F455387

General Info

Members Datasets Scaffolds Average Seq Length
499 316 998 167

Family's Representative Sequence

Representative Sequence 3300028379|Ga0268266_10907154|Ga0268266_109071541
Length 164
Sequence MSAAFSLSSAAQVRPITLAIVAGLACAFVIGKTLPSTMDVVSAIIEPLCANSVTGSQDVVEPITSHALPNVPGKRVTIVRVFYGPGGFTPAHRHAGSVTAYITKGEIRSQLGGGPVETFGVGQSFFEPPGATHLVSANASTTEPAELIAVFVADEGAELTTMLK

Samples

Sample ID Description Type Environment
1 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
64 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
65 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
73 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
74 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
100 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
101 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
156 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
157 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
158 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
159 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
160 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
161 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
162 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
163 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
164 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
165 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
166 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
167 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
168 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
169 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
170 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
171 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
172 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
173 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
174 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
175 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
176 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
177 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
178 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
179 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
180 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
181 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
182 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
183 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
184 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
185 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
186 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
187 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
188 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
189 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
190 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
191 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
192 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
193 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
194 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
195 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
196 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
197 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
198 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
199 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
200 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
201 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
202 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
203 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
204 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
205 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
206 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
207 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
208 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
209 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
210 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
211 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
212 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
213 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
214 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
215 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
216 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
217 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
218 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
219 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
220 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
221 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
222 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
223 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
224 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
225 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
226 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
227 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
228 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
229 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
230 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
231 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
232 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
233 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
234 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
235 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
236 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
237 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
238 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
239 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
240 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
241 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
242 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
243 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
244 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
245 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
246 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
247 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
248 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
249 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
250 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
251 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
252 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
253 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
254 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
255 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
256 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
257 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
258 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
259 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
260 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
261 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
262 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
263 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
264 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
265 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
266 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
267 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
268 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
269 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
270 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
271 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
272 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
273 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
274 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
275 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
277 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
278 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
279 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
280 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
281 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
282 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
283 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
284 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
285 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
286 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
287 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
288 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
289 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
290 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
291 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
292 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
293 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
294 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
295 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
296 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
297 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
298 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
299 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
300 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
301 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
302 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
303 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
304 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
305 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
306 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
307 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
308 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
309 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
310 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
311 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
312 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
313 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
314 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
315 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
316 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.4
Metatranscriptomes 0
Isolates 0.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.42
Nodule 0.6
Rhizoplane 7.01
Rhizosphere 75.95
Stem 0
Stem Tuber 0
Unclassified 1.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0268266_10907154 3300028379 Bacteria 852
2 Ga0070658_10753356 3300005327 Bacteria 846
3 Ga0070683_100231718 3300005329 Bacteria 1756
4 Ga0070670_100806579 3300005331 Bacteria 848
5 Ga0068869_100558962 3300005334 Bacteria 962
6 Ga0068868_100540310 3300005338 Bacteria 1026
7 Ga0068868_101295101 3300005338 Bacteria 677
8 Ga0070689_100224288 3300005340 Bacteria 1543
9 Ga0070661_100825864 3300005344 Bacteria 762
10 Ga0070668_100050701 3300005347 Bacteria 3196
11 Ga0070668_100097150 3300005347 Bacteria 2329
12 Ga0070668_100475086 3300005347 Bacteria 1079
13 Ga0070669_100084169 3300005353 Bacteria 2373
14 Ga0070675_100155708 3300005354 Bacteria 1962
15 Ga0070671_100038671 3300005355 Bacteria 3960
16 Ga0070674_100057958 3300005356 Bacteria 2691
17 Ga0070673_101435936 3300005364 Bacteria 650
18 Ga0070673_101454065 3300005364 Bacteria 646
19 Ga0070688_100014829 3300005365 Bacteria 4422
20 Ga0070688_100496828 3300005365 Bacteria 919
21 Ga0070667_100211501 3300005367 Bacteria 1724
22 Ga0070667_100479493 3300005367 Bacteria 1139
23 Ga0070709_10001411 3300005434 Bacteria 13022
24 Ga0070709_10027052 3300005434 Bacteria 3407
25 Ga0070714_100319960 3300005435 Bacteria 1450
26 Ga0070714_101776778 3300005435 Bacteria 602
27 Ga0070713_100002841 3300005436 Bacteria 11326
28 Ga0070713_101026785 3300005436 Bacteria 796
29 Ga0070710_10000787 3300005437 Bacteria 15188
30 Ga0070710_10002318 3300005437 Bacteria 9004
31 Ga0070711_100032100 3300005439 Bacteria 3489
32 Ga0070711_100374319 3300005439 Bacteria 1150
33 Ga0070700_100183622 3300005441 Bacteria 1457
34 Ga0070663_100231925 3300005455 Bacteria 1454
35 Ga0070663_101379402 3300005455 Bacteria 624
36 Ga0070678_100034146 3300005456 Bacteria 3540
37 Ga0070678_100070224 3300005456 Bacteria 2617
38 Ga0070678_101599839 3300005456 Bacteria 612
39 Ga0070662_101291221 3300005457 Bacteria 628
40 Ga0070681_10058339 3300005458 Bacteria 3840
41 Ga0070706_100583014 3300005467 Bacteria 1040
42 Ga0070706_100812180 3300005467 Bacteria 865
43 Ga0070707_100807859 3300005468 Bacteria 902
44 Ga0070698_100177540 3300005471 Bacteria 2068
45 Ga0070698_100367368 3300005471 Bacteria 1371
46 Ga0070699_100223403 3300005518 Bacteria 1678
47 Ga0070679_100063911 3300005530 Bacteria 3668
48 Ga0070684_100824127 3300005535 Bacteria 868
49 Ga0070697_100082647 3300005536 Bacteria 2648
50 Ga0070697_100241565 3300005536 Bacteria 1542
51 Ga0068853_100064957 3300005539 Bacteria 3166
52 Ga0068853_100649718 3300005539 Bacteria 1004
53 Ga0070672_100219453 3300005543 Bacteria 1594
54 Ga0070686_100177283 3300005544 Bacteria 1512
55 Ga0070686_100894044 3300005544 Bacteria 722
56 Ga0070665_100027843 3300005548 Bacteria 5691
57 Ga0070665_100116229 3300005548 Bacteria 2678
58 Ga0070665_101521432 3300005548 Bacteria 677
59 Ga0070665_101603601 3300005548 Bacteria 659
60 Ga0068855_100015676 3300005563 Bacteria 9119
61 Ga0068855_100919038 3300005563 Bacteria 923
62 Ga0070664_100355308 3300005564 Bacteria 1334
63 Ga0070664_100465638 3300005564 Bacteria 1162
64 Ga0068857_100077339 3300005577 Bacteria 2969
65 Ga0068854_101382483 3300005578 Bacteria 636
66 Ga0068854_101476172 3300005578 Bacteria 617
67 Ga0068856_100876108 3300005614 Bacteria 917
68 Ga0068852_100166146 3300005616 Bacteria 2065
69 Ga0068852_100391053 3300005616 Bacteria 1366
70 Ga0068852_100696659 3300005616 Bacteria 1026
71 Ga0068852_100803401 3300005616 Bacteria 955
72 Ga0068859_100825855 3300005617 Bacteria 1013
73 Ga0068864_100070671 3300005618 Bacteria 3038
74 Ga0068866_10190378 3300005718 Bacteria 1218
75 Ga0068861_100901130 3300005719 Bacteria 837
76 Ga0068851_10099361 3300005834 Bacteria 1542
77 Ga0068851_10340293 3300005834 Bacteria 871
78 Ga0068870_10917137 3300005840 Bacteria 620
79 Ga0068858_100086981 3300005842 Bacteria 2907
80 Ga0068858_100216512 3300005842 Bacteria 1813
81 Ga0068858_101123249 3300005842 Bacteria 772
82 Ga0068860_101206571 3300005843 Bacteria 777
83 Ga0068862_100936531 3300005844 Bacteria 853
84 Ga0081455_10008859 3300005937 Bacteria 10408
85 Ga0081540_1003616 3300005983 Bacteria 12134
86 Ga0081539_10000813 3300005985 Bacteria 60571
87 Ga0070717_10001984 3300006028 Bacteria 14308
88 Ga0070717_10015705 3300006028 Bacteria 5852
89 Ga0070717_10452327 3300006028 Bacteria 1157
90 Ga0070717_11283872 3300006028 Bacteria 666
91 Ga0075365_10153429 3300006038 Bacteria 1603
92 Ga0075365_10463968 3300006038 Bacteria 894
93 Ga0075365_10544735 3300006038 Bacteria 821
94 Ga0075363_100041458 3300006048 Bacteria 2428
95 Ga0075363_100173167 3300006048 Bacteria 1226
96 Ga0075363_100238086 3300006048 Bacteria 1046
97 Ga0075364_10503497 3300006051 Bacteria 828
98 Ga0075364_10698828 3300006051 Bacteria 692
99 Ga0070715_10002208 3300006163 Bacteria 5912
100 Ga0070715_10055569 3300006163 Bacteria 1719
101 Ga0070716_100002263 3300006173 Bacteria 8870
102 Ga0070716_100135816 3300006173 Unclassified 1561
103 Ga0070712_100114162 3300006175 Bacteria 2021
104 Ga0075362_10003648 3300006177 Bacteria 5425
105 Ga0075362_10081996 3300006177 Bacteria 1488
106 Ga0075362_10171310 3300006177 Bacteria 1049
107 Ga0075367_10172598 3300006178 Bacteria 1347
108 Ga0075367_10250104 3300006178 Bacteria 1112
109 Ga0075367_10305505 3300006178 Bacteria 1002
110 Ga0075367_10565783 3300006178 Bacteria 722
111 Ga0075369_10000179 3300006186 Bacteria 18073
112 Ga0075366_10184981 3300006195 Bacteria 1266
113 Ga0097621_100712306 3300006237 Bacteria 925
114 Ga0075370_10028981 3300006353 Bacteria 3081
115 Ga0075370_10426747 3300006353 Bacteria 797
116 Ga0075428_100062292 3300006844 Bacteria 4084
117 Ga0068865_100397512 3300006881 Bacteria 1128
118 Ga0068865_100613623 3300006881 Bacteria 921
119 Ga0068865_100700352 3300006881 Bacteria 865
120 Ga0068865_100794577 3300006881 Bacteria 816
121 Ga0097620_100825892 3300006931 Bacteria 1013
122 Ga0099794_10133345 3300007265 Bacteria 1255
123 Ga0099794_10256653 3300007265 Bacteria 902
124 Ga0099794_10300781 3300007265 Bacteria 831
125 Ga0099795_10010335 3300007788 Bacteria 2745
126 Ga0099795_10097006 3300007788 Bacteria 1151
127 Ga0105250_10367090 3300009092 Bacteria 633
128 Ga0105240_10217482 3300009093 Bacteria 2228
129 Ga0105240_11302459 3300009093 Bacteria 766
130 Ga0111539_10366848 3300009094 Bacteria 1676
131 Ga0105247_10013897 3300009101 Bacteria 4828
132 Ga0114129_10173671 3300009147 Bacteria 2936
133 Ga0105243_10266464 3300009148 Bacteria 1536
134 Ga0105243_10775034 3300009148 Bacteria 943
135 Ga0105242_10631310 3300009176 Bacteria 1039
136 Ga0105242_10740133 3300009176 Bacteria 967
137 Ga0105242_12200394 3300009176 Bacteria 597
138 Ga0105248_11016061 3300009177 Bacteria 937
139 Ga0105237_10205654 3300009545 Bacteria 1969
140 Ga0105237_11178180 3300009545 Bacteria 773
141 Ga0105249_12354801 3300009553 Bacteria 605
142 Ga0099796_10046274 3300010159 Bacteria 1493
143 Ga0105239_10016541 3300010375 Bacteria 8154
144 Ga0105239_10069094 3300010375 Bacteria 3882
145 Ga0105239_10678235 3300010375 Bacteria 1178
146 Ga0105246_11515132 3300011119 Bacteria 630
147 Ga0157370_10189477 3300013104 Bacteria 1909
148 Ga0157369_10125937 3300013105 Bacteria 2716
149 Ga0157369_10795503 3300013105 Bacteria 972
150 Ga0157369_11231507 3300013105 Bacteria 763
151 Ga0157374_10656471 3300013296 Bacteria 1061
152 Ga0157378_10000929 3300013297 Bacteria 27006
153 Ga0157378_10056231 3300013297 Bacteria 3506
154 Ga0157378_10481965 3300013297 Bacteria 1236
155 Ga0157378_10584044 3300013297 Bacteria 1127
156 Ga0163162_10089810 3300013306 Bacteria 3154
157 Ga0163162_10466853 3300013306 Bacteria 1394
158 Ga0163162_10691066 3300013306 Bacteria 1142
159 Ga0163162_10943952 3300013306 Bacteria 974
160 Ga0157372_10286136 3300013307 Bacteria 1917
161 Ga0157375_10319001 3300013308 Bacteria 1718
162 Ga0157375_11121130 3300013308 Bacteria 921
163 Ga0163163_10076663 3300014325 Bacteria 3338
164 Ga0157380_10501282 3300014326 Bacteria 1179
165 Ga0157380_10586021 3300014326 Bacteria 1101
166 Ga0157380_10719377 3300014326 Bacteria 1006
167 Ga0157380_10878104 3300014326 Bacteria 921
168 Ga0157379_10033950 3300014968 Bacteria 4548
169 Ga0157379_10788100 3300014968 Bacteria 896
170 Ga0157376_10010552 3300014969 Bacteria 6764
171 Ga0163161_10185992 3300017792 Bacteria 1595
172 Ga0163161_10334761 3300017792 Bacteria 1200
173 Ga0213872_10136982 3300021361 Bacteria 1076
174 Ga0213871_10067024 3300021441 Bacteria 1008
175 Ga0207697_10230929 3300025315 Bacteria 817
176 Ga0207682_10067498 3300025893 Bacteria 1509
177 Ga0207692_10062849 3300025898 Bacteria 1928
178 Ga0207692_10536078 3300025898 Unclassified 746
179 Ga0207710_10067111 3300025900 Bacteria 1638
180 Ga0207647_10134431 3300025904 Bacteria 1452
181 Ga0207685_10159396 3300025905 Bacteria 1029
182 Ga0207685_10747933 3300025905 Bacteria 535
183 Ga0207699_10002180 3300025906 Bacteria 9245
184 Ga0207699_10010325 3300025906 Bacteria 4681
185 Ga0207643_10349471 3300025908 Bacteria 928
186 Ga0207684_10102344 3300025910 Bacteria 2449
187 Ga0207684_10506475 3300025910 Bacteria 1035
188 Ga0207707_10134454 3300025912 Bacteria 2162
189 Ga0207707_10999528 3300025912 Bacteria 687
190 Ga0207695_10194614 3300025913 Bacteria 1944
191 Ga0207671_10058295 3300025914 Bacteria 2862
192 Ga0207671_10760842 3300025914 Bacteria 769
193 Ga0207693_10162325 3300025915 Bacteria 1758
194 Ga0207693_10935857 3300025915 Unclassified 664
195 Ga0207663_10006068 3300025916 Bacteria 6145
196 Ga0207663_10006345 3300025916 Bacteria 6044
197 Ga0207660_10397354 3300025917 Bacteria 1110
198 Ga0207657_10374472 3300025919 Bacteria 1122
199 Ga0207652_10028728 3300025921 Bacteria 4642
200 Ga0207681_10302873 3300025923 Bacteria 1265
201 Ga0207681_10616778 3300025923 Bacteria 897
202 Ga0207659_10210882 3300025926 Bacteria 1557
203 Ga0207659_10819440 3300025926 Bacteria 800
204 Ga0207687_10369136 3300025927 Bacteria 1173
205 Ga0207700_10004224 3300025928 Bacteria 8437
206 Ga0207664_10124756 3300025929 Bacteria 2160
207 Ga0207664_10361062 3300025929 Bacteria 1287
208 Ga0207644_10094666 3300025931 Bacteria 2232
209 Ga0207644_10469708 3300025931 Bacteria 1035
210 Ga0207690_10055932 3300025932 Bacteria 2659
211 Ga0207706_10704829 3300025933 Unclassified 862
212 Ga0207706_11372566 3300025933 Bacteria 581
213 Ga0207686_10331406 3300025934 Bacteria 1140
214 Ga0207686_10462305 3300025934 Bacteria 978
215 Ga0207709_10007974 3300025935 Bacteria 5866
216 Ga0207669_10368707 3300025937 Bacteria 1115
217 Ga0207704_10183379 3300025938 Bacteria 1515
218 Ga0207704_10442216 3300025938 Bacteria 1036
219 Ga0207704_10545280 3300025938 Bacteria 942
220 Ga0207665_10019029 3300025939 Bacteria 4511
221 Ga0207665_10137946 3300025939 Bacteria 1737
222 Ga0207665_10662060 3300025939 Bacteria 819
223 Ga0207691_10052085 3300025940 Bacteria 3739
224 Ga0207691_10196436 3300025940 Bacteria 1757
225 Ga0207711_10029690 3300025941 Bacteria 4613
226 Ga0207689_10191335 3300025942 Bacteria 1688
227 Ga0207661_10357960 3300025944 Bacteria 1318
228 Ga0207667_10095704 3300025949 Bacteria 3065
229 Ga0207667_10655198 3300025949 Bacteria 1055
230 Ga0207712_10009125 3300025961 Bacteria 6276
231 Ga0207668_10075244 3300025972 Bacteria 2427
232 Ga0207640_10123838 3300025981 Bacteria 1857
233 Ga0207658_10092323 3300025986 Bacteria 2351
234 Ga0207677_10689499 3300026023 Bacteria 905
235 Ga0207703_10127553 3300026035 Bacteria 2193
236 Ga0207703_10479092 3300026035 Unclassified 1166
237 Ga0207639_10565139 3300026041 Bacteria 1046
238 Ga0207639_11158002 3300026041 Bacteria 726
239 Ga0207678_10076140 3300026067 Bacteria 2874
240 Ga0207678_10109696 3300026067 Bacteria 2354
241 Ga0207678_10187793 3300026067 Bacteria 1766
242 Ga0207708_10047941 3300026075 Bacteria 3251
243 Ga0207641_10326657 3300026088 Bacteria 1456
244 Ga0207648_10414340 3300026089 Bacteria 1222
245 Ga0207648_10459882 3300026089 Bacteria 1160
246 Ga0207676_11576280 3300026095 Bacteria 654
247 Ga0207674_10185249 3300026116 Bacteria 2032
248 Ga0207675_100489272 3300026118 Bacteria 1224
249 Ga0207683_10015524 3300026121 Bacteria 6485
250 Ga0207683_10042294 3300026121 Bacteria 3980
251 Ga0207683_11407100 3300026121 Bacteria 645
252 Ga0207698_10034058 3300026142 Bacteria 3709
253 Ga0207698_11522443 3300026142 Bacteria 684
254 Ga0209179_1006823 3300027512 Bacteria 1859
255 Ga0209179_1018701 3300027512 Bacteria 1326
256 Ga0268266_10003301 3300028379 Bacteria 16212
257 Ga0268266_10017966 3300028379 Bacteria 6030
258 Ga0268265_10314546 3300028380 Bacteria 1415
259 Ga0268265_10365594 3300028380 Bacteria 1322
260 Ga0268265_11180314 3300028380 Bacteria 762
261 Ga0268264_10941100 3300028381 Bacteria 869
262 Ga0307517_10000495 3300028786 Bacteria 67515
263 Ga0307517_10384205 3300028786 Bacteria 749
264 Ga0307515_10032002 3300028794 Bacteria 8735
265 Ga0307515_10338634 3300028794 Bacteria 1158
266 Ga0265325_10008378 3300031241 Bacteria 6103
267 Ga0265316_10864003 3300031344 Bacteria 633
268 Ga0307408_101075974 3300031548 Bacteria 745
269 Ga0307508_10000002 3300031616 Bacteria 407635
270 Ga0307508_10043792 3300031616 Bacteria 4008
271 Ga0307516_10006269 3300031730 Bacteria 13981
272 Ga0307516_10015885 3300031730 Bacteria 7900
273 Ga0307516_10514332 3300031730 Bacteria 851
274 Ga0307516_10670385 3300031730 Bacteria 693
275 Ga0307516_10766545 3300031730 Bacteria 625
276 Ga0307410_10942172 3300031852 Bacteria 742
277 Ga0307406_10608850 3300031901 Bacteria 902
278 Ga0307412_10072082 3300031911 Bacteria 2360
279 Ga0307412_10328491 3300031911 Bacteria 1220
280 Ga0307416_100822474 3300032002 Bacteria 1026
281 Ga0307416_102429760 3300032002 Bacteria 623
282 Ga0307415_100179251 3300032126 Bacteria 1661
283 Ga0307510_10098156 3300033180 Bacteria 2734
284 Ga0373930_0013014 3300034816 Bacteria 1527
285 Ga0373958_0029288 3300034819 Bacteria 1071
286 Ga0373934_0005190 3300035086 Bacteria 4819
287 Ga0373952_0241817 3300035092 Bacteria 543
288 Ga0373923_0003136 3300035111 Bacteria 5254
289 Ga0373936_0012940 3300035113 Bacteria 3182
290 Ga0373939_0202684 3300035114 Bacteria 751
291 Ga0373953_0012842 3300035117 Bacteria 2975
292 Ga0373954_0000258 3300035118 Bacteria 19123
293 Ga0373956_0001469 3300035119 Bacteria 9742
294 Ga0373957_0001886 3300035120 Bacteria 5825
295 Ga0373946_0183946 3300035171 Bacteria 993
296 Ga0373955_0007855 3300035172 Bacteria 4921
297 Ga0373931_0001558 3300035691 Bacteria 9898
298 Ga0373931_0592376 3300035691 Bacteria 724
299 Ga0373927_0024658 3300035695 Bacteria 3931
300 Ga0373927_0051588 3300035695 Bacteria 2660
301 Ga0373933_0037624 3300035724 Bacteria 2839
302 Ga0373937_0212297 3300036401 Bacteria 1821
303 Ga0373925_0414397 3300037068 Bacteria 1100
304 Ga0373925_0647589 3300037068 Bacteria 871
305 Ga0395901_0931625 3300038443 Unclassified 849
306 Ga0436360_0204878 3300039438 Bacteria 3845
307 Ga0436361_0424452 3300039447 Bacteria 5154
308 Ga0451798_0865352 3300041458 Bacteria 873
309 Ga0451807_2559491 3300041486 Bacteria 737
310 Ga0451837_0130753 3300041494 Bacteria 794
311 Ga0451839_0680294 3300041496 Unclassified 568
312 Ga0451839_1094527 3300041496 Bacteria 591
313 Ga0451843_1733914 3300041509 Bacteria 1011
314 Ga0451853_1839094 3300041512 Bacteria 645
315 Ga0495617_050863 3300046452 Bacteria 1378
316 Ga0495627_126696 3300046453 Bacteria 719
317 Ga0495592_0040238 3300046454 Bacteria 3508
318 Ga0495603_0166302 3300046455 Bacteria 1278
319 Ga0495603_0228956 3300046455 Bacteria 1072
320 Ga0495629_0000932 3300046459 Bacteria 23548
321 Ga0495651_0087945 3300046462 Bacteria 2335
322 Ga0495651_0118353 3300046462 Bacteria 1949
323 Ga0495653_0001885 3300046463 Bacteria 16548
324 Ga0495605_0014418 3300046474 Bacteria 4332
325 Ga0495605_0171371 3300046474 Bacteria 959
326 Ga0495639_0025185 3300046475 Bacteria 2623
327 Ga0495639_0125187 3300046475 Bacteria 1228
328 Ga0495664_0323902 3300046477 Bacteria 929
329 Ga0495584_0154123 3300046491 Bacteria 1167
330 Ga0495584_0198373 3300046491 Bacteria 1020
331 Ga0495584_0281634 3300046491 Bacteria 845
332 Ga0495585_0027528 3300046492 Bacteria 3244
333 Ga0495585_0239337 3300046492 Bacteria 909
334 Ga0495594_0009868 3300046499 Bacteria 4948
335 Ga0495607_0371163 3300046501 Bacteria 656
336 Ga0495583_0117029 3300046506 Bacteria 1125
337 Ga0495608_0040794 3300046511 Bacteria 3108
338 Ga0495628_0038859 3300046516 Bacteria 3807
339 Ga0495631_0103619 3300046518 Bacteria 1224
340 Ga0495631_0174323 3300046518 Bacteria 922
341 Ga0495631_0224137 3300046518 Bacteria 802
342 Ga0495643_0182496 3300046522 Bacteria 1019
343 Ga0495644_0046064 3300046523 Bacteria 1639
344 Ga0495644_0272937 3300046523 Bacteria 659
345 Ga0495663_0060143 3300046525 Bacteria 1193
346 Ga0495652_0038249 3300046529 Bacteria 4157
347 Ga0495652_0230893 3300046529 Bacteria 1384
348 Ga0495652_0874864 3300046529 Bacteria 594
349 Ga0495640_0020818 3300046533 Bacteria 4820
350 Ga0495598_0003465 3300046537 Bacteria 3355
351 Ga0495609_0367063 3300046538 Bacteria 579
352 Ga0495621_0005132 3300046539 Bacteria 3742
353 Ga0495645_0032506 3300046543 Bacteria 3806
354 Ga0495622_0104564 3300046557 Bacteria 1297
355 Ga0495633_0011335 3300046558 Bacteria 4811
356 Ga0495633_0229368 3300046558 Bacteria 849
357 Ga0495667_0007419 3300046559 Bacteria 7434
358 Ga0495667_0686731 3300046559 Bacteria 635
359 Ga0495656_0008676 3300046615 Bacteria 3636
360 Ga0495656_0046311 3300046615 Bacteria 1840
361 Ga0495656_0314263 3300046615 Bacteria 805
362 Ga0495668_0043418 3300046616 Bacteria 2501
363 Ga0495668_0122335 3300046616 Bacteria 1424
364 Ga0495634_0008179 3300046642 Bacteria 7795
365 Ga0495611_0279670 3300046648 Bacteria 771
366 Ga0495611_0506124 3300046648 Bacteria 548
367 Ga0495635_0002237 3300046663 Bacteria 13152
368 Ga0495659_0009260 3300046664 Bacteria 3140
369 Ga0495661_0423916 3300046665 Bacteria 644
370 Ga0495588_0159847 3300046674 Bacteria 1191
371 Ga0495588_0596159 3300046674 Bacteria 579
372 Ga0495599_0016188 3300046678 Bacteria 4628
373 Ga0495623_0019521 3300046679 Bacteria 4379
374 Ga0495646_0010250 3300046680 Bacteria 5961
375 Ga0495647_0299970 3300046681 Bacteria 724
376 Ga0495669_0001679 3300046684 Bacteria 9065
377 Ga0495669_0032053 3300046684 Bacteria 2308
378 Ga0495669_0048703 3300046684 Bacteria 1896
379 Ga0495669_0142179 3300046684 Bacteria 1133
380 Ga0495669_0194062 3300046684 Bacteria 970
381 Ga0495624_0180941 3300046690 Bacteria 1285
382 Ga0495670_0008532 3300046691 Bacteria 5044
383 Ga0495671_0475447 3300046692 Bacteria 597
384 Ga0495589_0097634 3300046794 Bacteria 1423
385 Ga0495589_0256380 3300046794 Bacteria 816
386 Ga0495589_0524697 3300046794 Bacteria 540
387 Ga0495600_0024995 3300046809 Bacteria 3847
388 Ga0495581_0011187 3300047315 Bacteria 5188
389 Ga0495604_0005325 3300047317 Bacteria 10206
390 Ga0495674_0044145 3300047319 Bacteria 3964
391 Ga0495672_0072760 3300047320 Bacteria 1940
392 Ga0495672_0125963 3300047320 Bacteria 1354
393 Ga0495676_0031776 3300047321 Bacteria 4461
394 Ga0495680_0229487 3300047322 Bacteria 1322
395 Ga0495683_0063475 3300047323 Bacteria 1825
396 Ga0495675_0014860 3300047444 Bacteria 4923
397 Ga0495677_0290410 3300047445 Bacteria 642
398 Ga0495673_0021778 3300047469 Bacteria 3156
399 Ga0495684_0002066 3300047471 Bacteria 16139
400 Ga0495593_0009372 3300047673 Bacteria 5681
401 Ga0495602_0014531 3300048088 Bacteria 7988
402 Ga0496100_0054121 3300048903 Bacteria 2616
403 Ga0496100_0632790 3300048903 Bacteria 832
404 Ga0496101_0003593 3300048904 Bacteria 9679
405 Ga0496101_0116543 3300048904 Bacteria 2015
406 Ga0496101_0423447 3300048904 Bacteria 1049
407 Ga0496102_0041231 3300048905 Bacteria 4178
408 Ga0496103_0056799 3300048906 Bacteria 2430
409 Ga0496103_0152407 3300048906 Bacteria 1481
410 Ga0496104_0013566 3300048907 Bacteria 7344
411 Ga0496105_0018872 3300048908 Bacteria 5554
412 Ga0496105_0122974 3300048908 Bacteria 2139
413 Ga0496106_0008719 3300048909 Bacteria 7500
414 Ga0496106_0039391 3300048909 Bacteria 3539
415 Ga0496106_0163326 3300048909 Bacteria 1762
416 Ga0496107_0354612 3300048910 Bacteria 1091
417 Ga0496108_0006246 3300048911 Bacteria 9648
418 Ga0496108_0025055 3300048911 Bacteria 4915
419 Ga0496108_1207023 3300048911 Bacteria 639
420 Ga0496109_0202499 3300048912 Bacteria 1866
421 Ga0496110_0007940 3300048913 Bacteria 8499
422 Ga0496110_0089228 3300048913 Bacteria 2755
423 Ga0496110_0193399 3300048913 Bacteria 1847
424 Ga0496110_0738586 3300048913 Bacteria 887
425 Ga0496111_0034218 3300048914 Bacteria 3627
426 Ga0496111_0062456 3300048914 Bacteria 2701
427 Ga0496112_0001393 3300048915 Bacteria 18457
428 Ga0496113_0001153 3300048916 Bacteria 14398
429 Ga0496114_0010917 3300048917 Bacteria 7239
430 Ga0496114_0082252 3300048917 Bacteria 2721
431 Ga0496114_1598572 3300048917 Bacteria 540
432 Ga0496115_0002321 3300048918 Bacteria 13627
433 Ga0496115_0186197 3300048918 Bacteria 1715
434 Ga0496115_0568088 3300048918 Bacteria 905
435 Ga0496121_0152236 3300048924 Bacteria 1701
436 Ga0496121_0455403 3300048924 Bacteria 823
437 Ga0496121_0458594 3300048924 Bacteria 819
438 Ga0496124_0054746 3300048927 Bacteria 3375
439 Ga0496124_0087240 3300048927 Bacteria 2552
440 Ga0496126_0161493 3300048929 Bacteria 1914
441 Ga0496126_0455829 3300048929 Bacteria 1028
442 Ga0496126_0571847 3300048929 Bacteria 894
443 Ga0501034_0004051 3300049571 Bacteria 16440
444 Ga0501034_0086191 3300049571 Bacteria 3142
445 Ga0501034_0123053 3300049571 Bacteria 2580
446 Ga0501068_0188613 3300049584 Bacteria 1305
447 Ga0501070_0191417 3300049586 Bacteria 1681
448 Ga0501072_0539931 3300049588 Unclassified 921
449 Ga0501080_0976020 3300049742 Bacteria 736
450 Ga0501044_0036799 3300049823 Bacteria 5119
451 nmdc:mga03683_22828_c3 3300050489 Bacteria 1550
452 nmdc:mga03683_417_c2 3300050489 Bacteria 8097
453 nmdc:mga03n38_127122_c1 3300050490 Bacteria 1259
454 nmdc:mga00v17_17285_c1 3300050491 Bacteria 4080
455 nmdc:mga00v17_252575_c1 3300050491 Bacteria 1143
456 nmdc:mga00v17_430040_c1 3300050491 Bacteria 857
457 nmdc:mga00v17_729789_c1 3300050491 Unclassified 634
458 nmdc:mga0yw44_17504_c1 3300050492 Bacteria 3902
459 nmdc:mga0yw44_544462_c1 3300050492 Bacteria 788
460 nmdc:mga0k408_251138_c1 3300050493 Bacteria 1056
461 nmdc:mga0k408_280061_c1 3300050493 Bacteria 995
462 nmdc:mga06z11_146653_c1 3300050494 Bacteria 1338
463 nmdc:mga06z11_192632_c1 3300050494 Bacteria 1181
464 nmdc:mga07m45_18211_c1 3300050496 Bacteria 3786
465 nmdc:mga0sz30_3020_c1 3300050516 Bacteria 6030
466 nmdc:mga0sz30_4062_c1 3300050516 Bacteria 5271
467 Ga0495601_0011133 3300053077 Bacteria 5373
468 Ga0495601_0030837 3300053077 Bacteria 3331
469 Ga0495601_0172742 3300053077 Bacteria 1413
470 Ga0495612_0029297 3300053078 Bacteria 2217
471 Ga0500635_0011618 3300053080 Bacteria 2508
472 Ga0495595_0006080 3300053084 Bacteria 4906
473 Ga0495595_0034004 3300053084 Bacteria 2304
474 Ga0495619_0001152 3300053085 Bacteria 17364
475 Ga0495619_0005951 3300053085 Bacteria 7726
476 Ga0500644_0134513 3300053088 Bacteria 977
477 Ga0500647_0013212 3300053091 Bacteria 3733
478 Ga0500566_0067400 3300053094 Bacteria 2015
479 Ga0500554_004228 3300053102 Bacteria 3024
480 Ga0500595_001168 3300053119 Bacteria 14542
481 Ga0500608_057362 3300053122 Bacteria 1865
482 Ga0500614_004534 3300053123 Bacteria 2930
483 Ga0500559_0057542 3300053136 Bacteria 1727
484 Ga0500603_003016 3300053150 Bacteria 3632
485 Ga0500620_203317 3300053155 Bacteria 675
486 Ga0500627_0114320 3300053158 Bacteria 1216
487 Ga0500630_035411 3300053159 Bacteria 2446
488 Ga0500638_000113 3300053162 Bacteria 15503
489 Ga0500639_017494 3300053163 Bacteria 3784
490 Ga0500636_0255017 3300053177 Bacteria 892
491 Ga0500637_0006864 3300053178 Bacteria 5651
492 Ga0500637_0014405 3300053178 Bacteria 4171
493 Ga0500576_165291 3300053725 Bacteria 805
494 Ga0500596_001980 3300053735 Bacteria 4102
495 Ga0500601_021213 3300053737 Bacteria 750
496 Ga0500661_003701 3300055283 Bacteria 2870
497 2509150363 2508501128 Bacteria 8613869
498 2879112904 2879110137 Bacteria 8907982
499 8056688264 8056681323 Bacteria 8472857
500 Ga0268266_10907154
501 Ga0070658_10753356
502 Ga0070683_100231718
503 Ga0070670_100806579
504 Ga0068869_100558962
505 Ga0068868_100540310
506 Ga0068868_101295101
507 Ga0070689_100224288
508 Ga0070661_100825864
509 Ga0070668_100050701
510 Ga0070668_100097150
511 Ga0070668_100475086
512 Ga0070669_100084169
513 Ga0070675_100155708
514 Ga0070671_100038671
515 Ga0070674_100057958
516 Ga0070673_101435936
517 Ga0070673_101454065
518 Ga0070688_100014829
519 Ga0070688_100496828
520 Ga0070667_100211501
521 Ga0070667_100479493
522 Ga0070709_10001411
523 Ga0070709_10027052
524 Ga0070714_100319960
525 Ga0070714_101776778
526 Ga0070713_100002841
527 Ga0070713_101026785
528 Ga0070710_10000787
529 Ga0070710_10002318
530 Ga0070711_100032100
531 Ga0070711_100374319
532 Ga0070700_100183622
533 Ga0070663_100231925
534 Ga0070663_101379402
535 Ga0070678_100034146
536 Ga0070678_100070224
537 Ga0070678_101599839
538 Ga0070662_101291221
539 Ga0070681_10058339
540 Ga0070706_100583014
541 Ga0070706_100812180
542 Ga0070707_100807859
543 Ga0070698_100177540
544 Ga0070698_100367368
545 Ga0070699_100223403
546 Ga0070679_100063911
547 Ga0070684_100824127
548 Ga0070697_100082647
549 Ga0070697_100241565
550 Ga0068853_100064957
551 Ga0068853_100649718
552 Ga0070672_100219453
553 Ga0070686_100177283
554 Ga0070686_100894044
555 Ga0070665_100027843
556 Ga0070665_100116229
557 Ga0070665_101521432
558 Ga0070665_101603601
559 Ga0068855_100015676
560 Ga0068855_100919038
561 Ga0070664_100355308
562 Ga0070664_100465638
563 Ga0068857_100077339
564 Ga0068854_101382483
565 Ga0068854_101476172
566 Ga0068856_100876108
567 Ga0068852_100166146
568 Ga0068852_100391053
569 Ga0068852_100696659
570 Ga0068852_100803401
571 Ga0068859_100825855
572 Ga0068864_100070671
573 Ga0068866_10190378
574 Ga0068861_100901130
575 Ga0068851_10099361
576 Ga0068851_10340293
577 Ga0068870_10917137
578 Ga0068858_100086981
579 Ga0068858_100216512
580 Ga0068858_101123249
581 Ga0068860_101206571
582 Ga0068862_100936531
583 Ga0081455_10008859
584 Ga0081540_1003616
585 Ga0081539_10000813
586 Ga0070717_10001984
587 Ga0070717_10015705
588 Ga0070717_10452327
589 Ga0070717_11283872
590 Ga0075365_10153429
591 Ga0075365_10463968
592 Ga0075365_10544735
593 Ga0075363_100041458
594 Ga0075363_100173167
595 Ga0075363_100238086
596 Ga0075364_10503497
597 Ga0075364_10698828
598 Ga0070715_10002208
599 Ga0070715_10055569
600 Ga0070716_100002263
601 Ga0070716_100135816
602 Ga0070712_100114162
603 Ga0075362_10003648
604 Ga0075362_10081996
605 Ga0075362_10171310
606 Ga0075367_10172598
607 Ga0075367_10250104
608 Ga0075367_10305505
609 Ga0075367_10565783
610 Ga0075369_10000179
611 Ga0075366_10184981
612 Ga0097621_100712306
613 Ga0075370_10028981
614 Ga0075370_10426747
615 Ga0075428_100062292
616 Ga0068865_100397512
617 Ga0068865_100613623
618 Ga0068865_100700352
619 Ga0068865_100794577
620 Ga0097620_100825892
621 Ga0099794_10133345
622 Ga0099794_10256653
623 Ga0099794_10300781
624 Ga0099795_10010335
625 Ga0099795_10097006
626 Ga0105250_10367090
627 Ga0105240_10217482
628 Ga0105240_11302459
629 Ga0111539_10366848
630 Ga0105247_10013897
631 Ga0114129_10173671
632 Ga0105243_10266464
633 Ga0105243_10775034
634 Ga0105242_10631310
635 Ga0105242_10740133
636 Ga0105242_12200394
637 Ga0105248_11016061
638 Ga0105237_10205654
639 Ga0105237_11178180
640 Ga0105249_12354801
641 Ga0099796_10046274
642 Ga0105239_10016541
643 Ga0105239_10069094
644 Ga0105239_10678235
645 Ga0105246_11515132
646 Ga0157370_10189477
647 Ga0157369_10125937
648 Ga0157369_10795503
649 Ga0157369_11231507
650 Ga0157374_10656471
651 Ga0157378_10000929
652 Ga0157378_10056231
653 Ga0157378_10481965
654 Ga0157378_10584044
655 Ga0163162_10089810
656 Ga0163162_10466853
657 Ga0163162_10691066
658 Ga0163162_10943952
659 Ga0157372_10286136
660 Ga0157375_10319001
661 Ga0157375_11121130
662 Ga0163163_10076663
663 Ga0157380_10501282
664 Ga0157380_10586021
665 Ga0157380_10719377
666 Ga0157380_10878104
667 Ga0157379_10033950
668 Ga0157379_10788100
669 Ga0157376_10010552
670 Ga0163161_10185992
671 Ga0163161_10334761
672 Ga0213872_10136982
673 Ga0213871_10067024
674 Ga0207697_10230929
675 Ga0207682_10067498
676 Ga0207692_10062849
677 Ga0207692_10536078
678 Ga0207710_10067111
679 Ga0207647_10134431
680 Ga0207685_10159396
681 Ga0207685_10747933
682 Ga0207699_10002180
683 Ga0207699_10010325
684 Ga0207643_10349471
685 Ga0207684_10102344
686 Ga0207684_10506475
687 Ga0207707_10134454
688 Ga0207707_10999528
689 Ga0207695_10194614
690 Ga0207671_10058295
691 Ga0207671_10760842
692 Ga0207693_10162325
693 Ga0207693_10935857
694 Ga0207663_10006068
695 Ga0207663_10006345
696 Ga0207660_10397354
697 Ga0207657_10374472
698 Ga0207652_10028728
699 Ga0207681_10302873
700 Ga0207681_10616778
701 Ga0207659_10210882
702 Ga0207659_10819440
703 Ga0207687_10369136
704 Ga0207700_10004224
705 Ga0207664_10124756
706 Ga0207664_10361062
707 Ga0207644_10094666
708 Ga0207644_10469708
709 Ga0207690_10055932
710 Ga0207706_10704829
711 Ga0207706_11372566
712 Ga0207686_10331406
713 Ga0207686_10462305
714 Ga0207709_10007974
715 Ga0207669_10368707
716 Ga0207704_10183379
717 Ga0207704_10442216
718 Ga0207704_10545280
719 Ga0207665_10019029
720 Ga0207665_10137946
721 Ga0207665_10662060
722 Ga0207691_10052085
723 Ga0207691_10196436
724 Ga0207711_10029690
725 Ga0207689_10191335
726 Ga0207661_10357960
727 Ga0207667_10095704
728 Ga0207667_10655198
729 Ga0207712_10009125
730 Ga0207668_10075244
731 Ga0207640_10123838
732 Ga0207658_10092323
733 Ga0207677_10689499
734 Ga0207703_10127553
735 Ga0207703_10479092
736 Ga0207639_10565139
737 Ga0207639_11158002
738 Ga0207678_10076140
739 Ga0207678_10109696
740 Ga0207678_10187793
741 Ga0207708_10047941
742 Ga0207641_10326657
743 Ga0207648_10414340
744 Ga0207648_10459882
745 Ga0207676_11576280
746 Ga0207674_10185249
747 Ga0207675_100489272
748 Ga0207683_10015524
749 Ga0207683_10042294
750 Ga0207683_11407100
751 Ga0207698_10034058
752 Ga0207698_11522443
753 Ga0209179_1006823
754 Ga0209179_1018701
755 Ga0268266_10003301
756 Ga0268266_10017966
757 Ga0268265_10314546
758 Ga0268265_10365594
759 Ga0268265_11180314
760 Ga0268264_10941100
761 Ga0307517_10000495
762 Ga0307517_10384205
763 Ga0307515_10032002
764 Ga0307515_10338634
765 Ga0265325_10008378
766 Ga0265316_10864003
767 Ga0307408_101075974
768 Ga0307508_10000002
769 Ga0307508_10043792
770 Ga0307516_10006269
771 Ga0307516_10015885
772 Ga0307516_10514332
773 Ga0307516_10670385
774 Ga0307516_10766545
775 Ga0307410_10942172
776 Ga0307406_10608850
777 Ga0307412_10072082
778 Ga0307412_10328491
779 Ga0307416_100822474
780 Ga0307416_102429760
781 Ga0307415_100179251
782 Ga0307510_10098156
783 Ga0373930_0013014
784 Ga0373958_0029288
785 Ga0373934_0005190
786 Ga0373952_0241817
787 Ga0373923_0003136
788 Ga0373936_0012940
789 Ga0373939_0202684
790 Ga0373953_0012842
791 Ga0373954_0000258
792 Ga0373956_0001469
793 Ga0373957_0001886
794 Ga0373946_0183946
795 Ga0373955_0007855
796 Ga0373931_0001558
797 Ga0373931_0592376
798 Ga0373927_0024658
799 Ga0373927_0051588
800 Ga0373933_0037624
801 Ga0373937_0212297
802 Ga0373925_0414397
803 Ga0373925_0647589
804 Ga0395901_0931625
805 Ga0436360_0204878
806 Ga0436361_0424452
807 Ga0451798_0865352
808 Ga0451807_2559491
809 Ga0451837_0130753
810 Ga0451839_0680294
811 Ga0451839_1094527
812 Ga0451843_1733914
813 Ga0451853_1839094
814 Ga0495617_050863
815 Ga0495627_126696
816 Ga0495592_0040238
817 Ga0495603_0166302
818 Ga0495603_0228956
819 Ga0495629_0000932
820 Ga0495651_0087945
821 Ga0495651_0118353
822 Ga0495653_0001885
823 Ga0495605_0014418
824 Ga0495605_0171371
825 Ga0495639_0025185
826 Ga0495639_0125187
827 Ga0495664_0323902
828 Ga0495584_0154123
829 Ga0495584_0198373
830 Ga0495584_0281634
831 Ga0495585_0027528
832 Ga0495585_0239337
833 Ga0495594_0009868
834 Ga0495607_0371163
835 Ga0495583_0117029
836 Ga0495608_0040794
837 Ga0495628_0038859
838 Ga0495631_0103619
839 Ga0495631_0174323
840 Ga0495631_0224137
841 Ga0495643_0182496
842 Ga0495644_0046064
843 Ga0495644_0272937
844 Ga0495663_0060143
845 Ga0495652_0038249
846 Ga0495652_0230893
847 Ga0495652_0874864
848 Ga0495640_0020818
849 Ga0495598_0003465
850 Ga0495609_0367063
851 Ga0495621_0005132
852 Ga0495645_0032506
853 Ga0495622_0104564
854 Ga0495633_0011335
855 Ga0495633_0229368
856 Ga0495667_0007419
857 Ga0495667_0686731
858 Ga0495656_0008676
859 Ga0495656_0046311
860 Ga0495656_0314263
861 Ga0495668_0043418
862 Ga0495668_0122335
863 Ga0495634_0008179
864 Ga0495611_0279670
865 Ga0495611_0506124
866 Ga0495635_0002237
867 Ga0495659_0009260
868 Ga0495661_0423916
869 Ga0495588_0159847
870 Ga0495588_0596159
871 Ga0495599_0016188
872 Ga0495623_0019521
873 Ga0495646_0010250
874 Ga0495647_0299970
875 Ga0495669_0001679
876 Ga0495669_0032053
877 Ga0495669_0048703
878 Ga0495669_0142179
879 Ga0495669_0194062
880 Ga0495624_0180941
881 Ga0495670_0008532
882 Ga0495671_0475447
883 Ga0495589_0097634
884 Ga0495589_0256380
885 Ga0495589_0524697
886 Ga0495600_0024995
887 Ga0495581_0011187
888 Ga0495604_0005325
889 Ga0495674_0044145
890 Ga0495672_0072760
891 Ga0495672_0125963
892 Ga0495676_0031776
893 Ga0495680_0229487
894 Ga0495683_0063475
895 Ga0495675_0014860
896 Ga0495677_0290410
897 Ga0495673_0021778
898 Ga0495684_0002066
899 Ga0495593_0009372
900 Ga0495602_0014531
901 Ga0496100_0054121
902 Ga0496100_0632790
903 Ga0496101_0003593
904 Ga0496101_0116543
905 Ga0496101_0423447
906 Ga0496102_0041231
907 Ga0496103_0056799
908 Ga0496103_0152407
909 Ga0496104_0013566
910 Ga0496105_0018872
911 Ga0496105_0122974
912 Ga0496106_0008719
913 Ga0496106_0039391
914 Ga0496106_0163326
915 Ga0496107_0354612
916 Ga0496108_0006246
917 Ga0496108_0025055
918 Ga0496108_1207023
919 Ga0496109_0202499
920 Ga0496110_0007940
921 Ga0496110_0089228
922 Ga0496110_0193399
923 Ga0496110_0738586
924 Ga0496111_0034218
925 Ga0496111_0062456
926 Ga0496112_0001393
927 Ga0496113_0001153
928 Ga0496114_0010917
929 Ga0496114_0082252
930 Ga0496114_1598572
931 Ga0496115_0002321
932 Ga0496115_0186197
933 Ga0496115_0568088
934 Ga0496121_0152236
935 Ga0496121_0455403
936 Ga0496121_0458594
937 Ga0496124_0054746
938 Ga0496124_0087240
939 Ga0496126_0161493
940 Ga0496126_0455829
941 Ga0496126_0571847
942 Ga0501034_0004051
943 Ga0501034_0086191
944 Ga0501034_0123053
945 Ga0501068_0188613
946 Ga0501070_0191417
947 Ga0501072_0539931
948 Ga0501080_0976020
949 Ga0501044_0036799
950 nmdc:mga03683_22828_c3
951 nmdc:mga03683_417_c2
952 nmdc:mga03n38_127122_c1
953 nmdc:mga00v17_17285_c1
954 nmdc:mga00v17_252575_c1
955 nmdc:mga00v17_430040_c1
956 nmdc:mga00v17_729789_c1
957 nmdc:mga0yw44_17504_c1
958 nmdc:mga0yw44_544462_c1
959 nmdc:mga0k408_251138_c1
960 nmdc:mga0k408_280061_c1
961 nmdc:mga06z11_146653_c1
962 nmdc:mga06z11_192632_c1
963 nmdc:mga07m45_18211_c1
964 nmdc:mga0sz30_3020_c1
965 nmdc:mga0sz30_4062_c1
966 Ga0495601_0011133
967 Ga0495601_0030837
968 Ga0495601_0172742
969 Ga0495612_0029297
970 Ga0500635_0011618
971 Ga0495595_0006080
972 Ga0495595_0034004
973 Ga0495619_0001152
974 Ga0495619_0005951
975 Ga0500644_0134513
976 Ga0500647_0013212
977 Ga0500566_0067400
978 Ga0500554_004228
979 Ga0500595_001168
980 Ga0500608_057362
981 Ga0500614_004534
982 Ga0500559_0057542
983 Ga0500603_003016
984 Ga0500620_203317
985 Ga0500627_0114320
986 Ga0500630_035411
987 Ga0500638_000113
988 Ga0500639_017494
989 Ga0500636_0255017
990 Ga0500637_0006864
991 Ga0500637_0014405
992 Ga0500576_165291
993 Ga0500596_001980
994 Ga0500601_021213
995 Ga0500661_003701
996 2509150363
997 2879112904
998 8056688264

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

79

151

0.93

PF00190

Cupin_1

Cupin

49

163

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bu7-assembly1.cif.gz_B crystal structure and biochemical characterization of gdosp, a gentisate 1,2-dioxygenase from silicibacter pomeroyi 0.9242 80 154
5zbe-assembly1.cif.gz_A crystal structure of aere from microcystis aeruginosa 0.9177 80 158
5jsp-assembly1.cif.gz_A new mechanistic insight from substrate and product bound structures of the metal-dependent dimethylsulfoniopropionate lyase dddq 0.8819 80 167
5wpw-assembly1.cif.gz_A crystal structure of coconut allergen cocosin 0.8786 80 155
5wpw-assembly1.cif.gz_B crystal structure of coconut allergen cocosin 0.8769 80 155
ID Description Score Start End Superfamily
3bu7B00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9242 80 154 2.60.120.10
af_A0A0P0VIM4_38_317_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.904 80 155 2.60.120.10
2h0vB02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8893 80 156 2.60.120.10
af_Q23540_37_144_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8889 62 86 3.10.450.50
3fjsA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8869 63 157 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A6A7L502-F1-model_v4 Cupin domain-containing protein 0.9905 75 166
AF-S9SZC4-F1-model_v4 deleted 0.9843 62 167
AF-J8RTN8-F1-model_v4 deleted 0.9821 82 167
AF-K1W5Y2-F1-model_v4 Cupin 2 domain-containing protein 0.9806 62 165
AF-A0A1F1Q8I5-F1-model_v4 Cupin 0.9796 64 168

Map