667_10005509 3300025949 Bacteria 15436
349 Ga0207667_10071478 3300025949 Bacteria 3608
350 Ga0207667_10541738 3300025949 Unclassified 1178
351 Ga0207667_11108721 3300025949 Bacteria 774
352 Ga0207651_10062637 3300025960 Unclassified 2593
353 Ga0207712_10111302 3300025961 Bacteria 2054
354 Ga0207668_10405769 3300025972 Bacteria 1153
355 Ga0207640_10212627 3300025981 Unclassified 1474
356 Ga0207640_10309421 3300025981 Bacteria 1253
357 Ga0207658_10016995 3300025986 Bacteria 5008
358 Ga0207658_10056504 3300025986 Bacteria 2913
359 Ga0207658_10169723 3300025986 Bacteria 1796
360 Ga0207677_10017227 3300026023 Unclassified 4301
361 Ga0207677_10278533 3300026023 Bacteria 1372
362 Ga0207677_10346451 3300026023 Bacteria 1243
363 Ga0207703_10115731 3300026035 Bacteria 2294
364 Ga0207703_10118209 3300026035 Unclassified 2272
365 Ga0207703_10356104 3300026035 Unclassified 1349
366 Ga0207703_10477052 3300026035 Unclassified 1168
367 Ga0207703_10728250 3300026035 Unclassified 944
368 Ga0207639_10065868 3300026041 Bacteria 2813
369 Ga0207639_10180207 3300026041 Bacteria 1796
370 Ga0207639_10201882 3300026041 Bacteria 1706
371 Ga0207639_10202143 3300026041 Unclassified 1705
372 Ga0207639_10216696 3300026041 Bacteria 1651
373 Ga0207678_10359094 3300026067 Unclassified 1257
374 Ga0207678_10671119 3300026067 Bacteria 911
375 Ga0207708_10527784 3300026075 Unclassified 993
376 Ga0207702_10196728 3300026078 Bacteria 1866
377 Ga0207702_10286374 3300026078 Unclassified 1559
378 Ga0207641_10082468 3300026088 Unclassified 2794
379 Ga0207641_10123200 3300026088 Bacteria 2317
380 Ga0207648_10001428 3300026089 Bacteria 26300
381 Ga0207648_10006831 3300026089 Bacteria 11307
382 Ga0207648_10008872 3300026089 Bacteria 9681
383 Ga0207648_10012006 3300026089 Bacteria 8127
384 Ga0207648_10062172 3300026089 Bacteria 3256
385 Ga0207648_10083954 3300026089 Bacteria 2778
386 Ga0207648_10316652 3300026089 Bacteria 1401
387 Ga0207676_10022007 3300026095 Bacteria 4684
388 Ga0207676_10066635 3300026095 Bacteria 2873
389 Ga0207676_10135533 3300026095 Bacteria 2100
390 Ga0207674_10001267 3300026116 Bacteria 33015
391 Ga0207674_10017832 3300026116 Bacteria 7738
392 Ga0207674_10034138 3300026116 Bacteria 5320
393 Ga0207674_10240419 3300026116 Bacteria 1757
394 Ga0207674_10324239 3300026116 Bacteria 1490
395 Ga0207674_10933837 3300026116 Bacteria 836
396 Ga0207675_100381945 3300026118 Bacteria 1385
397 Ga0207683_10001458 3300026121 Bacteria 21328
398 Ga0207683_10070615 3300026121 Bacteria 3086
399 Ga0207698_10013022 3300026142 Bacteria 5472
400 Ga0207698_10092249 3300026142 Bacteria 2482
401 Ga0207698_10140259 3300026142 Bacteria 2081
402 Ga0207698_10397230 3300026142 Bacteria 1316
403 Ga0207698_10841791 3300026142 Unclassified 922
404 Ga0268266_10000070 3300028379 Bacteria 235423
405 Ga0268266_10282062 3300028379 Bacteria 1545
406 Ga0268265_10032814 3300028380 Bacteria 3768
407 Ga0268264_10000098 3300028381 Bacteria 229055
408 Ga0268264_10002510 3300028381 Bacteria 16132
409 Ga0307511_10000263 3300030521 Bacteria 54309
410 Ga0307516_10003984 3300031730 Bacteria 18549
411 Ga0307516_10067671 3300031730 Bacteria 3441
412 Ga0307412_10000113 3300031911 Bacteria 62050
413 Ga0307412_10087147 3300031911 Bacteria 2175
414 Ga0307414_10000375 3300032004 Bacteria 24537
415 Ga0307414_10000415 3300032004 Bacteria 22959
416 Ga0307414_10023321 3300032004 Bacteria 3923
417 Ga0307414_10026208 3300032004 Bacteria 3749
418 Ga0307414_10520274 3300032004 Bacteria 1056
419 Ga0316593_10165902 3300032168 Bacteria 808
420 Ga0373943_0131153 3300035170 Bacteria 1341
421 Ga0373955_0620508 3300035172 Bacteria 662
422 Ga0373933_0042067 3300035724 Bacteria 2700
423 Ga0373925_0269658 3300037068 Bacteria 1369
424 Ga0395899_0002920 3300037312 Bacteria 13725
425 Ga0395898_0004939 3300037466 Bacteria 14471
426 Ga0395905_0529413 3300037471 Bacteria 1079
427 Ga0395901_0010792 3300038443 Bacteria 9259
428 Ga0436365_0585774 3300039437 Bacteria 54587
429 Ga0451833_0828335 3300041491 Unclassified 831
430 Ga0451835_0391317 3300041492 Bacteria 936
431 Ga0466972_0001501 3300044658 Bacteria 11358
432 Ga0466960_0043024 3300044901 Bacteria 2147
433 Ga0495638_0054272 3300046460 Unclassified 2492
434 Ga0495650_0015814 3300046471 Bacteria 3855
435 Ga0495582_0120129 3300046473 Bacteria 1481
436 Ga0495662_0336540 3300046476 Bacteria 742
437 Ga0495664_0347516 3300046477 Bacteria 893
438 Ga0495628_0008871 3300046516 Bacteria 8603
439 Ga0495630_0047955 3300046517 Bacteria 3196
440 Ga0495648_0004074 3300046524 Bacteria 12609
441 Ga0495652_0254360 3300046529 Bacteria 1300
442 Ga0495586_0011084 3300046535 Bacteria 4790
443 Ga0495587_0018894 3300046536 Bacteria 4273
444 Ga0495667_0169234 3300046559 Bacteria 1404
445 Ga0495646_0280669 3300046680 Bacteria 885
446 Ga0495658_0409084 3300046683 Bacteria 865
447 Ga0495674_0666026 3300047319 Bacteria 819
448 Ga0495672_0029347 3300047320 Bacteria 3465
449 Ga0495672_0112008 3300047320 Bacteria 1463
450 Ga0495680_0069893 3300047322 Bacteria 2678
451 Ga0495687_000006 3300047443 Bacteria 571936
452 Ga0495686_0403625 3300047472 Bacteria 733
453 Ga0496111_0173751 3300048914 Bacteria 1601
454 Ga0496114_0324968 3300048917 Bacteria 1360
455 Ga0501291_012482 3300049514 Bacteria 1242
456 Ga0501292_027146 3300049515 Bacteria 948
457 Ga0501299_002031 3300049522 Unclassified 2751
458 Ga0501202_000294 3300049652 Bacteria 6851
459 Ga0501208_043755 3300049655 Bacteria 836
460 Ga0501217_051307 3300049661 Bacteria 1079
461 Ga0501223_003903 3300049663 Bacteria 3219
462 Ga0501224_002857 3300049664 Bacteria 2379
463 Ga0501233_098968 3300049668 Bacteria 769
464 Ga0501235_004698 3300049669 Bacteria 2955
465 Ga0501240_018530 3300049673 Bacteria 1025
466 Ga0501242_005699 3300049674 Bacteria 1408
467 Ga0501243_000060 3300049675 Bacteria 10743
468 Ga0501243_028638 3300049675 Unclassified 944
469 Ga0501250_000606 3300049680 Bacteria 2534
470 Ga0501251_001443 3300049681 Bacteria 2219
471 Ga0501257_014810 3300049686 Bacteria 1798
472 Ga0501259_014581 3300049688 Bacteria 1334
473 Ga0501259_059522 3300049688 Bacteria 795
474 Ga0501260_003353 3300049689 Bacteria 1434
475 Ga0501221_006435 3300049704 Bacteria 1986
476 Ga0501221_010618 3300049704 Unclassified 1640
477 Ga0501225_0084101 3300049705 Bacteria 916
478 Ga0501225_0111071 3300049705 Bacteria 808
479 Ga0501234_003841 3300049707 Unclassified 2363
480 Ga0501245_006347 3300049708 Bacteria 1651
481 Ga0501266_008381 3300049763 Bacteria 1301
482 Ga0501268_013025 3300049765 Bacteria 1338
483 Ga0501283_013496 3300049779 Bacteria 1239
484 Ga0501284_00755 3300050005 Bacteria 1665
485 nmdc:mga0k408_176973_c1 3300050493 Bacteria 1272
486 nmdc:mga04h51_184682_c1 3300050495 Bacteria 813
487 nmdc:mga08y16_11997_c1 3300050511 Bacteria 9100
488 nmdc:mga0n895_964745_c1 3300050512 Unclassified 835
489 Ga0500583_0001180 3300053092 Bacteria 7462
490 Ga0500651_0002473 3300053093 Bacteria 9774
491 Ga0500641_0007364 3300053096 Bacteria 3923
492 Ga0500642_0304199 3300053130 Bacteria 719
493 Ga0500568_0002934 3300053139 Bacteria 9771
494 Ga0500568_0007571 3300053139 Bacteria 5313
495 Ga0500577_0230591 3300053142 Bacteria 803
496 Ga0500616_0167348 3300053153 Unclassified 1002
497 Ga0500622_0005007 3300053156 Bacteria 8071

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026035 Ga0207703_10477052 Ga0207703_104770522 172
2 3300049688 Ga0501259_059522 Ga0501259_059522_118_762 190
3 3300003320 rootH2_10059235 rootH2_100592352 195
4 3300047320 Ga0495672_0029347 Ga0495672_0029347_2554_3228 196
5 3300053139 Ga0500568_0002934 Ga0500568_0002934_5866_6540 196
6 3300003323 rootH1_10019571 rootH1_1001957117 197
7 3300049668 Ga0501233_098968 Ga0501233_098968_54_698 197
8 3300005438 Ga0070701_10294002 Ga0070701_102940021 198
9 3300009094 Ga0111539_10005613 Ga0111539_100056137 198
10 3300009148 Ga0105243_10429567 Ga0105243_104295671 198
11 3300009545 Ga0105237_10164201 Ga0105237_101642012 198
12 3300009553 Ga0105249_10021631 Ga0105249_100216313 198
13 3300013306 Ga0163162_10034594 Ga0163162_100345942 198
14 3300013308 Ga0157375_10082663 Ga0157375_100826633 198
15 3300014326 Ga0157380_10002002 Ga0157380_1000200210 198
16 3300014745 Ga0157377_10002686 Ga0157377_100026865 198
17 3300035172 Ga0373955_0620508 Ga0373955_0620508_45_644 198
18 3300041491 Ga0451833_0828335 Ga0451833_0828335_187_792 198
19 3300047319 Ga0495674_0666026 Ga0495674_0666026_41_640 198
20 3300050511 nmdc:mga08y16_11997_c1 nmdc:mga08y16_11997_c1_421_1020 198
21 3300009093 Ga0105240_10199019 Ga0105240_101990192 199
22 3300009545 Ga0105237_11281811 Ga0105237_112818111 199
23 3300009553 Ga0105249_10727349 Ga0105249_107273491 199
24 3300047443 Ga0495687_000006 Ga0495687_000006_358084_358692 200
25 3300032168 Ga0316593_10165902 Ga0316593_101659021 201
26 3300005329 Ga0070683_100000032 Ga0070683_10000003268 202
27 3300005535 Ga0070684_100000422 Ga0070684_10000042228 202
28 3300005616 Ga0068852_100080028 Ga0068852_1000800283 202
29 3300021384 Ga0213876_10002215 Ga0213876_100022152 202
30 3300025944 Ga0207661_10000020 Ga0207661_10000020129 202
31 3300039437 Ga0436365_0585774 Ga0436365_0585774_11352_11975 202
32 3300025914 Ga0207671_10151413 Ga0207671_101514132 203
33 3300031911 Ga0307412_10087147 Ga0307412_100871472 204
34 3300032004 Ga0307414_10000375 Ga0307414_1000037513 204
35 3300005329 Ga0070683_100013048 Ga0070683_1000130482 205
36 3300005367 Ga0070667_100126408 Ga0070667_1001264081 205
37 3300005535 Ga0070684_100039649 Ga0070684_1000396493 205
38 3300005563 Ga0068855_100001484 Ga0068855_10000148417 205
39 3300005578 Ga0068854_100077915 Ga0068854_1000779152 205
40 3300005842 Ga0068858_100154013 Ga0068858_1001540132 205
41 3300009093 Ga0105240_10006979 Ga0105240_100069796 205
42 3300013100 Ga0157373_10028849 Ga0157373_100288494 205
43 3300013105 Ga0157369_10053300 Ga0157369_100533004 205
44 3300013307 Ga0157372_10247344 Ga0157372_102473442 205
45 3300025913 Ga0207695_10000089 Ga0207695_1000008999 205
46 3300025913 Ga0207695_10057403 Ga0207695_100574033 205
47 3300025949 Ga0207667_10002521 Ga0207667_1000252110 205
48 3300025986 Ga0207658_10056504 Ga0207658_100565042 205
49 3300047320 Ga0495672_0112008 Ga0495672_0112008_45_686 205
50 3300050493 nmdc:mga0k408_176973_c1 nmdc:mga0k408_176973_c1_217_903 205
51 3300005328 Ga0070676_10205712 Ga0070676_102057122 206
52 3300005334 Ga0068869_100402446 Ga0068869_1004024461 206
53 3300005459 Ga0068867_100501009 Ga0068867_1005010091 206
54 3300005616 Ga0068852_100932008 Ga0068852_1009320081 206
55 3300005840 Ga0068870_10199014 Ga0068870_101990142 206
56 3300013306 Ga0163162_10107831 Ga0163162_101078313 206
57 3300013308 Ga0157375_10069782 Ga0157375_100697823 206
58 3300013308 Ga0157375_11481612 Ga0157375_114816122 206
59 3300025908 Ga0207643_10190500 Ga0207643_101905002 206
60 3300025918 Ga0207662_10201766 Ga0207662_102017661 206
61 3300025931 Ga0207644_10311069 Ga0207644_103110691 206
62 3300025940 Ga0207691_10044820 Ga0207691_100448202 206
63 3300025940 Ga0207691_10522563 Ga0207691_105225632 206
64 3300026089 Ga0207648_10083954 Ga0207648_100839541 206
65 3300026095 Ga0207676_10066635 Ga0207676_100666353 206
66 3300026142 Ga0207698_10092249 Ga0207698_100922492 206
67 3300005345 Ga0070692_10276050 Ga0070692_102760501 207
68 3300013104 Ga0157370_10066994 Ga0157370_100669943 207
69 3300025914 Ga0207671_10009121 Ga0207671_100091214 207
70 3300025914 Ga0207671_10698706 Ga0207671_106987062 207
71 3300037312 Ga0395899_0002920 Ga0395899_0002920_5145_5783 207
72 3300037466 Ga0395898_0004939 Ga0395898_0004939_9849_10487 207
73 3300038443 Ga0395901_0010792 Ga0395901_0010792_699_1337 207
74 3300003323 rootH1_10310217 rootH1_103102172 208
75 3300005290 Ga0065712_10156186 Ga0065712_101561862 208
76 3300005367 Ga0070667_100261006 Ga0070667_1002610061 208
77 3300013102 Ga0157371_10010914 Ga0157371_100109143 208
78 3300013307 Ga0157372_10059200 Ga0157372_100592002 208
79 3300025923 Ga0207681_10202137 Ga0207681_102021372 208
80 3300053139 Ga0500568_0007571 Ga0500568_0007571_1321_1956 208
81 iso_pu_bacteria 2738541284 2738762733 208
82 iso_pu_bacteria 2929921140 2929927431 208
83 iso_pu_bacteria 8003151029 8003151286 208
84 3300003322 rootL2_10188889 rootL2_101888892 209
85 3300005548 Ga0070665_100000052 Ga0070665_100000052154 209
86 3300005719 Ga0068861_100551983 Ga0068861_1005519831 209
87 3300005843 Ga0068860_100000053 Ga0068860_100000053156 209
88 3300009147 Ga0114129_10830904 Ga0114129_108309041 209
89 3300009553 Ga0105249_10171771 Ga0105249_101717713 209
90 3300013297 Ga0157378_10104265 Ga0157378_101042651 209
91 3300013306 Ga0163162_10004939 Ga0163162_1000493911 209
92 3300026023 Ga0207677_10278533 Ga0207677_102785332 209
93 3300026035 Ga0207703_10728250 Ga0207703_107282502 209
94 3300026041 Ga0207639_10201882 Ga0207639_102018822 209
95 3300026067 Ga0207678_10671119 Ga0207678_106711191 209
96 3300026118 Ga0207675_100381945 Ga0207675_1003819451 209
97 3300028379 Ga0268266_10000070 Ga0268266_1000007027 209
98 3300028381 Ga0268264_10000098 Ga0268264_10000098154 209
99 3300032004 Ga0307414_10520274 Ga0307414_105202742 209
100 3300046524 Ga0495648_0004074 Ga0495648_0004074_6450_7088 209
101 3300053092 Ga0500583_0001180 Ga0500583_0001180_5372_6010 209
102 3300053096 Ga0500641_0007364 Ga0500641_0007364_2178_2825 209
103 3300053130 Ga0500642_0304199 Ga0500642_0304199_45_683 209
104 3300053142 Ga0500577_0230591 Ga0500577_0230591_128_766 209
105 3300053153 Ga0500616_0167348 Ga0500616_0167348_306_944 209
106 3300053156 Ga0500622_0005007 Ga0500622_0005007_3002_3640 209
107 3300001979 JGI24740J21852_10002490 JGI24740J21852_100024906 210
108 3300002738 JGI25154J39366_1000004 JGI25154J39366_1000004179 210
109 3300002741 JGI25157J39369_1004662 JGI25157J39369_10046623 210
110 3300003215 JGI25153J46596_10006708 JGI25153J46596_100067082 210
111 3300005262 Ga0065165_1015676 Ga0065165_10156762 210
112 3300005331 Ga0070670_100156413 Ga0070670_1001564131 210
113 3300005333 Ga0070677_10060125 Ga0070677_100601252 210
114 3300005338 Ga0068868_100010436 Ga0068868_1000104365 210
115 3300005338 Ga0068868_100071892 Ga0068868_1000718922 210
116 3300005339 Ga0070660_100018625 Ga0070660_1000186252 210
117 3300005339 Ga0070660_100120862 Ga0070660_1001208622 210
118 3300005347 Ga0070668_100045115 Ga0070668_1000451151 210
119 3300005353 Ga0070669_100610699 Ga0070669_1006106991 210
120 3300005355 Ga0070671_100052932 Ga0070671_1000529324 210
121 3300005364 Ga0070673_100128559 Ga0070673_1001285591 210
122 3300005456 Ga0070678_100004536 Ga0070678_1000045361 210
123 3300005543 Ga0070672_100264629 Ga0070672_1002646291 210
124 3300005548 Ga0070665_100273624 Ga0070665_1002736241 210
125 3300005563 Ga0068855_100539440 Ga0068855_1005394402 210
126 3300005577 Ga0068857_100745445 Ga0068857_1007454451 210
127 3300005578 Ga0068854_100596849 Ga0068854_1005968492 210
128 3300005614 Ga0068856_100043907 Ga0068856_1000439073 210
129 3300005614 Ga0068856_100071295 Ga0068856_1000712952 210
130 3300005616 Ga0068852_100114590 Ga0068852_1001145905 210
131 3300005616 Ga0068852_100251361 Ga0068852_1002513612 210
132 3300005616 Ga0068852_100805980 Ga0068852_1008059802 210
133 3300005718 Ga0068866_10063241 Ga0068866_100632412 210
134 3300005719 Ga0068861_100227496 Ga0068861_1002274962 210
135 3300005840 Ga0068870_10059020 Ga0068870_100590202 210
136 3300005841 Ga0068863_100099225 Ga0068863_1000992253 210
137 3300005842 Ga0068858_100192716 Ga0068858_1001927161 210
138 3300005843 Ga0068860_100004189 Ga0068860_1000041897 210
139 3300005843 Ga0068860_100029346 Ga0068860_1000293465 210
140 3300006237 Ga0097621_100034425 Ga0097621_1000344252 210
141 3300006358 Ga0068871_100039162 Ga0068871_1000391623 210
142 3300006871 Ga0075434_100732832 Ga0075434_1007328322 210
143 3300009093 Ga0105240_10000374 Ga0105240_1000037466 210
144 3300009098 Ga0105245_10453702 Ga0105245_104537021 210
145 3300009174 Ga0105241_10000197 Ga0105241_1000019720 210
146 3300009176 Ga0105242_10026899 Ga0105242_100268994 210
147 3300009545 Ga0105237_10008783 Ga0105237_100087837 210
148 3300009551 Ga0105238_10001819 Ga0105238_100018193 210
149 3300009553 Ga0105249_10025411 Ga0105249_100254114 210
150 3300010375 Ga0105239_10015738 Ga0105239_100157387 210
151 3300013296 Ga0157374_10047959 Ga0157374_100479594 210
152 3300013296 Ga0157374_10201959 Ga0157374_102019592 210
153 3300013297 Ga0157378_10015602 Ga0157378_100156023 210
154 3300013297 Ga0157378_10018747 Ga0157378_100187475 210
155 3300013297 Ga0157378_10756064 Ga0157378_107560642 210
156 3300013307 Ga0157372_10108884 Ga0157372_101088842 210
157 3300013307 Ga0157372_10237401 Ga0157372_102374013 210
158 3300013308 Ga0157375_10425536 Ga0157375_104255361 210
159 3300014968 Ga0157379_10491145 Ga0157379_104911452 210
160 3300017792 Ga0163161_10498208 Ga0163161_104982081 210
161 3300025245 Ga0207425_1020384 Ga0207425_10203842 210
162 3300025246 Ga0209646_1000025 Ga0209646_1000025158 210
163 3300025250 Ga0209026_1000097 Ga0209026_10000978 210
164 3300025297 Ga0209758_1048041 Ga0209758_10480412 210
165 3300025302 Ga0207426_1000261 Ga0207426_100026137 210
166 3300025302 Ga0207426_1054798 Ga0207426_10547981 210
167 3300025321 Ga0207656_10034575 Ga0207656_100345752 210
168 3300025893 Ga0207682_10306823 Ga0207682_103068231 210
169 3300025899 Ga0207642_10242678 Ga0207642_102426781 210
170 3300025901 Ga0207688_10045158 Ga0207688_100451581 210
171 3300025903 Ga0207680_10401745 Ga0207680_104017451 210
172 3300025908 Ga0207643_10005611 Ga0207643_100056113 210
173 3300025909 Ga0207705_10509140 Ga0207705_105091401 210
174 3300025911 Ga0207654_10001449 Ga0207654_1000144910 210
175 3300025913 Ga0207695_10001662 Ga0207695_1000166218 210
176 3300025919 Ga0207657_10045316 Ga0207657_100453162 210
177 3300025924 Ga0207694_10008159 Ga0207694_100081593 210
178 3300025931 Ga0207644_10156458 Ga0207644_101564582 210
179 3300025934 Ga0207686_10038692 Ga0207686_100386922 210
180 3300025940 Ga0207691_10014495 Ga0207691_100144955 210
181 3300025942 Ga0207689_10043961 Ga0207689_100439613 210
182 3300025949 Ga0207667_10000014 Ga0207667_100000148 210
183 3300025949 Ga0207667_10071478 Ga0207667_100714782 210
184 3300025960 Ga0207651_10062637 Ga0207651_100626373 210
185 3300025961 Ga0207712_10111302 Ga0207712_101113022 210
186 3300025981 Ga0207640_10212627 Ga0207640_102126272 210
187 3300026035 Ga0207703_10118209 Ga0207703_101182094 210
188 3300026041 Ga0207639_10202143 Ga0207639_102021432 210
189 3300026078 Ga0207702_10196728 Ga0207702_101967282 210
190 3300026078 Ga0207702_10286374 Ga0207702_102863743 210
191 3300026088 Ga0207641_10082468 Ga0207641_100824683 210
192 3300026089 Ga0207648_10001428 Ga0207648_1000142812 210
193 3300026116 Ga0207674_10933837 Ga0207674_109338371 210
194 3300026121 Ga0207683_10001458 Ga0207683_100014585 210
195 3300026142 Ga0207698_10841791 Ga0207698_108417911 210
196 3300028381 Ga0268264_10002510 Ga0268264_100025107 210
197 3300031730 Ga0307516_10067671 Ga0307516_100676712 210
198 3300044658 Ga0466972_0001501 Ga0466972_0001501_6693_7340 210
199 3300044901 Ga0466960_0043024 Ga0466960_0043024_1483_2130 210
200 3300049661 Ga0501217_051307 Ga0501217_051307_127_768 210
201 3300049675 Ga0501243_028638 Ga0501243_028638_273_911 210
202 3300049704 Ga0501221_010618 Ga0501221_010618_520_1161 210
203 3300050005 Ga0501284_00755 Ga0501284_00755_958_1608 210
204 3300003354 JGI25160J50197_1000262 JGI25160J50197_100026231 211
205 3300005329 Ga0070683_100777906 Ga0070683_1007779061 211
206 3300005334 Ga0068869_100118590 Ga0068869_1001185901 211
207 3300005539 Ga0068853_100190351 Ga0068853_1001903512 211
208 3300005548 Ga0070665_100233349 Ga0070665_1002333493 211
209 3300005563 Ga0068855_100071156 Ga0068855_1000711566 211
210 3300005563 Ga0068855_100197527 Ga0068855_1001975272 211
211 3300005577 Ga0068857_100007830 Ga0068857_1000078303 211
212 3300005578 Ga0068854_100095067 Ga0068854_1000950672 211
213 3300005614 Ga0068856_100378912 Ga0068856_1003789122 211
214 3300005616 Ga0068852_100000133 Ga0068852_1000001333 211
215 3300006195 Ga0075366_10189183 Ga0075366_101891832 211
216 3300009093 Ga0105240_10015176 Ga0105240_100151763 211
217 3300009093 Ga0105240_10019264 Ga0105240_100192644 211
218 3300009093 Ga0105240_10033479 Ga0105240_100334795 211
219 3300009093 Ga0105240_10080900 Ga0105240_100809004 211
220 3300009174 Ga0105241_10095504 Ga0105241_100955043 211
221 3300009174 Ga0105241_10183846 Ga0105241_101838462 211
222 3300009174 Ga0105241_10712370 Ga0105241_107123701 211
223 3300009545 Ga0105237_10001923 Ga0105237_1000192314 211
224 3300009545 Ga0105237_10013215 Ga0105237_100132153 211
225 3300009551 Ga0105238_10073362 Ga0105238_100733623 211
226 3300009551 Ga0105238_10398391 Ga0105238_103983912 211
227 3300009551 Ga0105238_10864322 Ga0105238_108643222 211
228 3300010375 Ga0105239_10027456 Ga0105239_100274567 211
229 3300010375 Ga0105239_10386503 Ga0105239_103865031 211
230 3300013104 Ga0157370_10147059 Ga0157370_101470592 211
231 3300013105 Ga0157369_10006223 Ga0157369_1000622313 211
232 3300013296 Ga0157374_10968818 Ga0157374_109688182 211
233 3300013307 Ga0157372_10023091 Ga0157372_100230911 211
234 3300025302 Ga0207426_1000059 Ga0207426_100005948 211
235 3300025904 Ga0207647_10065513 Ga0207647_100655132 211
236 3300025911 Ga0207654_10086156 Ga0207654_100861562 211
237 3300025913 Ga0207695_10019725 Ga0207695_100197254 211
238 3300025913 Ga0207695_10036952 Ga0207695_100369521 211
239 3300025913 Ga0207695_10190997 Ga0207695_101909972 211
240 3300025914 Ga0207671_10004464 Ga0207671_1000446411 211
241 3300025914 Ga0207671_10008896 Ga0207671_100088967 211
242 3300025924 Ga0207694_10064293 Ga0207694_100642932 211
243 3300025924 Ga0207694_10151617 Ga0207694_101516172 211
244 3300025924 Ga0207694_10294202 Ga0207694_102942022 211
245 3300025932 Ga0207690_10307925 Ga0207690_103079252 211
246 3300025942 Ga0207689_10220887 Ga0207689_102208872 211
247 3300025949 Ga0207667_10005509 Ga0207667_100055098 211
248 3300025949 Ga0207667_11108721 Ga0207667_111087211 211
249 3300025981 Ga0207640_10309421 Ga0207640_103094211 211
250 3300026116 Ga0207674_10017832 Ga0207674_100178322 211
251 3300026116 Ga0207674_10240419 Ga0207674_102404192 211
252 3300026142 Ga0207698_10013022 Ga0207698_100130222 211
253 3300032004 Ga0307414_10026208 Ga0307414_100262082 211
254 3300037471 Ga0395905_0529413 Ga0395905_0529413_36_680 211
255 3300046471 Ga0495650_0015814 Ga0495650_0015814_2693_3331 211
256 3300047472 Ga0495686_0403625 Ga0495686_0403625_51_692 211
257 3300050495 nmdc:mga04h51_184682_c1 nmdc:mga04h51_184682_c1_14_688 211
258 3300050512 nmdc:mga0n895_964745_c1 nmdc:mga0n895_964745_c1_32_700 211
259 2162886007 SwRhRL2b_contig_2501798 SwRhRL2b_0884.00002450 212
260 3300003323 rootH1_10355285 rootH1_103552851 212
261 3300005288 Ga0065714_10002496 Ga0065714_1000249621 212
262 3300005288 Ga0065714_10002543 Ga0065714_1000254317 212
263 3300005288 Ga0065714_10171218 Ga0065714_101712182 212
264 3300005289 Ga0065704_10000311 Ga0065704_1000031134 212
265 3300005290 Ga0065712_10135094 Ga0065712_101350941 212
266 3300005328 Ga0070676_10004069 Ga0070676_100040697 212
267 3300005328 Ga0070676_10209040 Ga0070676_102090402 212
268 3300005329 Ga0070683_100008834 Ga0070683_1000088342 212
269 3300005329 Ga0070683_100226186 Ga0070683_1002261862 212
270 3300005329 Ga0070683_100233559 Ga0070683_1002335593 212
271 3300005330 Ga0070690_100007222 Ga0070690_1000072224 212
272 3300005331 Ga0070670_100170237 Ga0070670_1001702372 212
273 3300005334 Ga0068869_100023644 Ga0068869_1000236443 212
274 3300005334 Ga0068869_100035767 Ga0068869_1000357672 212
275 3300005335 Ga0070666_10359519 Ga0070666_103595192 212
276 3300005336 Ga0070680_100000574 Ga0070680_10000057420 212
277 3300005336 Ga0070680_100658430 Ga0070680_1006584301 212
278 3300005337 Ga0070682_100057834 Ga0070682_1000578342 212
279 3300005338 Ga0068868_100035751 Ga0068868_1000357512 212
280 3300005338 Ga0068868_100488601 Ga0068868_1004886012 212
281 3300005339 Ga0070660_100226888 Ga0070660_1002268882 212
282 3300005340 Ga0070689_100010273 Ga0070689_1000102736 212
283 3300005341 Ga0070691_10046084 Ga0070691_100460841 212
284 3300005344 Ga0070661_100002222 Ga0070661_10000222213 212
285 3300005344 Ga0070661_100014290 Ga0070661_1000142902 212
286 3300005353 Ga0070669_100417100 Ga0070669_1004171002 212
287 3300005353 Ga0070669_100782177 Ga0070669_1007821772 212
288 3300005354 Ga0070675_100072153 Ga0070675_1000721532 212
289 3300005354 Ga0070675_100080788 Ga0070675_1000807884 212
290 3300005355 Ga0070671_100148714 Ga0070671_1001487142 212
291 3300005364 Ga0070673_100574110 Ga0070673_1005741101 212
292 3300005365 Ga0070688_100004828 Ga0070688_1000048281 212
293 3300005365 Ga0070688_100423238 Ga0070688_1004232382 212
294 3300005366 Ga0070659_100386476 Ga0070659_1003864761 212
295 3300005367 Ga0070667_100071844 Ga0070667_1000718442 212
296 3300005367 Ga0070667_100214534 Ga0070667_1002145342 212
297 3300005457 Ga0070662_100016001 Ga0070662_1000160013 212
298 3300005457 Ga0070662_100025345 Ga0070662_1000253452 212
299 3300005457 Ga0070662_100029055 Ga0070662_1000290552 212
300 3300005458 Ga0070681_10009703 Ga0070681_100097034 212
301 3300005458 Ga0070681_10427218 Ga0070681_104272182 212
302 3300005458 Ga0070681_10464983 Ga0070681_104649833 212
303 3300005459 Ga0068867_100126754 Ga0068867_1001267542 212
304 3300005459 Ga0068867_100161117 Ga0068867_1001611172 212
305 3300005459 Ga0068867_100239464 Ga0068867_1002394642 212
306 3300005459 Ga0068867_100601607 Ga0068867_1006016071 212
307 3300005530 Ga0070679_100009153 Ga0070679_1000091532 212
308 3300005535 Ga0070684_100009871 Ga0070684_1000098711 212
309 3300005535 Ga0070684_100056383 Ga0070684_1000563833 212
310 3300005535 Ga0070684_101159246 Ga0070684_1011592461 212
311 3300005539 Ga0068853_100011876 Ga0068853_1000118761 212
312 3300005539 Ga0068853_100012841 Ga0068853_1000128417 212
313 3300005539 Ga0068853_100290906 Ga0068853_1002909062 212
314 3300005543 Ga0070672_100083983 Ga0070672_1000839832 212
315 3300005547 Ga0070693_100002542 Ga0070693_1000025424 212
316 3300005563 Ga0068855_100008453 Ga0068855_1000084532 212
317 3300005564 Ga0070664_100004434 Ga0070664_1000044349 212
318 3300005564 Ga0070664_100026953 Ga0070664_1000269535 212
319 3300005564 Ga0070664_100780964 Ga0070664_1007809641 212
320 3300005577 Ga0068857_100003159 Ga0068857_1000031593 212
321 3300005577 Ga0068857_100512648 Ga0068857_1005126482 212
322 3300005578 Ga0068854_100066288 Ga0068854_1000662881 212
323 3300005616 Ga0068852_100146048 Ga0068852_1001460483 212
324 3300005616 Ga0068852_100573828 Ga0068852_1005738281 212
325 3300005617 Ga0068859_100095821 Ga0068859_1000958213 212
326 3300005617 Ga0068859_100316110 Ga0068859_1003161102 212
327 3300005617 Ga0068859_100511275 Ga0068859_1005112751 212
328 3300005617 Ga0068859_100530798 Ga0068859_1005307981 212
329 3300005618 Ga0068864_100014595 Ga0068864_1000145952 212
330 3300005618 Ga0068864_100398276 Ga0068864_1003982762 212
331 3300005718 Ga0068866_10013684 Ga0068866_100136843 212
332 3300005834 Ga0068851_10213629 Ga0068851_102136291 212
333 3300005841 Ga0068863_100132948 Ga0068863_1001329482 212
334 3300005841 Ga0068863_100392118 Ga0068863_1003921181 212
335 3300005842 Ga0068858_100322834 Ga0068858_1003228342 212
336 3300005843 Ga0068860_100416102 Ga0068860_1004161022 212
337 3300005844 Ga0068862_100234581 Ga0068862_1002345812 212
338 3300006237 Ga0097621_100144029 Ga0097621_1001440292 212
339 3300006358 Ga0068871_100310912 Ga0068871_1003109122 212
340 3300006881 Ga0068865_100056852 Ga0068865_1000568524 212
341 3300006931 Ga0097620_100095820 Ga0097620_1000958203 212
342 3300006931 Ga0097620_100316125 Ga0097620_1003161252 212
343 3300006931 Ga0097620_100511331 Ga0097620_1005113311 212
344 3300006931 Ga0097620_100530799 Ga0097620_1005307991 212
345 3300009093 Ga0105240_10003960 Ga0105240_1000396020 212
346 3300009093 Ga0105240_10208233 Ga0105240_102082334 212
347 3300009101 Ga0105247_10068402 Ga0105247_100684022 212
348 3300009174 Ga0105241_10000206 Ga0105241_1000020621 212
349 3300009174 Ga0105241_10113208 Ga0105241_101132082 212
350 3300009174 Ga0105241_10339992 Ga0105241_103399922 212
351 3300009174 Ga0105241_10725494 Ga0105241_107254941 212
352 3300009176 Ga0105242_10369412 Ga0105242_103694122 212
353 3300009176 Ga0105242_10675900 Ga0105242_106759002 212
354 3300009177 Ga0105248_10419931 Ga0105248_104199311 212
355 3300009553 Ga0105249_10016054 Ga0105249_100160542 212
356 3300010375 Ga0105239_10237239 Ga0105239_102372393 212
357 3300010375 Ga0105239_10403631 Ga0105239_104036312 212
358 3300011119 Ga0105246_10968797 Ga0105246_109687971 212
359 3300013100 Ga0157373_10000058 Ga0157373_1000005848 212
360 3300013100 Ga0157373_10566010 Ga0157373_105660101 212
361 3300013102 Ga0157371_10006159 Ga0157371_100061599 212
362 3300013102 Ga0157371_10064520 Ga0157371_100645202 212
363 3300013102 Ga0157371_10375483 Ga0157371_103754832 212
364 3300013104 Ga0157370_10013436 Ga0157370_100134363 212
365 3300013104 Ga0157370_10379610 Ga0157370_103796102 212
366 3300013296 Ga0157374_10002879 Ga0157374_100028795 212
367 3300013296 Ga0157374_10091498 Ga0157374_100914982 212
368 3300013297 Ga0157378_10036067 Ga0157378_100360672 212
369 3300013306 Ga0163162_10000805 Ga0163162_1000080520 212
370 3300013306 Ga0163162_10004351 Ga0163162_100043515 212
371 3300013306 Ga0163162_10027232 Ga0163162_100272324 212
372 3300013306 Ga0163162_11080663 Ga0163162_110806632 212
373 3300013307 Ga0157372_10599802 Ga0157372_105998022 212
374 3300013308 Ga0157375_10011110 Ga0157375_100111106 212
375 3300013308 Ga0157375_10039372 Ga0157375_100393724 212
376 3300013308 Ga0157375_10039655 Ga0157375_100396552 212
377 3300013308 Ga0157375_10152999 Ga0157375_101529993 212
378 3300014325 Ga0163163_10010845 Ga0163163_100108452 212
379 3300014325 Ga0163163_10196373 Ga0163163_101963732 212
380 3300014326 Ga0157380_10194637 Ga0157380_101946372 212
381 3300014497 Ga0182008_10000004 Ga0182008_10000004328 212
382 3300014745 Ga0157377_10062308 Ga0157377_100623083 212
383 3300014745 Ga0157377_10200076 Ga0157377_102000761 212
384 3300014968 Ga0157379_10008743 Ga0157379_100087434 212
385 3300014968 Ga0157379_10032956 Ga0157379_100329562 212
386 3300014969 Ga0157376_10106476 Ga0157376_101064762 212
387 3300014969 Ga0157376_10185297 Ga0157376_101852972 212
388 3300017792 Ga0163161_10027360 Ga0163161_100273604 212
389 3300017792 Ga0163161_10167202 Ga0163161_101672023 212
390 3300025899 Ga0207642_10121820 Ga0207642_101218202 212
391 3300025903 Ga0207680_10075084 Ga0207680_100750842 212
392 3300025904 Ga0207647_10054388 Ga0207647_100543882 212
393 3300025904 Ga0207647_10069841 Ga0207647_100698413 212
394 3300025905 Ga0207685_10145778 Ga0207685_101457782 212
395 3300025907 Ga0207645_10021411 Ga0207645_100214111 212
396 3300025912 Ga0207707_10000111 Ga0207707_1000011154 212
397 3300025912 Ga0207707_10365024 Ga0207707_103650242 212
398 3300025913 Ga0207695_10003216 Ga0207695_1000321617 212
399 3300025917 Ga0207660_10001012 Ga0207660_1000101219 212
400 3300025917 Ga0207660_10451857 Ga0207660_104518572 212
401 3300025919 Ga0207657_10332935 Ga0207657_103329351 212
402 3300025919 Ga0207657_10454608 Ga0207657_104546082 212
403 3300025920 Ga0207649_10001181 Ga0207649_100011812 212
404 3300025920 Ga0207649_10017069 Ga0207649_100170691 212
405 3300025921 Ga0207652_10000538 Ga0207652_1000053817 212
406 3300025923 Ga0207681_10610546 Ga0207681_106105461 212
407 3300025926 Ga0207659_10117390 Ga0207659_101173902 212
408 3300025932 Ga0207690_10007964 Ga0207690_100079645 212
409 3300025933 Ga0207706_10012444 Ga0207706_100124448 212
410 3300025933 Ga0207706_10044031 Ga0207706_100440313 212
411 3300025933 Ga0207706_10061219 Ga0207706_100612193 212
412 3300025938 Ga0207704_10150380 Ga0207704_101503802 212
413 3300025938 Ga0207704_10205999 Ga0207704_102059992 212
414 3300025940 Ga0207691_10094865 Ga0207691_100948652 212
415 3300025940 Ga0207691_10124551 Ga0207691_101245512 212
416 3300025942 Ga0207689_10004379 Ga0207689_100043792 212
417 3300025942 Ga0207689_10017089 Ga0207689_100170894 212
418 3300025942 Ga0207689_10131641 Ga0207689_101316412 212
419 3300025944 Ga0207661_10002666 Ga0207661_100026667 212
420 3300025944 Ga0207661_10060332 Ga0207661_100603322 212
421 3300025945 Ga0207679_10000909 Ga0207679_1000090913 212
422 3300025945 Ga0207679_10207346 Ga0207679_102073462 212
423 3300025949 Ga0207667_10541738 Ga0207667_105417382 212
424 3300025972 Ga0207668_10405769 Ga0207668_104057691 212
425 3300025986 Ga0207658_10016995 Ga0207658_100169954 212
426 3300025986 Ga0207658_10169723 Ga0207658_101697231 212
427 3300026023 Ga0207677_10017227 Ga0207677_100172274 212
428 3300026023 Ga0207677_10346451 Ga0207677_103464511 212
429 3300026035 Ga0207703_10115731 Ga0207703_101157312 212
430 3300026035 Ga0207703_10356104 Ga0207703_103561041 212
431 3300026041 Ga0207639_10065868 Ga0207639_100658681 212
432 3300026041 Ga0207639_10180207 Ga0207639_101802072 212
433 3300026041 Ga0207639_10216696 Ga0207639_102166962 212
434 3300026067 Ga0207678_10359094 Ga0207678_103590941 212
435 3300026075 Ga0207708_10527784 Ga0207708_105277842 212
436 3300026088 Ga0207641_10123200 Ga0207641_101232002 212
437 3300026089 Ga0207648_10006831 Ga0207648_100068312 212
438 3300026089 Ga0207648_10008872 Ga0207648_100088729 212
439 3300026089 Ga0207648_10012006 Ga0207648_100120063 212
440 3300026089 Ga0207648_10062172 Ga0207648_100621723 212
441 3300026089 Ga0207648_10316652 Ga0207648_103166523 212
442 3300026095 Ga0207676_10022007 Ga0207676_100220071 212
443 3300026095 Ga0207676_10135533 Ga0207676_101355331 212
444 3300026116 Ga0207674_10001267 Ga0207674_100012678 212
445 3300026116 Ga0207674_10034138 Ga0207674_100341384 212
446 3300026116 Ga0207674_10324239 Ga0207674_103242391 212
447 3300026121 Ga0207683_10070615 Ga0207683_100706152 212
448 3300026142 Ga0207698_10140259 Ga0207698_101402592 212
449 3300026142 Ga0207698_10397230 Ga0207698_103972302 212
450 3300028379 Ga0268266_10282062 Ga0268266_102820623 212
451 3300028380 Ga0268265_10032814 Ga0268265_100328141 212
452 3300030521 Ga0307511_10000263 Ga0307511_1000026340 212
453 3300031730 Ga0307516_10003984 Ga0307516_1000398416 212
454 3300031911 Ga0307412_10000113 Ga0307412_1000011333 212
455 3300032004 Ga0307414_10000415 Ga0307414_100004159 212
456 3300032004 Ga0307414_10023321 Ga0307414_100233214 212
457 3300035170 Ga0373943_0131153 Ga0373943_0131153_419_1060 212
458 3300035724 Ga0373933_0042067 Ga0373933_0042067_478_1119 212
459 3300037068 Ga0373925_0269658 Ga0373925_0269658_616_1257 212
460 3300041492 Ga0451835_0391317 Ga0451835_0391317_160_801 212
461 3300046460 Ga0495638_0054272 Ga0495638_0054272_89_730 212
462 3300046473 Ga0495582_0120129 Ga0495582_0120129_197_838 212
463 3300046476 Ga0495662_0336540 Ga0495662_0336540_56_697 212
464 3300046477 Ga0495664_0347516 Ga0495664_0347516_119_760 212
465 3300046516 Ga0495628_0008871 Ga0495628_0008871_5757_6398 212
466 3300046517 Ga0495630_0047955 Ga0495630_0047955_685_1326 212
467 3300046529 Ga0495652_0254360 Ga0495652_0254360_115_756 212
468 3300046535 Ga0495586_0011084 Ga0495586_0011084_906_1547 212
469 3300046536 Ga0495587_0018894 Ga0495587_0018894_3591_4232 212
470 3300046559 Ga0495667_0169234 Ga0495667_0169234_201_842 212
471 3300046680 Ga0495646_0280669 Ga0495646_0280669_78_719 212
472 3300046683 Ga0495658_0409084 Ga0495658_0409084_169_810 212
473 3300047322 Ga0495680_0069893 Ga0495680_0069893_369_1010 212
474 3300048914 Ga0496111_0173751 Ga0496111_0173751_93_734 212
475 3300048917 Ga0496114_0324968 Ga0496114_0324968_656_1297 212
476 3300049514 Ga0501291_012482 Ga0501291_012482_467_1111 212
477 3300049515 Ga0501292_027146 Ga0501292_027146_127_771 212
478 3300049522 Ga0501299_002031 Ga0501299_002031_85_729 212
479 3300049652 Ga0501202_000294 Ga0501202_000294_5246_5890 212
480 3300049655 Ga0501208_043755 Ga0501208_043755_121_765 212
481 3300049663 Ga0501223_003903 Ga0501223_003903_409_1053 212
482 3300049664 Ga0501224_002857 Ga0501224_002857_1297_1941 212
483 3300049669 Ga0501235_004698 Ga0501235_004698_910_1554 212
484 3300049673 Ga0501240_018530 Ga0501240_018530_200_844 212
485 3300049674 Ga0501242_005699 Ga0501242_005699_295_939 212
486 3300049675 Ga0501243_000060 Ga0501243_000060_2649_3293 212
487 3300049680 Ga0501250_000606 Ga0501250_000606_900_1544 212
488 3300049681 Ga0501251_001443 Ga0501251_001443_551_1195 212
489 3300049686 Ga0501257_014810 Ga0501257_014810_11_655 212
490 3300049688 Ga0501259_014581 Ga0501259_014581_141_785 212
491 3300049689 Ga0501260_003353 Ga0501260_003353_249_893 212
492 3300049704 Ga0501221_006435 Ga0501221_006435_410_1054 212
493 3300049705 Ga0501225_0084101 Ga0501225_0084101_120_764 212
494 3300049705 Ga0501225_0111071 Ga0501225_0111071_81_725 212
495 3300049707 Ga0501234_003841 Ga0501234_003841_47_691 212
496 3300049708 Ga0501245_006347 Ga0501245_006347_98_742 212
497 3300049763 Ga0501266_008381 Ga0501266_008381_197_841 212
498 3300049765 Ga0501268_013025 Ga0501268_013025_445_1089 212
499 3300049779 Ga0501283_013496 Ga0501283_013496_517_1161 212
500 3300053093 Ga0500651_0002473 Ga0500651_0002473_670_1308 212

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06439

3keto-disac_hyd

3-keto-disaccharide hydrolase

46

228

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4jqt-assembly1.cif.gz_B crystal structure of a putative glycosyl hydrolase (bt3469) from bacteroides thetaiotaomicron vpi-5482 at 2.49 a resolution 0.8344 27 211
3u1x-assembly1.cif.gz_A crystal structure of a putative glycosyl hydrolase (bdi_1869) from parabacteroides distasonis atcc 8503 at 1.70 a resolution 0.8289 27 211
3u1x-assembly1.cif.gz_B crystal structure of a putative glycosyl hydrolase (bdi_1869) from parabacteroides distasonis atcc 8503 at 1.70 a resolution 0.82 27 211
3hbk-assembly1.cif.gz_A crystal structure of putative glycosyl hydrolase, was domain of unknown function (duf1080) (yp_001302580.1) from parabacteroides distasonis atcc 8503 at 2.36 a resolution 0.8044 27 211
4b1m-assembly3.cif.gz_C carbohydrate binding module cbm66 from bacillus subtilis 0.8012 39 208
ID Description Score Start End Superfamily
4jqtB02 Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 0.8311 27 211 2.60.120.560
3u1xA00 Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 0.8164 27 211 2.60.120.560
4b1mC00 Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 0.8012 39 208 2.60.120.560
3immB00 Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 0.761 28 210 2.60.120.560
4b1mC00 Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 0.7595 39 208 2.60.120.560
ID Description Score Start End GO Terms
AF-A0A800E527-F1-model_v4 deleted 0.9854 76 160
AF-A0A3D1GDU6-F1-model_v4 DUF1080 domain-containing protein 0.9814 28 210 GO:0016787
AF-A0A257TA69-F1-model_v4 Glycosyl hydrolase 0.9753 84 211 GO:0016787
AF-A0A1Z9A9Y0-F1-model_v4 Glycosyl hydrolase 0.9747 78 211 GO:0016787
AF-A0A518EYP6-F1-model_v4 3-keto-disaccharide hydrolase domain-containing protein 0.973 27 212 GO:0016787

Feature Viewer

pLDDT pTM Quality
90.21 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map