F455478

General Info

Members Datasets Scaffolds Average Seq Length
500 237 1000 94

Family's Representative Sequence

Representative Sequence 3300005293|Ga0065715_10444535|Ga0065715_104445352
Length 107
Sequence MCSGPCWMRFITPMAPTAISDAARPRLAKGARLQTDSTTRRSVLLFPEGIIELNETAHEILSRCDGRRLSEIVHALAEEYDADLEIVAADVRETLADLQRRQLIQLT

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
106 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
108 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
162 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
163 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
164 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
165 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
166 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
167 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
168 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
169 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
170 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
173 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
174 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
175 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
176 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
177 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
178 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
179 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
180 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
181 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
182 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
183 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
184 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
185 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
186 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
187 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
188 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
189 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
190 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
191 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
192 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
193 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
194 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
195 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
196 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
197 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
198 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
199 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
200 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
201 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
202 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
203 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
204 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
205 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
206 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
207 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
208 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
209 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
210 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
211 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
212 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
213 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
214 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
215 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
216 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
217 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
218 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
219 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
220 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
221 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
222 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
223 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
224 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
225 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
226 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
227 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
228 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
229 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
230 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
231 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
232 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
233 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
234 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
235 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
236 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
237 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.4
Rhizosphere 92.6
Stem 0
Stem Tuber 0
Unclassified 13.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10444535 3300005293 Unclassified 832
2 SwRhRL2b_contig_3935959 2162886007 Unclassified 838
3 JGI24743J22301_10057179 3300001991 Unclassified 800
4 JGI24035J26624_1002622 3300002126 Unclassified 1676
5 JGI24035J26624_1004916 3300002126 Bacteria 1273
6 Ga0065704_10009506 3300005289 Bacteria 4783
7 Ga0065704_10019511 3300005289 Bacteria 2015
8 Ga0065712_10022601 3300005290 Bacteria 2074
9 Ga0065712_10108408 3300005290 Bacteria 1857
10 Ga0065712_10286768 3300005290 Bacteria 884
11 Ga0065712_10655730 3300005290 Unclassified 565
12 Ga0065715_10019845 3300005293 Bacteria 2664
13 Ga0065715_10019910 3300005293 Bacteria 1469
14 Ga0065715_10036262 3300005293 Bacteria 1206
15 Ga0065715_10446633 3300005293 Unclassified 830
16 Ga0065715_10787572 3300005293 Bacteria 615
17 Ga0065715_11144133 3300005293 Bacteria 508
18 Ga0065707_10013646 3300005295 Bacteria 2843
19 Ga0065707_10035841 3300005295 Bacteria 2317
20 Ga0065707_10038617 3300005295 Bacteria 1118
21 Ga0065707_10168197 3300005295 Bacteria 1505
22 Ga0065707_10514389 3300005295 Unclassified 747
23 Ga0070658_10484957 3300005327 Bacteria 1067
24 Ga0070676_10914872 3300005328 Bacteria 654
25 Ga0070676_10959242 3300005328 Bacteria 640
26 Ga0070683_100039583 3300005329 Bacteria 4329
27 Ga0070683_101167352 3300005329 Unclassified 740
28 Ga0070690_101187624 3300005330 Bacteria 608
29 Ga0070666_10229444 3300005335 Bacteria 1311
30 Ga0070666_10291609 3300005335 Unclassified 1161
31 Ga0070680_100082636 3300005336 Bacteria 2651
32 Ga0068868_100110324 3300005338 Bacteria 2235
33 Ga0068868_100467160 3300005338 Bacteria 1100
34 Ga0068868_102356200 3300005338 Unclassified 508
35 Ga0070660_100218878 3300005339 Bacteria 1547
36 Ga0070660_100652075 3300005339 Unclassified 882
37 Ga0070689_100006218 3300005340 Bacteria 8241
38 Ga0070689_100024398 3300005340 Bacteria 4536
39 Ga0070689_100659674 3300005340 Bacteria 911
40 Ga0070661_100070887 3300005344 Bacteria 2564
41 Ga0070692_10253552 3300005345 Bacteria 1054
42 Ga0070668_100134587 3300005347 Bacteria 1986
43 Ga0070668_100204101 3300005347 Bacteria 1624
44 Ga0070668_100485491 3300005347 Unclassified 1067
45 Ga0070669_100079198 3300005353 Bacteria 2443
46 Ga0070675_100003613 3300005354 Bacteria 11765
47 Ga0070675_100003972 3300005354 Bacteria 11213
48 Ga0070675_100226879 3300005354 Bacteria 1628
49 Ga0070675_100456969 3300005354 Bacteria 1146
50 Ga0070673_100040997 3300005364 Bacteria 3555
51 Ga0070673_101363931 3300005364 Unclassified 667
52 Ga0070673_101487176 3300005364 Unclassified 638
53 Ga0070688_100008327 3300005365 Bacteria 5627
54 Ga0070688_100211569 3300005365 Bacteria 1361
55 Ga0070659_100015510 3300005366 Bacteria 5709
56 Ga0070659_100595261 3300005366 Bacteria 950
57 Ga0070667_100057220 3300005367 Bacteria 3295
58 Ga0070667_100330902 3300005367 Bacteria 1376
59 Ga0070667_100434269 3300005367 Bacteria 1198
60 Ga0070709_10104716 3300005434 Bacteria 1891
61 Ga0070709_10178204 3300005434 Bacteria 1490
62 Ga0070709_11508715 3300005434 Bacteria 546
63 Ga0070714_100020238 3300005435 Bacteria 5431
64 Ga0070714_100127770 3300005435 Bacteria 2268
65 Ga0070714_100342117 3300005435 Bacteria 1403
66 Ga0070714_100425867 3300005435 Bacteria 1258
67 Ga0070714_100620407 3300005435 Bacteria 1039
68 Ga0070714_101303513 3300005435 Bacteria 709
69 Ga0070713_101507556 3300005436 Bacteria 652
70 Ga0070713_101607395 3300005436 Unclassified 631
71 Ga0070710_10151752 3300005437 Bacteria 1429
72 Ga0070710_10373832 3300005437 Unclassified 949
73 Ga0070710_10402699 3300005437 Bacteria 917
74 Ga0070710_10453232 3300005437 Unclassified 870
75 Ga0070710_11405219 3300005437 Unclassified 522
76 Ga0070701_10022217 3300005438 Bacteria 3039
77 Ga0070711_100167282 3300005439 Bacteria 1673
78 Ga0070711_100541515 3300005439 Bacteria 965
79 Ga0070711_100593078 3300005439 Bacteria 924
80 Ga0070705_100016385 3300005440 Bacteria 3851
81 Ga0070700_100032937 3300005441 Bacteria 3119
82 Ga0070700_101201881 3300005441 Bacteria 633
83 Ga0070694_100010036 3300005444 Bacteria 5824
84 Ga0070708_100056171 3300005445 Bacteria 3501
85 Ga0070708_100223796 3300005445 Bacteria 1765
86 Ga0070708_100387068 3300005445 Bacteria 1319
87 Ga0070663_100091357 3300005455 Bacteria 2256
88 Ga0070663_100133436 3300005455 Bacteria 1888
89 Ga0070662_100032627 3300005457 Bacteria 3660
90 Ga0070662_100078141 3300005457 Bacteria 2457
91 Ga0070662_100292375 3300005457 Bacteria 1321
92 Ga0070662_100329712 3300005457 Bacteria 1247
93 Ga0070662_100484921 3300005457 Bacteria 1030
94 Ga0070662_101142149 3300005457 Bacteria 669
95 Ga0070662_101787019 3300005457 Bacteria 531
96 Ga0070681_10009000 3300005458 Bacteria 9817
97 Ga0070685_10434390 3300005466 Unclassified 916
98 Ga0070706_100125112 3300005467 Bacteria 2397
99 Ga0070706_100433714 3300005467 Bacteria 1223
100 Ga0070706_102049619 3300005467 Unclassified 518
101 Ga0070707_100122952 3300005468 Unclassified 2520
102 Ga0070707_100505713 3300005468 Bacteria 1170
103 Ga0070707_101120248 3300005468 Bacteria 753
104 Ga0070699_100187051 3300005518 Bacteria 1839
105 Ga0070699_100237268 3300005518 Bacteria 1627
106 Ga0070679_100554908 3300005530 Bacteria 1092
107 Ga0070684_100003184 3300005535 Bacteria 12275
108 Ga0070684_100276282 3300005535 Bacteria 1538
109 Ga0070697_100345332 3300005536 Bacteria 1285
110 Ga0070697_100436971 3300005536 Bacteria 1139
111 Ga0070697_101028657 3300005536 Bacteria 732
112 Ga0070697_101284467 3300005536 Bacteria 653
113 Ga0070697_102078032 3300005536 Bacteria 508
114 Ga0070672_100404465 3300005543 Bacteria 1171
115 Ga0070686_101910605 3300005544 Unclassified 507
116 Ga0070695_100060087 3300005545 Bacteria 2463
117 Ga0070693_100205950 3300005547 Bacteria 1281
118 Ga0070665_100032371 3300005548 Bacteria 5262
119 Ga0070665_100154843 3300005548 Bacteria 2294
120 Ga0070665_100165964 3300005548 Bacteria 2210
121 Ga0070665_101269832 3300005548 Unclassified 747
122 Ga0070665_101821837 3300005548 Bacteria 615
123 Ga0070704_100010836 3300005549 Bacteria 5561
124 Ga0070704_100274833 3300005549 Bacteria 1393
125 Ga0070664_100089164 3300005564 Bacteria 2668
126 Ga0070664_100222528 3300005564 Bacteria 1689
127 Ga0070664_100342807 3300005564 Bacteria 1358
128 Ga0068857_100361833 3300005577 Bacteria 1345
129 Ga0068857_100528753 3300005577 Bacteria 1109
130 Ga0068854_100922130 3300005578 Bacteria 769
131 Ga0068856_100889195 3300005614 Bacteria 910
132 Ga0068856_101346200 3300005614 Bacteria 729
133 Ga0070702_100015394 3300005615 Bacteria 3905
134 Ga0068852_100537138 3300005616 Bacteria 1168
135 Ga0068859_100043096 3300005617 Bacteria 4535
136 Ga0068859_100568281 3300005617 Bacteria 1228
137 Ga0068864_100427649 3300005618 Bacteria 1263
138 Ga0068864_100597435 3300005618 Bacteria 1071
139 Ga0068864_101223865 3300005618 Bacteria 750
140 Ga0068861_100145809 3300005719 Bacteria 1937
141 Ga0068861_101589861 3300005719 Bacteria 644
142 Ga0068863_100005582 3300005841 Bacteria 12362
143 Ga0068863_100686467 3300005841 Bacteria 1017
144 Ga0068858_100010371 3300005842 Bacteria 8826
145 Ga0068860_100039062 3300005843 Bacteria 4541
146 Ga0068860_101271345 3300005843 Unclassified 757
147 Ga0068860_101597097 3300005843 Bacteria 674
148 Ga0081455_10005689 3300005937 Bacteria 13602
149 Ga0081455_10012503 3300005937 Bacteria 8467
150 Ga0081455_10032288 3300005937 Bacteria 4720
151 Ga0081455_10160161 3300005937 Bacteria 1726
152 Ga0081539_10165303 3300005985 Unclassified 1051
153 Ga0070717_10060497 3300006028 Bacteria 3136
154 Ga0070717_10122560 3300006028 Bacteria 2229
155 Ga0070717_10176915 3300006028 Bacteria 1858
156 Ga0070717_10369787 3300006028 Bacteria 1284
157 Ga0070717_10766555 3300006028 Bacteria 877
158 Ga0070717_11324330 3300006028 Bacteria 654
159 Ga0070715_10420423 3300006163 Bacteria 748
160 Ga0070716_100035495 3300006173 Bacteria 2742
161 Ga0070716_100690040 3300006173 Bacteria 779
162 Ga0070716_101115823 3300006173 Bacteria 630
163 Ga0070712_100069370 3300006175 Bacteria 2514
164 Ga0070712_100604557 3300006175 Bacteria 928
165 Ga0070712_100700371 3300006175 Unclassified 863
166 Ga0070712_100814242 3300006175 Unclassified 802
167 Ga0070712_100860618 3300006175 Unclassified 780
168 Ga0097621_100652376 3300006237 Unclassified 966
169 Ga0068871_100209694 3300006358 Bacteria 1685
170 Ga0075428_101074083 3300006844 Bacteria 851
171 Ga0075433_10073939 3300006852 Bacteria 2999
172 Ga0075433_11154127 3300006852 Bacteria 673
173 Ga0075434_100120025 3300006871 Bacteria 2644
174 Ga0075434_100510329 3300006871 Bacteria 1223
175 Ga0075434_100916891 3300006871 Bacteria 891
176 Ga0075429_101822169 3300006880 Unclassified 528
177 Ga0075436_100589688 3300006914 Bacteria 818
178 Ga0075436_101492453 3300006914 Unclassified 513
179 Ga0097620_100043096 3300006931 Bacteria 4535
180 Ga0097620_100568337 3300006931 Bacteria 1228
181 Ga0075435_100437472 3300007076 Bacteria 1127
182 Ga0075435_101257374 3300007076 Bacteria 648
183 Ga0075435_101648684 3300007076 Bacteria 563
184 Ga0099795_10359832 3300007788 Bacteria 653
185 Ga0111539_11317433 3300009094 Bacteria 838
186 Ga0105245_10234996 3300009098 Bacteria 1774
187 Ga0105245_10491850 3300009098 Bacteria 1241
188 Ga0105247_10071269 3300009101 Bacteria 2173
189 Ga0114129_10303184 3300009147 Bacteria 2128
190 Ga0114129_10711797 3300009147 Bacteria 1289
191 Ga0114129_11094513 3300009147 Bacteria 998
192 Ga0114129_11868730 3300009147 Bacteria 729
193 Ga0114129_12066863 3300009147 Bacteria 688
194 Ga0105243_10300957 3300009148 Bacteria 1453
195 Ga0105241_11218907 3300009174 Bacteria 713
196 Ga0105242_11272090 3300009176 Bacteria 758
197 Ga0105242_12050469 3300009176 Bacteria 615
198 Ga0105248_10577892 3300009177 Bacteria 1268
199 Ga0105248_12836385 3300009177 Unclassified 553
200 Ga0105237_10905384 3300009545 Unclassified 889
201 Ga0105249_10007092 3300009553 Bacteria 9781
202 Ga0105249_11454682 3300009553 Unclassified 757
203 Ga0105249_12967223 3300009553 Bacteria 545
204 Ga0099796_10096267 3300010159 Bacteria 1107
205 Ga0099796_10140015 3300010159 Bacteria 945
206 Ga0105239_10028602 3300010375 Bacteria 6128
207 Ga0105239_10091552 3300010375 Bacteria 3356
208 Ga0105239_11290677 3300010375 Bacteria 842
209 Ga0105239_11474484 3300010375 Bacteria 786
210 Ga0105239_12003175 3300010375 Bacteria 672
211 Ga0105246_10058433 3300011119 Bacteria 2672
212 Ga0105246_10527765 3300011119 Bacteria 1007
213 Ga0157371_10102651 3300013102 Bacteria 2029
214 Ga0157369_10221085 3300013105 Bacteria 1983
215 Ga0157374_10083506 3300013296 Bacteria 3035
216 Ga0157374_10152640 3300013296 Bacteria 2246
217 Ga0157374_10290896 3300013296 Bacteria 1615
218 Ga0157374_10663919 3300013296 Bacteria 1055
219 Ga0157374_11719730 3300013296 Bacteria 652
220 Ga0157374_12051870 3300013296 Bacteria 598
221 Ga0157378_10063627 3300013297 Bacteria 3297
222 Ga0157378_10103531 3300013297 Bacteria 2601
223 Ga0157378_11421275 3300013297 Unclassified 737
224 Ga0157378_11452635 3300013297 Bacteria 729
225 Ga0157378_11841580 3300013297 Bacteria 654
226 Ga0163162_10021995 3300013306 Bacteria 6283
227 Ga0163162_10375008 3300013306 Bacteria 1556
228 Ga0157372_10109029 3300013307 Bacteria 3170
229 Ga0157372_11043822 3300013307 Unclassified 946
230 Ga0157372_11900772 3300013307 Unclassified 684
231 Ga0157375_10004337 3300013308 Bacteria 12316
232 Ga0157375_10147239 3300013308 Bacteria 2486
233 Ga0157375_10809822 3300013308 Bacteria 1085
234 Ga0157375_11553931 3300013308 Unclassified 782
235 Ga0157375_13183930 3300013308 Bacteria 547
236 Ga0163163_10032399 3300014325 Bacteria 5047
237 Ga0163163_10051190 3300014325 Bacteria 4072
238 Ga0163163_10248805 3300014325 Bacteria 1828
239 Ga0163163_10613085 3300014325 Bacteria 1151
240 Ga0157380_12728628 3300014326 Unclassified 560
241 Ga0157377_10029143 3300014745 Bacteria 2977
242 Ga0157377_10338103 3300014745 Bacteria 1006
243 Ga0157377_11048435 3300014745 Bacteria 621
244 Ga0157379_10013410 3300014968 Bacteria 7180
245 Ga0157379_10886043 3300014968 Bacteria 846
246 Ga0157379_11127691 3300014968 Bacteria 752
247 Ga0157379_11185006 3300014968 Bacteria 734
248 Ga0157376_10006760 3300014969 Bacteria 8116
249 Ga0157376_10126516 3300014969 Bacteria 2274
250 Ga0157376_10242888 3300014969 Bacteria 1678
251 Ga0157376_10526389 3300014969 Bacteria 1166
252 Ga0182005_1017492 3300015265 Unclassified 1984
253 Ga0207666_1000262 3300025271 Bacteria 7683
254 Ga0207666_1015039 3300025271 Bacteria 1099
255 Ga0207673_1002364 3300025290 Bacteria 2147
256 Ga0207697_10000909 3300025315 Bacteria 16724
257 Ga0207697_10003385 3300025315 Bacteria 7918
258 Ga0207697_10004500 3300025315 Bacteria 6649
259 Ga0207697_10043420 3300025315 Bacteria 1848
260 Ga0207692_10136073 3300025898 Bacteria 1393
261 Ga0207688_10661733 3300025901 Unclassified 660
262 Ga0207647_10017234 3300025904 Bacteria 4913
263 Ga0207685_10052646 3300025905 Bacteria 1578
264 Ga0207699_10106850 3300025906 Bacteria 1787
265 Ga0207699_10343336 3300025906 Bacteria 1052
266 Ga0207645_10010003 3300025907 Bacteria 6532
267 Ga0207645_10193464 3300025907 Bacteria 1337
268 Ga0207684_10238520 3300025910 Bacteria 1569
269 Ga0207707_10192060 3300025912 Bacteria 1781
270 Ga0207671_11158324 3300025914 Unclassified 606
271 Ga0207693_10050512 3300025915 Bacteria 3266
272 Ga0207693_10083352 3300025915 Bacteria 2504
273 Ga0207693_10104530 3300025915 Bacteria 2221
274 Ga0207693_10168189 3300025915 Unclassified 1726
275 Ga0207693_10282366 3300025915 Unclassified 1301
276 Ga0207693_10350517 3300025915 Bacteria 1155
277 Ga0207693_10498940 3300025915 Bacteria 950
278 Ga0207693_10511760 3300025915 Bacteria 937
279 Ga0207693_10549584 3300025915 Bacteria 900
280 Ga0207693_10553696 3300025915 Unclassified 897
281 Ga0207693_10981917 3300025915 Bacteria 645
282 Ga0207663_10600815 3300025916 Bacteria 864
283 Ga0207663_11027799 3300025916 Bacteria 661
284 Ga0207662_10001771 3300025918 Bacteria 10599
285 Ga0207662_10110254 3300025918 Bacteria 1715
286 Ga0207657_10241362 3300025919 Bacteria 1442
287 Ga0207657_10584045 3300025919 Unclassified 872
288 Ga0207649_10100685 3300025920 Bacteria 1912
289 Ga0207649_10161546 3300025920 Bacteria 1553
290 Ga0207652_10558140 3300025921 Bacteria 1029
291 Ga0207646_10099383 3300025922 Unclassified 2608
292 Ga0207681_10619413 3300025923 Bacteria 895
293 Ga0207659_10005069 3300025926 Bacteria 7991
294 Ga0207659_10038315 3300025926 Bacteria 3333
295 Ga0207687_10332214 3300025927 Bacteria 1233
296 Ga0207700_10317530 3300025928 Bacteria 1349
297 Ga0207664_10106658 3300025929 Bacteria 2323
298 Ga0207664_10513619 3300025929 Bacteria 1073
299 Ga0207664_11737586 3300025929 Bacteria 546
300 Ga0207644_11344903 3300025931 Unclassified 600
301 Ga0207690_10027491 3300025932 Bacteria 3595
302 Ga0207690_10931299 3300025932 Bacteria 721
303 Ga0207690_10941367 3300025932 Bacteria 717
304 Ga0207690_11420906 3300025932 Bacteria 580
305 Ga0207706_10001926 3300025933 Bacteria 20387
306 Ga0207706_10091029 3300025933 Bacteria 2682
307 Ga0207706_10119030 3300025933 Bacteria 2322
308 Ga0207706_10260978 3300025933 Bacteria 1512
309 Ga0207706_10456105 3300025933 Bacteria 1105
310 Ga0207686_10944114 3300025934 Bacteria 698
311 Ga0207709_10508964 3300025935 Bacteria 941
312 Ga0207670_10004308 3300025936 Bacteria 7641
313 Ga0207670_10143398 3300025936 Bacteria 1763
314 Ga0207669_10783453 3300025937 Unclassified 790
315 Ga0207704_10147676 3300025938 Bacteria 1654
316 Ga0207704_10623166 3300025938 Bacteria 886
317 Ga0207665_10019872 3300025939 Bacteria 4414
318 Ga0207665_10056609 3300025939 Bacteria 2647
319 Ga0207665_10520988 3300025939 Bacteria 921
320 Ga0207665_11236020 3300025939 Bacteria 596
321 Ga0207691_10302814 3300025940 Bacteria 1373
322 Ga0207691_11128357 3300025940 Bacteria 652
323 Ga0207661_10097207 3300025944 Bacteria 2465
324 Ga0207661_10311722 3300025944 Bacteria 1413
325 Ga0207661_10607420 3300025944 Bacteria 1004
326 Ga0207679_10689078 3300025945 Bacteria 926
327 Ga0207679_11134719 3300025945 Bacteria 717
328 Ga0207679_11987006 3300025945 Unclassified 529
329 Ga0207667_11624805 3300025949 Bacteria 614
330 Ga0207667_11862069 3300025949 Unclassified 564
331 Ga0207651_10038613 3300025960 Bacteria 3140
332 Ga0207651_11314553 3300025960 Unclassified 650
333 Ga0207651_11522545 3300025960 Unclassified 602
334 Ga0207712_10014146 3300025961 Bacteria 5122
335 Ga0207712_10953327 3300025961 Unclassified 760
336 Ga0207668_10183491 3300025972 Bacteria 1652
337 Ga0207668_10453017 3300025972 Bacteria 1095
338 Ga0207668_10466761 3300025972 Unclassified 1080
339 Ga0207658_10064495 3300025986 Bacteria 2748
340 Ga0207658_10421149 3300025986 Bacteria 1177
341 Ga0207658_10701779 3300025986 Bacteria 914
342 Ga0207677_10081146 3300026023 Bacteria 2326
343 Ga0207677_10824424 3300026023 Bacteria 832
344 Ga0207677_10860595 3300026023 Unclassified 815
345 Ga0207703_10011087 3300026035 Bacteria 7022
346 Ga0207678_10012655 3300026067 Bacteria 7413
347 Ga0207678_10249938 3300026067 Bacteria 1518
348 Ga0207678_11424618 3300026067 Bacteria 612
349 Ga0207708_10020294 3300026075 Bacteria 5012
350 Ga0207708_10970228 3300026075 Bacteria 738
351 Ga0207702_11539290 3300026078 Bacteria 658
352 Ga0207641_10019040 3300026088 Bacteria 5630
353 Ga0207641_10577462 3300026088 Bacteria 1099
354 Ga0207641_12537611 3300026088 Bacteria 511
355 Ga0207676_10083180 3300026095 Bacteria 2606
356 Ga0207676_10838197 3300026095 Bacteria 899
357 Ga0207676_11242052 3300026095 Bacteria 739
358 Ga0207676_11434590 3300026095 Unclassified 687
359 Ga0207674_10319230 3300026116 Bacteria 1503
360 Ga0207675_100151250 3300026118 Bacteria 2209
361 Ga0207675_100452519 3300026118 Bacteria 1272
362 Ga0207683_10319224 3300026121 Bacteria 1423
363 Ga0209974_10251949 3300027876 Bacteria 665
364 Ga0268266_10038912 3300028379 Bacteria 4049
365 Ga0268266_10169443 3300028379 Bacteria 1981
366 Ga0268266_10320997 3300028379 Bacteria 1449
367 Ga0268266_11107639 3300028379 Unclassified 766
368 Ga0268265_10106368 3300028380 Bacteria 2279
369 Ga0268264_10056356 3300028381 Bacteria 3286
370 Ga0268264_11197772 3300028381 Bacteria 769
371 Ga0268264_11529015 3300028381 Bacteria 678
372 Ga0268264_11835565 3300028381 Unclassified 616
373 Ga0373944_0160609 3300035089 Bacteria 797
374 Ga0373944_0234279 3300035089 Unclassified 674
375 Ga0373923_0196290 3300035111 Bacteria 932
376 Ga0373953_0204535 3300035117 Bacteria 854
377 Ga0373957_0047421 3300035120 Bacteria 1634
378 Ga0373943_0050226 3300035170 Bacteria 2049
379 Ga0373935_0001921 3300035692 Bacteria 11690
380 Ga0373935_0036790 3300035692 Bacteria 3062
381 Ga0373927_0201503 3300035695 Bacteria 1307
382 Ga0373933_0171622 3300035724 Unclassified 1380
383 Ga0373933_0987141 3300035724 Bacteria 555
384 Ga0373947_0034151 3300035725 Bacteria 3008
385 Ga0373947_0052943 3300035725 Bacteria 2446
386 Ga0373947_0816098 3300035725 Bacteria 637
387 Ga0373937_0102016 3300036401 Bacteria 2663
388 Ga0373937_0118347 3300036401 Bacteria 2468
389 Ga0373937_0215956 3300036401 Bacteria 1805
390 Ga0373937_0813062 3300036401 Bacteria 883
391 Ga0373925_0150918 3300037068 Bacteria 1825
392 Ga0373925_0444617 3300037068 Bacteria 1061
393 Ga0373925_1581007 3300037068 Bacteria 536
394 Ga0395900_0007005 3300037418 Bacteria 11674
395 Ga0395898_0003345 3300037466 Bacteria 17992
396 Ga0395905_0015149 3300037471 Bacteria 7336
397 Ga0395905_1693274 3300037471 Unclassified 538
398 Ga0395901_0020303 3300038443 Bacteria 6800
399 Ga0451807_0463722 3300041486 Unclassified 583
400 Ga0451807_1336827 3300041486 Unclassified 508
401 Ga0439450_197187 3300042008 Bacteria 538
402 Ga0439455_0026557 3300042012 Bacteria 1414
403 Ga0439444_0079261 3300042437 Bacteria 716
404 Ga0439464_0223568 3300042439 Unclassified 604
405 Ga0439460_0062451 3300042461 Unclassified 1140
406 Ga0439440_0139771 3300042993 Bacteria 687
407 Ga0466965_0346172 3300044683 Bacteria 813
408 Ga0451576_0780248 3300045051 Bacteria 1004
409 Ga0451576_2377253 3300045051 Bacteria 542
410 Ga0466967_0077088 3300045976 Bacteria 3000
411 Ga0495641_0095074 3300046461 Bacteria 1331
412 Ga0495651_0292073 3300046462 Bacteria 1097
413 Ga0495651_0515027 3300046462 Bacteria 764
414 Ga0495653_0635261 3300046463 Bacteria 653
415 Ga0495582_0428241 3300046473 Bacteria 764
416 Ga0495582_0564334 3300046473 Bacteria 659
417 Ga0495664_0325477 3300046477 Bacteria 927
418 Ga0495664_0484930 3300046477 Bacteria 739
419 Ga0495664_0756377 3300046477 Bacteria 573
420 Ga0495584_0357485 3300046491 Bacteria 742
421 Ga0495618_0215245 3300046514 Bacteria 1213
422 Ga0495630_0027648 3300046517 Bacteria 4210
423 Ga0495652_0496776 3300046529 Bacteria 846
424 Ga0495640_0161616 3300046533 Bacteria 1435
425 Ga0495586_0020825 3300046535 Bacteria 3493
426 Ga0495587_0134222 3300046536 Bacteria 1414
427 Ga0495587_0393927 3300046536 Bacteria 770
428 Ga0495645_0321967 3300046543 Bacteria 1004
429 Ga0495645_0384977 3300046543 Bacteria 896
430 Ga0495667_0578316 3300046559 Bacteria 701
431 Ga0495634_0251793 3300046642 Bacteria 1080
432 Ga0495659_0477546 3300046664 Bacteria 545
433 Ga0495657_0469950 3300046675 Bacteria 735
434 Ga0495599_0017879 3300046678 Bacteria 4413
435 Ga0495623_0181984 3300046679 Bacteria 1220
436 Ga0495646_0416042 3300046680 Bacteria 697
437 Ga0495669_0084024 3300046684 Bacteria 1464
438 Ga0495600_0958581 3300046809 Unclassified 502
439 Ga0495604_0804750 3300047317 Bacteria 592
440 Ga0495674_0115364 3300047319 Bacteria 2273
441 Ga0495674_0995214 3300047319 Bacteria 643
442 Ga0495680_0338514 3300047322 Bacteria 1050
443 Ga0495680_0922805 3300047322 Bacteria 563
444 Ga0495675_0025275 3300047444 Bacteria 3787
445 Ga0495684_0033864 3300047471 Bacteria 3919
446 Ga0495684_0720094 3300047471 Bacteria 660
447 Ga0495602_0299441 3300048088 Bacteria 1177
448 Ga0496100_0422666 3300048903 Bacteria 1018
449 Ga0496101_0049947 3300048904 Bacteria 3010
450 Ga0496101_0608534 3300048904 Bacteria 864
451 Ga0496102_0019141 3300048905 Bacteria 6028
452 Ga0496102_0068720 3300048905 Bacteria 3251
453 Ga0496102_0338246 3300048905 Bacteria 1418
454 Ga0496102_0856232 3300048905 Bacteria 831
455 Ga0496103_0024181 3300048906 Bacteria 3665
456 Ga0496103_0109768 3300048906 Bacteria 1752
457 Ga0496103_0125967 3300048906 Bacteria 1634
458 Ga0496103_0979836 3300048906 Unclassified 527
459 Ga0496104_0131529 3300048907 Bacteria 2404
460 Ga0496104_0468395 3300048907 Bacteria 1171
461 Ga0496104_1059172 3300048907 Bacteria 715
462 Ga0496105_0052215 3300048908 Bacteria 3376
463 Ga0496105_0254118 3300048908 Bacteria 1423
464 Ga0496106_0023733 3300048909 Bacteria 4558
465 Ga0496107_0111150 3300048910 Bacteria 2014
466 Ga0496107_0426189 3300048910 Bacteria 986
467 Ga0496108_0065570 3300048911 Bacteria 3061
468 Ga0496109_0102739 3300048912 Bacteria 2653
469 Ga0496109_0332968 3300048912 Bacteria 1433
470 Ga0496109_0817630 3300048912 Bacteria 870
471 Ga0496110_0041442 3300048913 Bacteria 4018
472 Ga0496110_0432873 3300048913 Bacteria 1199
473 Ga0496112_0064551 3300048915 Bacteria 3613
474 Ga0496112_0127997 3300048915 Bacteria 2510
475 Ga0496112_0155674 3300048915 Bacteria 2252
476 Ga0496112_0483774 3300048915 Bacteria 1174
477 Ga0496113_0126854 3300048916 Bacteria 1999
478 Ga0496114_0090383 3300048917 Bacteria 2599
479 Ga0496114_0098008 3300048917 Bacteria 2499
480 Ga0496115_0246540 3300048918 Bacteria 1471
481 Ga0496115_0349618 3300048918 Bacteria 1206
482 Ga0496115_0402384 3300048918 Bacteria 1111
483 nmdc:mga08y16_352486_c1 3300050511 Bacteria 1511
484 nmdc:mga0n895_1169840_c1 3300050512 Bacteria 744
485 nmdc:mga0n895_121565_c1 3300050512 Bacteria 2632
486 nmdc:mga0n895_139345_c1 3300050512 Bacteria 2453
487 nmdc:mga0n895_792899_c1 3300050512 Bacteria 938
488 nmdc:mga0n895_851448_c1 3300050512 Bacteria 899
489 nmdc:mga0rr50_1488061_c1 3300050513 Bacteria 572
490 nmdc:mga0rr50_236666_c1 3300050513 Bacteria 1512
491 nmdc:mga0rr50_413110_c1 3300050513 Bacteria 1141
492 nmdc:mga0rr50_756189_c1 3300050513 Bacteria 829
493 nmdc:mga08x19_1314960_c1 3300050514 Unclassified 512
494 nmdc:mga0a205_149432_c1 3300050515 Bacteria 2236
495 Ga0495601_0024702 3300053077 Bacteria 3701
496 Ga0495612_0194387 3300053078 Bacteria 894
497 Ga0495595_0171161 3300053084 Bacteria 1075
498 Ga0495619_0148597 3300053085 Bacteria 1616
499 Ga0495619_0371861 3300053085 Bacteria 988
500 Ga0495619_0418992 3300053085 Bacteria 924
501 Ga0065715_10444535
502 SwRhRL2b_contig_3935959
503 JGI24743J22301_10057179
504 JGI24035J26624_1002622
505 JGI24035J26624_1004916
506 Ga0065704_10009506
507 Ga0065704_10019511
508 Ga0065712_10022601
509 Ga0065712_10108408
510 Ga0065712_10286768
511 Ga0065712_10655730
512 Ga0065715_10019845
513 Ga0065715_10019910
514 Ga0065715_10036262
515 Ga0065715_10446633
516 Ga0065715_10787572
517 Ga0065715_11144133
518 Ga0065707_10013646
519 Ga0065707_10035841
520 Ga0065707_10038617
521 Ga0065707_10168197
522 Ga0065707_10514389
523 Ga0070658_10484957
524 Ga0070676_10914872
525 Ga0070676_10959242
526 Ga0070683_100039583
527 Ga0070683_101167352
528 Ga0070690_101187624
529 Ga0070666_10229444
530 Ga0070666_10291609
531 Ga0070680_100082636
532 Ga0068868_100110324
533 Ga0068868_100467160
534 Ga0068868_102356200
535 Ga0070660_100218878
536 Ga0070660_100652075
537 Ga0070689_100006218
538 Ga0070689_100024398
539 Ga0070689_100659674
540 Ga0070661_100070887
541 Ga0070692_10253552
542 Ga0070668_100134587
543 Ga0070668_100204101
544 Ga0070668_100485491
545 Ga0070669_100079198
546 Ga0070675_100003613
547 Ga0070675_100003972
548 Ga0070675_100226879
549 Ga0070675_100456969
550 Ga0070673_100040997
551 Ga0070673_101363931
552 Ga0070673_101487176
553 Ga0070688_100008327
554 Ga0070688_100211569
555 Ga0070659_100015510
556 Ga0070659_100595261
557 Ga0070667_100057220
558 Ga0070667_100330902
559 Ga0070667_100434269
560 Ga0070709_10104716
561 Ga0070709_10178204
562 Ga0070709_11508715
563 Ga0070714_100020238
564 Ga0070714_100127770
565 Ga0070714_100342117
566 Ga0070714_100425867
567 Ga0070714_100620407
568 Ga0070714_101303513
569 Ga0070713_101507556
570 Ga0070713_101607395
571 Ga0070710_10151752
572 Ga0070710_10373832
573 Ga0070710_10402699
574 Ga0070710_10453232
575 Ga0070710_11405219
576 Ga0070701_10022217
577 Ga0070711_100167282
578 Ga0070711_100541515
579 Ga0070711_100593078
580 Ga0070705_100016385
581 Ga0070700_100032937
582 Ga0070700_101201881
583 Ga0070694_100010036
584 Ga0070708_100056171
585 Ga0070708_100223796
586 Ga0070708_100387068
587 Ga0070663_100091357
588 Ga0070663_100133436
589 Ga0070662_100032627
590 Ga0070662_100078141
591 Ga0070662_100292375
592 Ga0070662_100329712
593 Ga0070662_100484921
594 Ga0070662_101142149
595 Ga0070662_101787019
596 Ga0070681_10009000
597 Ga0070685_10434390
598 Ga0070706_100125112
599 Ga0070706_100433714
600 Ga0070706_102049619
601 Ga0070707_100122952
602 Ga0070707_100505713
603 Ga0070707_101120248
604 Ga0070699_100187051
605 Ga0070699_100237268
606 Ga0070679_100554908
607 Ga0070684_100003184
608 Ga0070684_100276282
609 Ga0070697_100345332
610 Ga0070697_100436971
611 Ga0070697_101028657
612 Ga0070697_101284467
613 Ga0070697_102078032
614 Ga0070672_100404465
615 Ga0070686_101910605
616 Ga0070695_100060087
617 Ga0070693_100205950
618 Ga0070665_100032371
619 Ga0070665_100154843
620 Ga0070665_100165964
621 Ga0070665_101269832
622 Ga0070665_101821837
623 Ga0070704_100010836
624 Ga0070704_100274833
625 Ga0070664_100089164
626 Ga0070664_100222528
627 Ga0070664_100342807
628 Ga0068857_100361833
629 Ga0068857_100528753
630 Ga0068854_100922130
631 Ga0068856_100889195
632 Ga0068856_101346200
633 Ga0070702_100015394
634 Ga0068852_100537138
635 Ga0068859_100043096
636 Ga0068859_100568281
637 Ga0068864_100427649
638 Ga0068864_100597435
639 Ga0068864_101223865
640 Ga0068861_100145809
641 Ga0068861_101589861
642 Ga0068863_100005582
643 Ga0068863_100686467
644 Ga0068858_100010371
645 Ga0068860_100039062
646 Ga0068860_101271345
647 Ga0068860_101597097
648 Ga0081455_10005689
649 Ga0081455_10012503
650 Ga0081455_10032288
651 Ga0081455_10160161
652 Ga0081539_10165303
653 Ga0070717_10060497
654 Ga0070717_10122560
655 Ga0070717_10176915
656 Ga0070717_10369787
657 Ga0070717_10766555
658 Ga0070717_11324330
659 Ga0070715_10420423
660 Ga0070716_100035495
661 Ga0070716_100690040
662 Ga0070716_101115823
663 Ga0070712_100069370
664 Ga0070712_100604557
665 Ga0070712_100700371
666 Ga0070712_100814242
667 Ga0070712_100860618
668 Ga0097621_100652376
669 Ga0068871_100209694
670 Ga0075428_101074083
671 Ga0075433_10073939
672 Ga0075433_11154127
673 Ga0075434_100120025
674 Ga0075434_100510329
675 Ga0075434_100916891
676 Ga0075429_101822169
677 Ga0075436_100589688
678 Ga0075436_101492453
679 Ga0097620_100043096
680 Ga0097620_100568337
681 Ga0075435_100437472
682 Ga0075435_101257374
683 Ga0075435_101648684
684 Ga0099795_10359832
685 Ga0111539_11317433
686 Ga0105245_10234996
687 Ga0105245_10491850
688 Ga0105247_10071269
689 Ga0114129_10303184
690 Ga0114129_10711797
691 Ga0114129_11094513
692 Ga0114129_11868730
693 Ga0114129_12066863
694 Ga0105243_10300957
695 Ga0105241_11218907
696 Ga0105242_11272090
697 Ga0105242_12050469
698 Ga0105248_10577892
699 Ga0105248_12836385
700 Ga0105237_10905384
701 Ga0105249_10007092
702 Ga0105249_11454682
703 Ga0105249_12967223
704 Ga0099796_10096267
705 Ga0099796_10140015
706 Ga0105239_10028602
707 Ga0105239_10091552
708 Ga0105239_11290677
709 Ga0105239_11474484
710 Ga0105239_12003175
711 Ga0105246_10058433
712 Ga0105246_10527765
713 Ga0157371_10102651
714 Ga0157369_10221085
715 Ga0157374_10083506
716 Ga0157374_10152640
717 Ga0157374_10290896
718 Ga0157374_10663919
719 Ga0157374_11719730
720 Ga0157374_12051870
721 Ga0157378_10063627
722 Ga0157378_10103531
723 Ga0157378_11421275
724 Ga0157378_11452635
725 Ga0157378_11841580
726 Ga0163162_10021995
727 Ga0163162_10375008
728 Ga0157372_10109029
729 Ga0157372_11043822
730 Ga0157372_11900772
731 Ga0157375_10004337
732 Ga0157375_10147239
733 Ga0157375_10809822
734 Ga0157375_11553931
735 Ga0157375_13183930
736 Ga0163163_10032399
737 Ga0163163_10051190
738 Ga0163163_10248805
739 Ga0163163_10613085
740 Ga0157380_12728628
741 Ga0157377_10029143
742 Ga0157377_10338103
743 Ga0157377_11048435
744 Ga0157379_10013410
745 Ga0157379_10886043
746 Ga0157379_11127691
747 Ga0157379_11185006
748 Ga0157376_10006760
749 Ga0157376_10126516
750 Ga0157376_10242888
751 Ga0157376_10526389
752 Ga0182005_1017492
753 Ga0207666_1000262
754 Ga0207666_1015039
755 Ga0207673_1002364
756 Ga0207697_10000909
757 Ga0207697_10003385
758 Ga0207697_10004500
759 Ga0207697_10043420
760 Ga0207692_10136073
761 Ga0207688_10661733
762 Ga0207647_10017234
763 Ga0207685_10052646
764 Ga0207699_10106850
765 Ga0207699_10343336
766 Ga0207645_10010003
767 Ga0207645_10193464
768 Ga0207684_10238520
769 Ga0207707_10192060
770 Ga0207671_11158324
771 Ga0207693_10050512
772 Ga0207693_10083352
773 Ga0207693_10104530
774 Ga0207693_10168189
775 Ga0207693_10282366
776 Ga0207693_10350517
777 Ga0207693_10498940
778 Ga0207693_10511760
779 Ga0207693_10549584
780 Ga0207693_10553696
781 Ga0207693_10981917
782 Ga0207663_10600815
783 Ga0207663_11027799
784 Ga0207662_10001771
785 Ga0207662_10110254
786 Ga0207657_10241362
787 Ga0207657_10584045
788 Ga0207649_10100685
789 Ga0207649_10161546
790 Ga0207652_10558140
791 Ga0207646_10099383
792 Ga0207681_10619413
793 Ga0207659_10005069
794 Ga0207659_10038315
795 Ga0207687_10332214
796 Ga0207700_10317530
797 Ga0207664_10106658
798 Ga0207664_10513619
799 Ga0207664_11737586
800 Ga0207644_11344903
801 Ga0207690_10027491
802 Ga0207690_10931299
803 Ga0207690_10941367
804 Ga0207690_11420906
805 Ga0207706_10001926
806 Ga0207706_10091029
807 Ga0207706_10119030
808 Ga0207706_10260978
809 Ga0207706_10456105
810 Ga0207686_10944114
811 Ga0207709_10508964
812 Ga0207670_10004308
813 Ga0207670_10143398
814 Ga0207669_10783453
815 Ga0207704_10147676
816 Ga0207704_10623166
817 Ga0207665_10019872
818 Ga0207665_10056609
819 Ga0207665_10520988
820 Ga0207665_11236020
821 Ga0207691_10302814
822 Ga0207691_11128357
823 Ga0207661_10097207
824 Ga0207661_10311722
825 Ga0207661_10607420
826 Ga0207679_10689078
827 Ga0207679_11134719
828 Ga0207679_11987006
829 Ga0207667_11624805
830 Ga0207667_11862069
831 Ga0207651_10038613
832 Ga0207651_11314553
833 Ga0207651_11522545
834 Ga0207712_10014146
835 Ga0207712_10953327
836 Ga0207668_10183491
837 Ga0207668_10453017
838 Ga0207668_10466761
839 Ga0207658_10064495
840 Ga0207658_10421149
841 Ga0207658_10701779
842 Ga0207677_10081146
843 Ga0207677_10824424
844 Ga0207677_10860595
845 Ga0207703_10011087
846 Ga0207678_10012655
847 Ga0207678_10249938
848 Ga0207678_11424618
849 Ga0207708_10020294
850 Ga0207708_10970228
851 Ga0207702_11539290
852 Ga0207641_10019040
853 Ga0207641_10577462
854 Ga0207641_12537611
855 Ga0207676_10083180
856 Ga0207676_10838197
857 Ga0207676_11242052
858 Ga0207676_11434590
859 Ga0207674_10319230
860 Ga0207675_100151250
861 Ga0207675_100452519
862 Ga0207683_10319224
863 Ga0209974_10251949
864 Ga0268266_10038912
865 Ga0268266_10169443
866 Ga0268266_10320997
867 Ga0268266_11107639
868 Ga0268265_10106368
869 Ga0268264_10056356
870 Ga0268264_11197772
871 Ga0268264_11529015
872 Ga0268264_11835565
873 Ga0373944_0160609
874 Ga0373944_0234279
875 Ga0373923_0196290
876 Ga0373953_0204535
877 Ga0373957_0047421
878 Ga0373943_0050226
879 Ga0373935_0001921
880 Ga0373935_0036790
881 Ga0373927_0201503
882 Ga0373933_0171622
883 Ga0373933_0987141
884 Ga0373947_0034151
885 Ga0373947_0052943
886 Ga0373947_0816098
887 Ga0373937_0102016
888 Ga0373937_0118347
889 Ga0373937_0215956
890 Ga0373937_0813062
891 Ga0373925_0150918
892 Ga0373925_0444617
893 Ga0373925_1581007
894 Ga0395900_0007005
895 Ga0395898_0003345
896 Ga0395905_0015149
897 Ga0395905_1693274
898 Ga0395901_0020303
899 Ga0451807_0463722
900 Ga0451807_1336827
901 Ga0439450_197187
902 Ga0439455_0026557
903 Ga0439444_0079261
904 Ga0439464_0223568
905 Ga0439460_0062451
906 Ga0439440_0139771
907 Ga0466965_0346172
908 Ga0451576_0780248
909 Ga0451576_2377253
910 Ga0466967_0077088
911 Ga0495641_0095074
912 Ga0495651_0292073
913 Ga0495651_0515027
914 Ga0495653_0635261
915 Ga0495582_0428241
916 Ga0495582_0564334
917 Ga0495664_0325477
918 Ga0495664_0484930
919 Ga0495664_0756377
920 Ga0495584_0357485
921 Ga0495618_0215245
922 Ga0495630_0027648
923 Ga0495652_0496776
924 Ga0495640_0161616
925 Ga0495586_0020825
926 Ga0495587_0134222
927 Ga0495587_0393927
928 Ga0495645_0321967
929 Ga0495645_0384977
930 Ga0495667_0578316
931 Ga0495634_0251793
932 Ga0495659_0477546
933 Ga0495657_0469950
934 Ga0495599_0017879
935 Ga0495623_0181984
936 Ga0495646_0416042
937 Ga0495669_0084024
938 Ga0495600_0958581
939 Ga0495604_0804750
940 Ga0495674_0115364
941 Ga0495674_0995214
942 Ga0495680_0338514
943 Ga0495680_0922805
944 Ga0495675_0025275
945 Ga0495684_0033864
946 Ga0495684_0720094
947 Ga0495602_0299441
948 Ga0496100_0422666
949 Ga0496101_0049947
950 Ga0496101_0608534
951 Ga0496102_0019141
952 Ga0496102_0068720
953 Ga0496102_0338246
954 Ga0496102_0856232
955 Ga0496103_0024181
956 Ga0496103_0109768
957 Ga0496103_0125967
958 Ga0496103_0979836
959 Ga0496104_0131529
960 Ga0496104_0468395
961 Ga0496104_1059172
962 Ga0496105_0052215
963 Ga0496105_0254118
964 Ga0496106_0023733
965 Ga0496107_0111150
966 Ga0496107_0426189
967 Ga0496108_0065570
968 Ga0496109_0102739
969 Ga0496109_0332968
970 Ga0496109_0817630
971 Ga0496110_0041442
972 Ga0496110_0432873
973 Ga0496112_0064551
974 Ga0496112_0127997
975 Ga0496112_0155674
976 Ga0496112_0483774
977 Ga0496113_0126854
978 Ga0496114_0090383
979 Ga0496114_0098008
980 Ga0496115_0246540
981 Ga0496115_0349618
982 Ga0496115_0402384
983 nmdc:mga08y16_352486_c1
984 nmdc:mga0n895_1169840_c1
985 nmdc:mga0n895_121565_c1
986 nmdc:mga0n895_139345_c1
987 nmdc:mga0n895_792899_c1
988 nmdc:mga0n895_851448_c1
989 nmdc:mga0rr50_1488061_c1
990 nmdc:mga0rr50_236666_c1
991 nmdc:mga0rr50_413110_c1
992 nmdc:mga0rr50_756189_c1
993 nmdc:mga08x19_1314960_c1
994 nmdc:mga0a205_149432_c1
995 Ga0495601_0024702
996 Ga0495612_0194387
997 Ga0495595_0171161
998 Ga0495619_0148597
999 Ga0495619_0371861
1000 Ga0495619_0418992

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05402

PqqD

Coenzyme PQQ synthesis protein D (PqqD)

41

104

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hkr-assembly1.cif.gz_A crystal structure of histone h3 lysine 79 (h3k79) methyltransferase rv2067c from mycobacterium tuberculosis 0.8954 7 93
5v1u-assembly2.cif.gz_B tbib1 in complex with the tbia(beta) leader peptide 0.8623 13 92
6jx3-assembly1.cif.gz_B lasso peptide synthetase b1 complexed with the leader peptide 0.8533 11 92
5sxy-assembly1.cif.gz_A the solution nmr structure for the pqqd truncation of methylobacterium extorquens pqqcd representing a functional and stand-alone ribosomally synthesized and post-translational modified (ripp) recognition element (rre) 0.8226 1 92
6jx3-assembly1.cif.gz_B lasso peptide synthetase b1 complexed with the leader peptide 0.8178 11 92
ID Description Score Start End Superfamily
af_P9WLL9_303_407_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8439 7 94 1.10.10.10
af_Q8INM8_6_71_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8331 58 90 1.10.10.10
af_Q18607_287_334_3.20.20.80 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.8315 16 40 3.20.20.80
af_M9PD66_13_78_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8132 58 90 1.10.10.10
af_Q9W4L7_16_81_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.7828 58 90 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2V6L9U9-F1-model_v4 Pyrroloquinoline quinone biosynthesis peptide chaperone PqqD 0.9851 1 94 GO:0018189
GO:0048038
AF-A0A317EBV2-F1-model_v4 Pyrroloquinoline quinone biosynthesis peptide chaperone PqqD 0.9758 8 94 GO:0018189
GO:0048038
AF-A0A0D6PET8-F1-model_v4 Coenzyme pyrrolo-quinoline quinone (PQQ) synthesis protein D PqqD 0.9737 6 92 GO:0018189
GO:0048038
AF-U2YMQ2-F1-model_v4 PqqA binding protein (Coenzyme PQQ synthesis protein D) (Pyrroloquinoline quinone biosynthesis protein D) 0.9721 5 92 GO:0018189
GO:0048038
AF-A0A257KU11-F1-model_v4 PqqA binding protein (Coenzyme PQQ synthesis protein D) (Pyrroloquinoline quinone biosynthesis protein D) 0.9707 6 93 GO:0018189
GO:0048038

Map