F455320

General Info

Members Datasets Scaffolds Average Seq Length
499 215 998 317

Family's Representative Sequence

Representative Sequence 3300005354|Ga0070675_100000442|Ga0070675_10000044218
Length 325
Sequence MPFPYDEFDLSGVRTYPLASRSSKARAEDFGRPFAAGGTFAAWFAALPAMLGAHDLKRAAAAITGARRGGRGVVWGIGAHVIKTGVSPILIDLMERGYVSALAMNGAGIIHDFEIALSGATSEDVDEALGPGRFGMATETAQLNDIIRGGAEAGQGIGQAVGAYLARLDPPHARQSLAATTHRLGIPLTVHVALGTDIIHMHPAASGAAIGEASLRDFRYFTSCVSRLGGGVYLNCGSAVVLPEVFLKAVALSRNQGADLTGLTTVNIDFIRQYRPQTNVVTRPVAGSGTGISLVGHHEILIPLLAAAVVESAQDADQAGRQVGR

Samples

Sample ID Description Type Environment
1 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
137 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
138 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
139 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
140 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
141 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
142 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
143 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
144 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
145 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
146 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
147 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
148 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
149 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
150 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
151 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
152 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
153 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
154 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
155 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
156 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
157 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
158 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
159 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
160 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
161 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
162 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
163 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
164 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
165 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
166 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
167 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
168 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
169 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
170 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
171 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
172 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
173 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
174 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
175 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
176 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
177 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
178 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
179 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
180 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
181 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
182 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
183 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
184 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
185 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
186 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
187 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
192 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
193 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
194 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
195 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
196 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
197 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
198 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
199 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
200 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
201 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
202 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
203 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
204 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
205 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
206 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
207 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
208 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
209 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
210 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
211 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
212 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
213 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
214 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
215 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.8
Rhizosphere 97.8
Stem 0
Stem Tuber 0
Unclassified 11.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070675_100000442 3300005354 Bacteria 28196
2 JGI25406J46586_10000465 3300003203 Bacteria 18917
3 JGI25406J46586_10002916 3300003203 Bacteria 8064
4 Ga0065704_10079688 3300005289 Bacteria 4102
5 Ga0065704_10110376 3300005289 Bacteria 1981
6 Ga0065712_10002522 3300005290 Bacteria 6260
7 Ga0065712_10007861 3300005290 Bacteria 4304
8 Ga0065712_10177599 3300005290 Bacteria 1209
9 Ga0065715_10021617 3300005293 Bacteria 1741
10 Ga0065715_10117202 3300005293 Bacteria 2356
11 Ga0065715_10170075 3300005293 Unclassified 1554
12 Ga0065715_10249518 3300005293 Unclassified 1172
13 Ga0065707_10021332 3300005295 Bacteria 1554
14 Ga0065707_10091694 3300005295 Bacteria 3895
15 Ga0065707_10164966 3300005295 Bacteria 1530
16 Ga0065707_10175498 3300005295 Bacteria 1454
17 Ga0070658_10120926 3300005327 Bacteria 2176
18 Ga0070658_10464624 3300005327 Bacteria 1091
19 Ga0070676_10014230 3300005328 Bacteria 4371
20 Ga0070676_10016943 3300005328 Bacteria 4028
21 Ga0070690_100021540 3300005330 Bacteria 3936
22 Ga0070690_100047854 3300005330 Bacteria 2721
23 Ga0070690_100054859 3300005330 Bacteria 2552
24 Ga0070670_100022128 3300005331 Bacteria 5472
25 Ga0070670_100039674 3300005331 Bacteria 4048
26 Ga0070670_100163325 3300005331 Bacteria 1931
27 Ga0070677_10002092 3300005333 Bacteria 6361
28 Ga0070677_10009315 3300005333 Bacteria 3326
29 Ga0068869_100001962 3300005334 Bacteria 12329
30 Ga0068869_100011307 3300005334 Bacteria 5848
31 Ga0068869_100062553 3300005334 Bacteria 2732
32 Ga0068869_100064450 3300005334 Bacteria 2695
33 Ga0068869_100104933 3300005334 Unclassified 2143
34 Ga0068869_100168506 3300005334 Bacteria 1709
35 Ga0070666_10017256 3300005335 Bacteria 4626
36 Ga0070680_100424690 3300005336 Unclassified 1134
37 Ga0070680_100461976 3300005336 Bacteria 1085
38 Ga0068868_100226021 3300005338 Unclassified 1568
39 Ga0068868_100371318 3300005338 Bacteria 1229
40 Ga0070689_100070760 3300005340 Bacteria 2724
41 Ga0070687_100002540 3300005343 Bacteria 6879
42 Ga0070687_100028925 3300005343 Bacteria 2692
43 Ga0070661_100031171 3300005344 Bacteria 3854
44 Ga0070668_100108782 3300005347 Bacteria 2205
45 Ga0070669_100002290 3300005353 Bacteria 13879
46 Ga0070669_100031895 3300005353 Bacteria 3806
47 Ga0070669_100069701 3300005353 Bacteria 2597
48 Ga0070669_100085517 3300005353 Bacteria 2355
49 Ga0070669_100097356 3300005353 Bacteria 2215
50 Ga0070675_100007840 3300005354 Bacteria 8275
51 Ga0070675_100010670 3300005354 Bacteria 7182
52 Ga0070675_100105351 3300005354 Bacteria 2379
53 Ga0070675_100117661 3300005354 Bacteria 2255
54 Ga0070675_100141243 3300005354 Bacteria 2058
55 Ga0070675_100266801 3300005354 Unclassified 1501
56 Ga0070671_100016297 3300005355 Bacteria 6011
57 Ga0070671_100093110 3300005355 Bacteria 2526
58 Ga0070671_100140123 3300005355 Bacteria 2041
59 Ga0070674_100009647 3300005356 Bacteria 5790
60 Ga0070674_100034144 3300005356 Bacteria 3394
61 Ga0070674_100165482 3300005356 Bacteria 1681
62 Ga0070673_100013283 3300005364 Bacteria 5688
63 Ga0070673_100014822 3300005364 Bacteria 5450
64 Ga0070673_100016109 3300005364 Bacteria 5275
65 Ga0070673_100071281 3300005364 Bacteria 2792
66 Ga0070673_100325612 3300005364 Bacteria 1358
67 Ga0070688_100007809 3300005365 Bacteria 5781
68 Ga0070688_100015562 3300005365 Bacteria 4333
69 Ga0070688_100041175 3300005365 Bacteria 2834
70 Ga0070659_100517110 3300005366 Unclassified 1019
71 Ga0070667_100005998 3300005367 Bacteria 10097
72 Ga0070701_10005603 3300005438 Bacteria 5203
73 Ga0070701_10013002 3300005438 Bacteria 3775
74 Ga0070701_10063071 3300005438 Unclassified 1960
75 Ga0070705_100246810 3300005440 Bacteria 1251
76 Ga0070700_100027941 3300005441 Bacteria 3350
77 Ga0070700_100043093 3300005441 Bacteria 2774
78 Ga0070700_100275030 3300005441 Bacteria 1218
79 Ga0070694_100068801 3300005444 Bacteria 2434
80 Ga0070708_100558030 3300005445 Bacteria 1080
81 Ga0070708_100597406 3300005445 Bacteria 1040
82 Ga0070678_100139590 3300005456 Bacteria 1937
83 Ga0070678_100228959 3300005456 Bacteria 1548
84 Ga0070678_100268098 3300005456 Bacteria 1439
85 Ga0070678_100352130 3300005456 Unclassified 1266
86 Ga0070662_100022331 3300005457 Bacteria 4331
87 Ga0070662_100034248 3300005457 Bacteria 3580
88 Ga0070681_10131949 3300005458 Unclassified 2430
89 Ga0068867_100011667 3300005459 Bacteria 6206
90 Ga0068867_100088321 3300005459 Bacteria 2349
91 Ga0070685_10006409 3300005466 Bacteria 6000
92 Ga0070685_10065486 3300005466 Bacteria 2139
93 Ga0070707_100071484 3300005468 Bacteria 3343
94 Ga0070707_100310054 3300005468 Bacteria 1534
95 Ga0070698_100306389 3300005471 Bacteria 1519
96 Ga0070698_100365649 3300005471 Bacteria 1375
97 Ga0070699_100057921 3300005518 Bacteria 3355
98 Ga0070684_100126110 3300005535 Bacteria 2306
99 Ga0070672_100019818 3300005543 Bacteria 4892
100 Ga0070672_100031161 3300005543 Bacteria 4012
101 Ga0070672_100102169 3300005543 Bacteria 2327
102 Ga0070672_100168278 3300005543 Bacteria 1822
103 Ga0070686_100022473 3300005544 Bacteria 3757
104 Ga0070686_100028971 3300005544 Bacteria 3362
105 Ga0070686_100091694 3300005544 Bacteria 2033
106 Ga0070686_100222837 3300005544 Bacteria 1364
107 Ga0070695_100079598 3300005545 Bacteria 2163
108 Ga0070696_100062351 3300005546 Bacteria 2609
109 Ga0070696_100189390 3300005546 Bacteria 1530
110 Ga0070693_100232557 3300005547 Bacteria 1213
111 Ga0070665_100357734 3300005548 Unclassified 1466
112 Ga0070704_100000802 3300005549 Bacteria 15581
113 Ga0070664_100003297 3300005564 Bacteria 13037
114 Ga0070664_100027878 3300005564 Bacteria 4697
115 Ga0070664_100041231 3300005564 Bacteria 3894
116 Ga0070664_100624649 3300005564 Bacteria 1000
117 Ga0068857_100036913 3300005577 Bacteria 4328
118 Ga0068857_100043393 3300005577 Bacteria 3989
119 Ga0068857_100050680 3300005577 Bacteria 3682
120 Ga0068852_100057233 3300005616 Bacteria 3373
121 Ga0068852_100620432 3300005616 Bacteria 1087
122 Ga0068859_100008626 3300005617 Bacteria 10300
123 Ga0068859_100022260 3300005617 Bacteria 6355
124 Ga0068859_100023787 3300005617 Bacteria 6148
125 Ga0068859_100051140 3300005617 Bacteria 4152
126 Ga0068859_100101088 3300005617 Bacteria 2940
127 Ga0068859_100238562 3300005617 Bacteria 1907
128 Ga0068864_100034591 3300005618 Unclassified 4298
129 Ga0068866_10019415 3300005718 Bacteria 3094
130 Ga0068861_100001024 3300005719 Bacteria 17105
131 Ga0068861_100006615 3300005719 Bacteria 7910
132 Ga0068861_100074454 3300005719 Bacteria 2641
133 Ga0068861_100078034 3300005719 Unclassified 2585
134 Ga0068861_100130997 3300005719 Unclassified 2036
135 Ga0068861_100247864 3300005719 Unclassified 1518
136 Ga0068861_100493396 3300005719 Bacteria 1105
137 Ga0068851_10007003 3300005834 Bacteria 5170
138 Ga0068870_10012140 3300005840 Bacteria 4017
139 Ga0068870_10052433 3300005840 Unclassified 2163
140 Ga0068863_100243308 3300005841 Bacteria 1737
141 Ga0068858_100091954 3300005842 Bacteria 2824
142 Ga0068860_100041763 3300005843 Bacteria 4381
143 Ga0068860_100064914 3300005843 Bacteria 3466
144 Ga0068862_100002475 3300005844 Bacteria 16354
145 Ga0068862_100039487 3300005844 Bacteria 4009
146 Ga0068862_100156207 3300005844 Bacteria 2034
147 Ga0068862_100325672 3300005844 Unclassified 1419
148 Ga0081455_10238106 3300005937 Unclassified 1339
149 Ga0081539_10000025 3300005985 Bacteria 340255
150 Ga0081539_10000134 3300005985 Bacteria 173625
151 Ga0081539_10004230 3300005985 Bacteria 16158
152 Ga0070716_100191666 3300006173 Bacteria 1351
153 Ga0097621_100065832 3300006237 Bacteria 2984
154 Ga0097621_100351618 3300006237 Bacteria 1311
155 Ga0097621_100379033 3300006237 Bacteria 1263
156 Ga0075428_100002473 3300006844 Bacteria 20060
157 Ga0075428_100003003 3300006844 Bacteria 18414
158 Ga0075428_100008180 3300006844 Bacteria 11605
159 Ga0075428_100019149 3300006844 Bacteria 7570
160 Ga0075428_100037322 3300006844 Bacteria 5350
161 Ga0075430_100028153 3300006846 Unclassified 4774
162 Ga0075430_100107463 3300006846 Bacteria 2327
163 Ga0075430_100152278 3300006846 Bacteria 1926
164 Ga0075430_100221746 3300006846 Bacteria 1569
165 Ga0075430_100362215 3300006846 Bacteria 1197
166 Ga0075431_100003295 3300006847 Bacteria 15633
167 Ga0075431_100008820 3300006847 Bacteria 10104
168 Ga0075431_100033919 3300006847 Bacteria 5260
169 Ga0075431_100060435 3300006847 Bacteria 3910
170 Ga0075433_10003019 3300006852 Bacteria 12931
171 Ga0075433_10012093 3300006852 Bacteria 6963
172 Ga0075433_10013291 3300006852 Bacteria 6690
173 Ga0075433_10027549 3300006852 Bacteria 4821
174 Ga0075433_10029013 3300006852 Bacteria 4709
175 Ga0075434_100015935 3300006871 Bacteria 7221
176 Ga0075434_100020372 3300006871 Bacteria 6432
177 Ga0075434_100138269 3300006871 Bacteria 2455
178 Ga0075434_100278387 3300006871 Bacteria 1693
179 Ga0075434_100284624 3300006871 Bacteria 1673
180 Ga0075434_100558176 3300006871 Bacteria 1165
181 Ga0075429_100016401 3300006880 Bacteria 6421
182 Ga0075429_100043886 3300006880 Unclassified 3889
183 Ga0075429_100190598 3300006880 Bacteria 1796
184 Ga0075429_100203987 3300006880 Bacteria 1732
185 Ga0075429_100296433 3300006880 Bacteria 1416
186 Ga0068865_100014570 3300006881 Bacteria 4999
187 Ga0068865_100073769 3300006881 Unclassified 2428
188 Ga0068865_100136926 3300006881 Bacteria 1841
189 Ga0068865_100227105 3300006881 Bacteria 1463
190 Ga0097620_100008626 3300006931 Bacteria 10300
191 Ga0097620_100022260 3300006931 Bacteria 6355
192 Ga0097620_100023790 3300006931 Bacteria 6148
193 Ga0097620_100051142 3300006931 Bacteria 4152
194 Ga0097620_100101089 3300006931 Bacteria 2940
195 Ga0097620_100238574 3300006931 Bacteria 1907
196 Ga0075435_100039531 3300007076 Bacteria 3765
197 Ga0111539_10002468 3300009094 Bacteria 24543
198 Ga0111539_10003084 3300009094 Bacteria 22086
199 Ga0111539_10005838 3300009094 Bacteria 15917
200 Ga0111539_10010233 3300009094 Bacteria 11819
201 Ga0111539_10040665 3300009094 Bacteria 5595
202 Ga0111539_10131612 3300009094 Bacteria 2929
203 Ga0111539_10229992 3300009094 Bacteria 2159
204 Ga0111539_10366267 3300009094 Bacteria 1678
205 Ga0111539_10569964 3300009094 Bacteria 1319
206 Ga0111539_10803260 3300009094 Bacteria 1095
207 Ga0114129_10001790 3300009147 Bacteria 29271
208 Ga0114129_10008510 3300009147 Bacteria 14623
209 Ga0114129_10059316 3300009147 Bacteria 5351
210 Ga0114129_10085383 3300009147 Bacteria 4379
211 Ga0114129_10187729 3300009147 Unclassified 2808
212 Ga0114129_10244551 3300009147 Unclassified 2411
213 Ga0114129_10265800 3300009147 Bacteria 2297
214 Ga0114129_10552703 3300009147 Bacteria 1497
215 Ga0105243_10020673 3300009148 Unclassified 4992
216 Ga0105242_10501348 3300009176 Bacteria 1155
217 Ga0105248_10385818 3300009177 Unclassified 1577
218 Ga0105248_10409834 3300009177 Bacteria 1526
219 Ga0105248_10549984 3300009177 Bacteria 1302
220 Ga0105238_10013174 3300009551 Bacteria 8346
221 Ga0105249_10006792 3300009553 Bacteria 9971
222 Ga0105249_10035784 3300009553 Bacteria 4502
223 Ga0105239_10079099 3300010375 Bacteria 3618
224 Ga0105246_10013769 3300011119 Bacteria 5075
225 Ga0105246_10232585 3300011119 Bacteria 1452
226 Ga0105246_10421836 3300011119 Unclassified 1114
227 Ga0157374_10474598 3300013296 Unclassified 1254
228 Ga0157375_10006844 3300013308 Bacteria 9934
229 Ga0157375_10074727 3300013308 Bacteria 3411
230 Ga0163163_10023059 3300014325 Bacteria 5902
231 Ga0163163_10674138 3300014325 Bacteria 1097
232 Ga0157380_10006697 3300014326 Bacteria 8137
233 Ga0157380_10012867 3300014326 Bacteria 6081
234 Ga0157380_10025095 3300014326 Bacteria 4518
235 Ga0157380_10026749 3300014326 Unclassified 4383
236 Ga0157380_10053252 3300014326 Bacteria 3207
237 Ga0157380_10073103 3300014326 Bacteria 2779
238 Ga0157380_10107998 3300014326 Unclassified 2332
239 Ga0157377_10107764 3300014745 Bacteria 1670
240 Ga0157377_10148726 3300014745 Bacteria 1446
241 Ga0163161_10028656 3300017792 Bacteria 3954
242 Ga0163161_10162022 3300017792 Bacteria 1706
243 Ga0207697_10104679 3300025315 Bacteria 1209
244 Ga0207656_10008714 3300025321 Unclassified 3746
245 Ga0207653_10022417 3300025885 Bacteria 2006
246 Ga0207682_10000435 3300025893 Bacteria 19326
247 Ga0207682_10022053 3300025893 Bacteria 2507
248 Ga0207642_10025409 3300025899 Bacteria 2396
249 Ga0207642_10259875 3300025899 Bacteria 989
250 Ga0207688_10000078 3300025901 Bacteria 37290
251 Ga0207645_10007659 3300025907 Bacteria 7609
252 Ga0207645_10009550 3300025907 Bacteria 6704
253 Ga0207645_10026200 3300025907 Bacteria 3769
254 Ga0207643_10004404 3300025908 Bacteria 7575
255 Ga0207643_10008469 3300025908 Bacteria 5517
256 Ga0207643_10026560 3300025908 Bacteria 3205
257 Ga0207643_10106161 3300025908 Bacteria 1651
258 Ga0207643_10108209 3300025908 Unclassified 1635
259 Ga0207705_10371745 3300025909 Bacteria 1103
260 Ga0207660_10130779 3300025917 Unclassified 1910
261 Ga0207662_10002394 3300025918 Bacteria 9405
262 Ga0207662_10042401 3300025918 Bacteria 2682
263 Ga0207662_10100314 3300025918 Bacteria 1793
264 Ga0207649_10151071 3300025920 Unclassified 1600
265 Ga0207681_10000705 3300025923 Bacteria 21963
266 Ga0207681_10048283 3300025923 Unclassified 2872
267 Ga0207681_10097595 3300025923 Bacteria 2112
268 Ga0207694_10013195 3300025924 Bacteria 6221
269 Ga0207650_10011683 3300025925 Bacteria 6050
270 Ga0207650_10045974 3300025925 Bacteria 3213
271 Ga0207659_10000501 3300025926 Bacteria 23548
272 Ga0207659_10017311 3300025926 Bacteria 4707
273 Ga0207659_10027839 3300025926 Bacteria 3832
274 Ga0207659_10052085 3300025926 Bacteria 2914
275 Ga0207659_10055964 3300025926 Bacteria 2823
276 Ga0207659_10106021 3300025926 Bacteria 2127
277 Ga0207659_10149645 3300025926 Bacteria 1822
278 Ga0207659_10334674 3300025926 Bacteria 1253
279 Ga0207700_10401386 3300025928 Bacteria 1201
280 Ga0207644_10016272 3300025931 Bacteria 5004
281 Ga0207644_10070438 3300025931 Bacteria 2556
282 Ga0207644_10209851 3300025931 Unclassified 1539
283 Ga0207690_10235600 3300025932 Bacteria 1407
284 Ga0207706_10002635 3300025933 Bacteria 17477
285 Ga0207706_10025098 3300025933 Bacteria 5343
286 Ga0207706_10110094 3300025933 Bacteria 2423
287 Ga0207686_10025434 3300025934 Bacteria 3443
288 Ga0207709_10011959 3300025935 Bacteria 4786
289 Ga0207670_10035677 3300025936 Bacteria 3227
290 Ga0207669_10000612 3300025937 Bacteria 15519
291 Ga0207669_10076046 3300025937 Bacteria 2130
292 Ga0207669_10190443 3300025937 Bacteria 1479
293 Ga0207704_10007425 3300025938 Bacteria 5178
294 Ga0207704_10210281 3300025938 Unclassified 1431
295 Ga0207665_10074534 3300025939 Bacteria 2323
296 Ga0207691_10006693 3300025940 Bacteria 11117
297 Ga0207691_10031971 3300025940 Bacteria 4910
298 Ga0207691_10067023 3300025940 Bacteria 3246
299 Ga0207691_10111082 3300025940 Bacteria 2437
300 Ga0207691_10298317 3300025940 Bacteria 1385
301 Ga0207691_10357837 3300025940 Bacteria 1248
302 Ga0207711_10024157 3300025941 Bacteria 5088
303 Ga0207711_10320229 3300025941 Bacteria 1433
304 Ga0207689_10002929 3300025942 Bacteria 15757
305 Ga0207689_10004769 3300025942 Bacteria 12231
306 Ga0207689_10079036 3300025942 Bacteria 2703
307 Ga0207689_10150789 3300025942 Bacteria 1916
308 Ga0207679_10002511 3300025945 Bacteria 11305
309 Ga0207679_10002916 3300025945 Bacteria 10600
310 Ga0207679_10006483 3300025945 Bacteria 7401
311 Ga0207679_10181769 3300025945 Bacteria 1740
312 Ga0207679_10266769 3300025945 Bacteria 1462
313 Ga0207651_10009582 3300025960 Bacteria 5314
314 Ga0207651_10035357 3300025960 Bacteria 3247
315 Ga0207651_10074175 3300025960 Bacteria 2422
316 Ga0207651_10282538 3300025960 Bacteria 1372
317 Ga0207712_10072877 3300025961 Unclassified 2475
318 Ga0207668_10026488 3300025972 Bacteria 3765
319 Ga0207668_10253810 3300025972 Bacteria 1430
320 Ga0207668_10501368 3300025972 Bacteria 1044
321 Ga0207658_10199680 3300025986 Bacteria 1669
322 Ga0207677_10051208 3300026023 Bacteria 2798
323 Ga0207677_10205771 3300026023 Bacteria 1568
324 Ga0207677_10293777 3300026023 Unclassified 1340
325 Ga0207708_10021277 3300026075 Bacteria 4890
326 Ga0207708_10034140 3300026075 Bacteria 3868
327 Ga0207708_10040549 3300026075 Bacteria 3549
328 Ga0207641_10187869 3300026088 Bacteria 1897
329 Ga0207648_10003537 3300026089 Bacteria 16338
330 Ga0207648_10006736 3300026089 Bacteria 11394
331 Ga0207648_10080603 3300026089 Bacteria 2840
332 Ga0207648_10109663 3300026089 Bacteria 2423
333 Ga0207648_10129950 3300026089 Unclassified 2217
334 Ga0207676_10088663 3300026095 Bacteria 2533
335 Ga0207676_10468062 3300026095 Bacteria 1191
336 Ga0207674_10023097 3300026116 Bacteria 6669
337 Ga0207674_10070752 3300026116 Bacteria 3507
338 Ga0207674_10186467 3300026116 Unclassified 2025
339 Ga0207675_100002780 3300026118 Bacteria 17190
340 Ga0207675_100007450 3300026118 Bacteria 10340
341 Ga0207675_100050142 3300026118 Bacteria 3895
342 Ga0207675_100205366 3300026118 Bacteria 1893
343 Ga0207683_10044089 3300026121 Bacteria 3899
344 Ga0207683_10064595 3300026121 Bacteria 3225
345 Ga0207683_10417180 3300026121 Bacteria 1236
346 Ga0207683_10450370 3300026121 Unclassified 1187
347 Ga0207698_10637126 3300026142 Bacteria 1054
348 Ga0207428_10000089 3300027907 Bacteria 127333
349 Ga0207428_10005347 3300027907 Bacteria 11972
350 Ga0207428_10011329 3300027907 Bacteria 7886
351 Ga0207428_10031883 3300027907 Bacteria 4340
352 Ga0268266_10165388 3300028379 Bacteria 2004
353 Ga0268265_10000714 3300028380 Bacteria 32686
354 Ga0268265_10641288 3300028380 Bacteria 1020
355 Ga0268264_10034904 3300028381 Bacteria 4140
356 Ga0268264_10596659 3300028381 Bacteria 1088
357 Ga0307408_100127650 3300031548 Unclassified 1980
358 Ga0307405_10000743 3300031731 Bacteria 12676
359 Ga0307405_10256490 3300031731 Bacteria 1304
360 Ga0307410_10048094 3300031852 Bacteria 2854
361 Ga0307406_10007061 3300031901 Bacteria 6217
362 Ga0307407_10201738 3300031903 Bacteria 1333
363 Ga0307409_100087398 3300031995 Bacteria 2541
364 Ga0307409_100573670 3300031995 Bacteria 1111
365 Ga0307416_100001310 3300032002 Bacteria 13407
366 Ga0307416_100186096 3300032002 Bacteria 1952
367 Ga0307415_100060338 3300032126 Bacteria 2620
368 Ga0373961_0034289 3300035241 Unclassified 1434
369 Ga0373935_0015012 3300035692 Bacteria 4677
370 Ga0373947_0313128 3300035725 Bacteria 1048
371 Ga0373937_0002907 3300036401 Bacteria 14312
372 Ga0373937_0014854 3300036401 Bacteria 6878
373 Ga0316584_0044526 3300036712 Bacteria 3309
374 Ga0373925_0101729 3300037068 Bacteria 2210
375 Ga0400484_35595 3300038725 Unclassified 3872
376 Ga0400490_51901 3300038726 Bacteria 1793
377 Ga0400486_19183 3300038742 Bacteria 38070
378 Ga0400486_25181 3300038742 Bacteria 17444
379 Ga0400486_28324 3300038742 Bacteria 11278
380 Ga0400489_43016 3300039093 Bacteria 54279
381 Ga0400487_58377 3300039110 Unclassified 3628
382 Ga0451807_1227182 3300041486 Bacteria 1157
383 Ga0450895_000862 3300042132 Bacteria 1938
384 Ga0450896_006127 3300042133 Bacteria 1646
385 Ga0450898_009299 3300042134 Bacteria 1570
386 Ga0450918_011613 3300042531 Bacteria 1534
387 Ga0451577_0044804 3300042876 Bacteria 3960
388 Ga0453684_0023641 3300044712 Bacteria 9032
389 Ga0451576_0013194 3300045051 Bacteria 9246
390 Ga0451576_0273849 3300045051 Bacteria 1765
391 Ga0451576_0280353 3300045051 Bacteria 1742
392 Ga0495592_0006832 3300046454 Bacteria 8520
393 Ga0495580_0034632 3300046472 Unclassified 3635
394 Ga0495584_0127198 3300046491 Bacteria 1292
395 Ga0495594_0195717 3300046499 Unclassified 1152
396 Ga0495628_0024658 3300046516 Unclassified 4920
397 Ga0495652_0151402 3300046529 Bacteria 1812
398 Ga0495640_0080332 3300046533 Bacteria 2169
399 Ga0495587_0034225 3300046536 Bacteria 3065
400 Ga0495645_0070323 3300046543 Bacteria 2526
401 Ga0495633_0049423 3300046558 Bacteria 1985
402 Ga0495656_0063624 3300046615 Bacteria 1618
403 Ga0495634_0129067 3300046642 Bacteria 1613
404 Ga0495659_0008128 3300046664 Bacteria 3335
405 Ga0495659_0027164 3300046664 Bacteria 1972
406 Ga0495659_0038489 3300046664 Bacteria 1698
407 Ga0495659_0069544 3300046664 Bacteria 1317
408 Ga0495658_0072515 3300046683 Unclassified 2003
409 Ga0495658_0173018 3300046683 Bacteria 1337
410 Ga0495669_0000968 3300046684 Bacteria 11985
411 Ga0495669_0137235 3300046684 Bacteria 1153
412 Ga0495613_0003466 3300046689 Bacteria 11799
413 Ga0495613_0204948 3300046689 Unclassified 1389
414 Ga0495604_0043185 3300047317 Unclassified 3530
415 Ga0495636_0070294 3300047318 Unclassified 1493
416 Ga0495674_0012800 3300047319 Bacteria 7900
417 Ga0495675_0125609 3300047444 Bacteria 1596
418 Ga0495684_0000704 3300047471 Bacteria 26850
419 Ga0495684_0299418 3300047471 Bacteria 1156
420 Ga0496104_0131530 3300048907 Bacteria 2404
421 Ga0496106_0215531 3300048909 Bacteria 1530
422 Ga0496112_0165451 3300048915 Bacteria 2178
423 Ga0501040_0012043 3300049576 Bacteria 5660
424 Ga0501040_0090021 3300049576 Bacteria 2132
425 Ga0501040_0129075 3300049576 Bacteria 1777
426 Ga0501042_0012246 3300049578 Bacteria 5805
427 Ga0501046_0160097 3300049580 Bacteria 1694
428 Ga0501048_0056902 3300049582 Bacteria 2774
429 Ga0501048_0209769 3300049582 Bacteria 1382
430 Ga0501067_0084194 3300049583 Unclassified 1764
431 Ga0501071_0406664 3300049587 Bacteria 1039
432 Ga0501072_0013128 3300049588 Bacteria 6340
433 Ga0501074_0036794 3300049590 Bacteria 3546
434 Ga0501074_0158762 3300049590 Bacteria 1615
435 Ga0501075_0081182 3300049591 Bacteria 2455
436 Ga0501075_0092936 3300049591 Bacteria 2290
437 Ga0501076_0039331 3300049592 Bacteria 3713
438 Ga0501076_0217205 3300049592 Bacteria 1563
439 Ga0501076_0324802 3300049592 Bacteria 1262
440 Ga0501076_0349656 3300049592 Bacteria 1214
441 Ga0501249_012281 3300049679 Unclassified 1809
442 Ga0501079_0030598 3300049741 Bacteria 4137
443 Ga0501079_0108548 3300049741 Bacteria 2155
444 Ga0501081_0096967 3300049743 Bacteria 2080
445 Ga0501083_0184659 3300049744 Bacteria 1361
446 nmdc:mga05p37_113343_c1 3300050507 Bacteria 3334
447 nmdc:mga05p37_159344_c1 3300050507 Bacteria 2757
448 nmdc:mga05p37_17477_c1 3300050507 Bacteria 8657
449 nmdc:mga05p37_3921_c1 3300050507 Bacteria 17427
450 nmdc:mga05p37_439060_c1 3300050507 Bacteria 1187
451 nmdc:mga05p37_53569_c1 3300050507 Bacteria 4962
452 nmdc:mga09592_129562_c1 3300050508 Unclassified 2170
453 nmdc:mga09592_172669_c1 3300050508 Bacteria 1869
454 nmdc:mga09592_1848_c1 3300050508 Bacteria 17028
455 nmdc:mga09592_188859_c1 3300050508 Unclassified 1783
456 nmdc:mga09592_222308_c1 3300050508 Bacteria 1636
457 nmdc:mga09592_41355_c1 3300050508 Bacteria 3876
458 nmdc:mga09592_46807_c1 3300050508 Bacteria 3644
459 nmdc:mga0qj67_108164_c1 3300050509 Bacteria 2243
460 nmdc:mga0qj67_15984_c1 3300050509 Bacteria 5682
461 nmdc:mga0qj67_193313_c1 3300050509 Unclassified 1653
462 nmdc:mga0qj67_33028_c1 3300050509 Bacteria 4037
463 nmdc:mga0qj67_335621_c1 3300050509 Bacteria 1223
464 nmdc:mga0qj67_6091_c1 3300050509 Bacteria 8836
465 nmdc:mga06r32_19287_c1 3300050510 Bacteria 6259
466 nmdc:mga06r32_26369_c1 3300050510 Bacteria 5417
467 nmdc:mga06r32_66308_c1 3300050510 Bacteria 3483
468 nmdc:mga08y16_174816_c1 3300050511 Bacteria 2230
469 nmdc:mga08y16_181625_c1 3300050511 Bacteria 2185
470 nmdc:mga08y16_18198_c1 3300050511 Bacteria 7403
471 nmdc:mga08y16_39574_c1 3300050511 Bacteria 4947
472 nmdc:mga08y16_401135_c1 3300050511 Bacteria 1403
473 nmdc:mga08y16_592545_c1 3300050511 Bacteria 1118
474 nmdc:mga08y16_9269_c1 3300050511 Bacteria 10329
475 nmdc:mga0n895_10695_c1 3300050512 Bacteria 8129
476 nmdc:mga0n895_13016_c1 3300050512 Bacteria 7484
477 nmdc:mga0n895_21159_c1 3300050512 Bacteria 6079
478 nmdc:mga0n895_290237_c1 3300050512 Bacteria 1658
479 nmdc:mga0n895_373787_c1 3300050512 Bacteria 1443
480 nmdc:mga0n895_465227_c1 3300050512 Bacteria 1276
481 nmdc:mga0n895_88512_c1 3300050512 Bacteria 3096
482 nmdc:mga0a205_1412_c1 3300050515 Bacteria 20378
483 nmdc:mga0a205_20365_c1 3300050515 Bacteria 6257
484 nmdc:mga0a205_2312_c1 3300050515 Bacteria 16823
485 nmdc:mga0a205_3073_c1 3300050515 Bacteria 14819
486 nmdc:mga0a205_310158_c1 3300050515 Bacteria 1450
487 nmdc:mga0a205_431734_c1 3300050515 Bacteria 1179
488 Ga0495601_0000588 3300053077 Bacteria 19344
489 Ga0495619_0005871 3300053085 Bacteria 7779
490 Ga0501084_0040715 3300054114 Unclassified 3888
491 Ga0501084_0064121 3300054114 Bacteria 3075
492 Ga0590071_000536 3300059421 Bacteria 11104
493 Ga0590071_001935 3300059421 Bacteria 5300
494 Ga0590074_000230 3300059423 Bacteria 7376
495 Ga0590074_005464 3300059423 Bacteria 2104
496 Ga0590075_000650 3300059424 Bacteria 9239
497 Ga0590077_000038 3300059426 Bacteria 30540
498 Ga0590077_001194 3300059426 Bacteria 6302
499 Ga0530510_0012415 3300061734 Bacteria 5985
500 Ga0070675_100000442
501 JGI25406J46586_10000465
502 JGI25406J46586_10002916
503 Ga0065704_10079688
504 Ga0065704_10110376
505 Ga0065712_10002522
506 Ga0065712_10007861
507 Ga0065712_10177599
508 Ga0065715_10021617
509 Ga0065715_10117202
510 Ga0065715_10170075
511 Ga0065715_10249518
512 Ga0065707_10021332
513 Ga0065707_10091694
514 Ga0065707_10164966
515 Ga0065707_10175498
516 Ga0070658_10120926
517 Ga0070658_10464624
518 Ga0070676_10014230
519 Ga0070676_10016943
520 Ga0070690_100021540
521 Ga0070690_100047854
522 Ga0070690_100054859
523 Ga0070670_100022128
524 Ga0070670_100039674
525 Ga0070670_100163325
526 Ga0070677_10002092
527 Ga0070677_10009315
528 Ga0068869_100001962
529 Ga0068869_100011307
530 Ga0068869_100062553
531 Ga0068869_100064450
532 Ga0068869_100104933
533 Ga0068869_100168506
534 Ga0070666_10017256
535 Ga0070680_100424690
536 Ga0070680_100461976
537 Ga0068868_100226021
538 Ga0068868_100371318
539 Ga0070689_100070760
540 Ga0070687_100002540
541 Ga0070687_100028925
542 Ga0070661_100031171
543 Ga0070668_100108782
544 Ga0070669_100002290
545 Ga0070669_100031895
546 Ga0070669_100069701
547 Ga0070669_100085517
548 Ga0070669_100097356
549 Ga0070675_100007840
550 Ga0070675_100010670
551 Ga0070675_100105351
552 Ga0070675_100117661
553 Ga0070675_100141243
554 Ga0070675_100266801
555 Ga0070671_100016297
556 Ga0070671_100093110
557 Ga0070671_100140123
558 Ga0070674_100009647
559 Ga0070674_100034144
560 Ga0070674_100165482
561 Ga0070673_100013283
562 Ga0070673_100014822
563 Ga0070673_100016109
564 Ga0070673_100071281
565 Ga0070673_100325612
566 Ga0070688_100007809
567 Ga0070688_100015562
568 Ga0070688_100041175
569 Ga0070659_100517110
570 Ga0070667_100005998
571 Ga0070701_10005603
572 Ga0070701_10013002
573 Ga0070701_10063071
574 Ga0070705_100246810
575 Ga0070700_100027941
576 Ga0070700_100043093
577 Ga0070700_100275030
578 Ga0070694_100068801
579 Ga0070708_100558030
580 Ga0070708_100597406
581 Ga0070678_100139590
582 Ga0070678_100228959
583 Ga0070678_100268098
584 Ga0070678_100352130
585 Ga0070662_100022331
586 Ga0070662_100034248
587 Ga0070681_10131949
588 Ga0068867_100011667
589 Ga0068867_100088321
590 Ga0070685_10006409
591 Ga0070685_10065486
592 Ga0070707_100071484
593 Ga0070707_100310054
594 Ga0070698_100306389
595 Ga0070698_100365649
596 Ga0070699_100057921
597 Ga0070684_100126110
598 Ga0070672_100019818
599 Ga0070672_100031161
600 Ga0070672_100102169
601 Ga0070672_100168278
602 Ga0070686_100022473
603 Ga0070686_100028971
604 Ga0070686_100091694
605 Ga0070686_100222837
606 Ga0070695_100079598
607 Ga0070696_100062351
608 Ga0070696_100189390
609 Ga0070693_100232557
610 Ga0070665_100357734
611 Ga0070704_100000802
612 Ga0070664_100003297
613 Ga0070664_100027878
614 Ga0070664_100041231
615 Ga0070664_100624649
616 Ga0068857_100036913
617 Ga0068857_100043393
618 Ga0068857_100050680
619 Ga0068852_100057233
620 Ga0068852_100620432
621 Ga0068859_100008626
622 Ga0068859_100022260
623 Ga0068859_100023787
624 Ga0068859_100051140
625 Ga0068859_100101088
626 Ga0068859_100238562
627 Ga0068864_100034591
628 Ga0068866_10019415
629 Ga0068861_100001024
630 Ga0068861_100006615
631 Ga0068861_100074454
632 Ga0068861_100078034
633 Ga0068861_100130997
634 Ga0068861_100247864
635 Ga0068861_100493396
636 Ga0068851_10007003
637 Ga0068870_10012140
638 Ga0068870_10052433
639 Ga0068863_100243308
640 Ga0068858_100091954
641 Ga0068860_100041763
642 Ga0068860_100064914
643 Ga0068862_100002475
644 Ga0068862_100039487
645 Ga0068862_100156207
646 Ga0068862_100325672
647 Ga0081455_10238106
648 Ga0081539_10000025
649 Ga0081539_10000134
650 Ga0081539_10004230
651 Ga0070716_100191666
652 Ga0097621_100065832
653 Ga0097621_100351618
654 Ga0097621_100379033
655 Ga0075428_100002473
656 Ga0075428_100003003
657 Ga0075428_100008180
658 Ga0075428_100019149
659 Ga0075428_100037322
660 Ga0075430_100028153
661 Ga0075430_100107463
662 Ga0075430_100152278
663 Ga0075430_100221746
664 Ga0075430_100362215
665 Ga0075431_100003295
666 Ga0075431_100008820
667 Ga0075431_100033919
668 Ga0075431_100060435
669 Ga0075433_10003019
670 Ga0075433_10012093
671 Ga0075433_10013291
672 Ga0075433_10027549
673 Ga0075433_10029013
674 Ga0075434_100015935
675 Ga0075434_100020372
676 Ga0075434_100138269
677 Ga0075434_100278387
678 Ga0075434_100284624
679 Ga0075434_100558176
680 Ga0075429_100016401
681 Ga0075429_100043886
682 Ga0075429_100190598
683 Ga0075429_100203987
684 Ga0075429_100296433
685 Ga0068865_100014570
686 Ga0068865_100073769
687 Ga0068865_100136926
688 Ga0068865_100227105
689 Ga0097620_100008626
690 Ga0097620_100022260
691 Ga0097620_100023790
692 Ga0097620_100051142
693 Ga0097620_100101089
694 Ga0097620_100238574
695 Ga0075435_100039531
696 Ga0111539_10002468
697 Ga0111539_10003084
698 Ga0111539_10005838
699 Ga0111539_10010233
700 Ga0111539_10040665
701 Ga0111539_10131612
702 Ga0111539_10229992
703 Ga0111539_10366267
704 Ga0111539_10569964
705 Ga0111539_10803260
706 Ga0114129_10001790
707 Ga0114129_10008510
708 Ga0114129_10059316
709 Ga0114129_10085383
710 Ga0114129_10187729
711 Ga0114129_10244551
712 Ga0114129_10265800
713 Ga0114129_10552703
714 Ga0105243_10020673
715 Ga0105242_10501348
716 Ga0105248_10385818
717 Ga0105248_10409834
718 Ga0105248_10549984
719 Ga0105238_10013174
720 Ga0105249_10006792
721 Ga0105249_10035784
722 Ga0105239_10079099
723 Ga0105246_10013769
724 Ga0105246_10232585
725 Ga0105246_10421836
726 Ga0157374_10474598
727 Ga0157375_10006844
728 Ga0157375_10074727
729 Ga0163163_10023059
730 Ga0163163_10674138
731 Ga0157380_10006697
732 Ga0157380_10012867
733 Ga0157380_10025095
734 Ga0157380_10026749
735 Ga0157380_10053252
736 Ga0157380_10073103
737 Ga0157380_10107998
738 Ga0157377_10107764
739 Ga0157377_10148726
740 Ga0163161_10028656
741 Ga0163161_10162022
742 Ga0207697_10104679
743 Ga0207656_10008714
744 Ga0207653_10022417
745 Ga0207682_10000435
746 Ga0207682_10022053
747 Ga0207642_10025409
748 Ga0207642_10259875
749 Ga0207688_10000078
750 Ga0207645_10007659
751 Ga0207645_10009550
752 Ga0207645_10026200
753 Ga0207643_10004404
754 Ga0207643_10008469
755 Ga0207643_10026560
756 Ga0207643_10106161
757 Ga0207643_10108209
758 Ga0207705_10371745
759 Ga0207660_10130779
760 Ga0207662_10002394
761 Ga0207662_10042401
762 Ga0207662_10100314
763 Ga0207649_10151071
764 Ga0207681_10000705
765 Ga0207681_10048283
766 Ga0207681_10097595
767 Ga0207694_10013195
768 Ga0207650_10011683
769 Ga0207650_10045974
770 Ga0207659_10000501
771 Ga0207659_10017311
772 Ga0207659_10027839
773 Ga0207659_10052085
774 Ga0207659_10055964
775 Ga0207659_10106021
776 Ga0207659_10149645
777 Ga0207659_10334674
778 Ga0207700_10401386
779 Ga0207644_10016272
780 Ga0207644_10070438
781 Ga0207644_10209851
782 Ga0207690_10235600
783 Ga0207706_10002635
784 Ga0207706_10025098
785 Ga0207706_10110094
786 Ga0207686_10025434
787 Ga0207709_10011959
788 Ga0207670_10035677
789 Ga0207669_10000612
790 Ga0207669_10076046
791 Ga0207669_10190443
792 Ga0207704_10007425
793 Ga0207704_10210281
794 Ga0207665_10074534
795 Ga0207691_10006693
796 Ga0207691_10031971
797 Ga0207691_10067023
798 Ga0207691_10111082
799 Ga0207691_10298317
800 Ga0207691_10357837
801 Ga0207711_10024157
802 Ga0207711_10320229
803 Ga0207689_10002929
804 Ga0207689_10004769
805 Ga0207689_10079036
806 Ga0207689_10150789
807 Ga0207679_10002511
808 Ga0207679_10002916
809 Ga0207679_10006483
810 Ga0207679_10181769
811 Ga0207679_10266769
812 Ga0207651_10009582
813 Ga0207651_10035357
814 Ga0207651_10074175
815 Ga0207651_10282538
816 Ga0207712_10072877
817 Ga0207668_10026488
818 Ga0207668_10253810
819 Ga0207668_10501368
820 Ga0207658_10199680
821 Ga0207677_10051208
822 Ga0207677_10205771
823 Ga0207677_10293777
824 Ga0207708_10021277
825 Ga0207708_10034140
826 Ga0207708_10040549
827 Ga0207641_10187869
828 Ga0207648_10003537
829 Ga0207648_10006736
830 Ga0207648_10080603
831 Ga0207648_10109663
832 Ga0207648_10129950
833 Ga0207676_10088663
834 Ga0207676_10468062
835 Ga0207674_10023097
836 Ga0207674_10070752
837 Ga0207674_10186467
838 Ga0207675_100002780
839 Ga0207675_100007450
840 Ga0207675_100050142
841 Ga0207675_100205366
842 Ga0207683_10044089
843 Ga0207683_10064595
844 Ga0207683_10417180
845 Ga0207683_10450370
846 Ga0207698_10637126
847 Ga0207428_10000089
848 Ga0207428_10005347
849 Ga0207428_10011329
850 Ga0207428_10031883
851 Ga0268266_10165388
852 Ga0268265_10000714
853 Ga0268265_10641288
854 Ga0268264_10034904
855 Ga0268264_10596659
856 Ga0307408_100127650
857 Ga0307405_10000743
858 Ga0307405_10256490
859 Ga0307410_10048094
860 Ga0307406_10007061
861 Ga0307407_10201738
862 Ga0307409_100087398
863 Ga0307409_100573670
864 Ga0307416_100001310
865 Ga0307416_100186096
866 Ga0307415_100060338
867 Ga0373961_0034289
868 Ga0373935_0015012
869 Ga0373947_0313128
870 Ga0373937_0002907
871 Ga0373937_0014854
872 Ga0316584_0044526
873 Ga0373925_0101729
874 Ga0400484_35595
875 Ga0400490_51901
876 Ga0400486_19183
877 Ga0400486_25181
878 Ga0400486_28324
879 Ga0400489_43016
880 Ga0400487_58377
881 Ga0451807_1227182
882 Ga0450895_000862
883 Ga0450896_006127
884 Ga0450898_009299
885 Ga0450918_011613
886 Ga0451577_0044804
887 Ga0453684_0023641
888 Ga0451576_0013194
889 Ga0451576_0273849
890 Ga0451576_0280353
891 Ga0495592_0006832
892 Ga0495580_0034632
893 Ga0495584_0127198
894 Ga0495594_0195717
895 Ga0495628_0024658
896 Ga0495652_0151402
897 Ga0495640_0080332
898 Ga0495587_0034225
899 Ga0495645_0070323
900 Ga0495633_0049423
901 Ga0495656_0063624
902 Ga0495634_0129067
903 Ga0495659_0008128
904 Ga0495659_0027164
905 Ga0495659_0038489
906 Ga0495659_0069544
907 Ga0495658_0072515
908 Ga0495658_0173018
909 Ga0495669_0000968
910 Ga0495669_0137235
911 Ga0495613_0003466
912 Ga0495613_0204948
913 Ga0495604_0043185
914 Ga0495636_0070294
915 Ga0495674_0012800
916 Ga0495675_0125609
917 Ga0495684_0000704
918 Ga0495684_0299418
919 Ga0496104_0131530
920 Ga0496106_0215531
921 Ga0496112_0165451
922 Ga0501040_0012043
923 Ga0501040_0090021
924 Ga0501040_0129075
925 Ga0501042_0012246
926 Ga0501046_0160097
927 Ga0501048_0056902
928 Ga0501048_0209769
929 Ga0501067_0084194
930 Ga0501071_0406664
931 Ga0501072_0013128
932 Ga0501074_0036794
933 Ga0501074_0158762
934 Ga0501075_0081182
935 Ga0501075_0092936
936 Ga0501076_0039331
937 Ga0501076_0217205
938 Ga0501076_0324802
939 Ga0501076_0349656
940 Ga0501249_012281
941 Ga0501079_0030598
942 Ga0501079_0108548
943 Ga0501081_0096967
944 Ga0501083_0184659
945 nmdc:mga05p37_113343_c1
946 nmdc:mga05p37_159344_c1
947 nmdc:mga05p37_17477_c1
948 nmdc:mga05p37_3921_c1
949 nmdc:mga05p37_439060_c1
950 nmdc:mga05p37_53569_c1
951 nmdc:mga09592_129562_c1
952 nmdc:mga09592_172669_c1
953 nmdc:mga09592_1848_c1
954 nmdc:mga09592_188859_c1
955 nmdc:mga09592_222308_c1
956 nmdc:mga09592_41355_c1
957 nmdc:mga09592_46807_c1
958 nmdc:mga0qj67_108164_c1
959 nmdc:mga0qj67_15984_c1
960 nmdc:mga0qj67_193313_c1
961 nmdc:mga0qj67_33028_c1
962 nmdc:mga0qj67_335621_c1
963 nmdc:mga0qj67_6091_c1
964 nmdc:mga06r32_19287_c1
965 nmdc:mga06r32_26369_c1
966 nmdc:mga06r32_66308_c1
967 nmdc:mga08y16_174816_c1
968 nmdc:mga08y16_181625_c1
969 nmdc:mga08y16_18198_c1
970 nmdc:mga08y16_39574_c1
971 nmdc:mga08y16_401135_c1
972 nmdc:mga08y16_592545_c1
973 nmdc:mga08y16_9269_c1
974 nmdc:mga0n895_10695_c1
975 nmdc:mga0n895_13016_c1
976 nmdc:mga0n895_21159_c1
977 nmdc:mga0n895_290237_c1
978 nmdc:mga0n895_373787_c1
979 nmdc:mga0n895_465227_c1
980 nmdc:mga0n895_88512_c1
981 nmdc:mga0a205_1412_c1
982 nmdc:mga0a205_20365_c1
983 nmdc:mga0a205_2312_c1
984 nmdc:mga0a205_3073_c1
985 nmdc:mga0a205_310158_c1
986 nmdc:mga0a205_431734_c1
987 Ga0495601_0000588
988 Ga0495619_0005871
989 Ga0501084_0040715
990 Ga0501084_0064121
991 Ga0590071_000536
992 Ga0590071_001935
993 Ga0590074_000230
994 Ga0590074_005464
995 Ga0590075_000650
996 Ga0590077_000038
997 Ga0590077_001194
998 Ga0530510_0012415

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6juy-assembly1.cif.gz_A crystal structure of argz, apo structure, an arginine dihydrolase from the ornithine-ammonia cycle in cyanobacteria 0.7375 56 314
6juy-assembly1.cif.gz_D crystal structure of argz, apo structure, an arginine dihydrolase from the ornithine-ammonia cycle in cyanobacteria 0.7312 50 315
6lrh-assembly1.cif.gz_B crystal structure of the binary complex of agre c264a mutant with l-arginine 0.7286 56 313
6juy-assembly1.cif.gz_C crystal structure of argz, apo structure, an arginine dihydrolase from the ornithine-ammonia cycle in cyanobacteria 0.7235 56 315
7cmc-assembly1.cif.gz_A crystal structure of deoxyhypusine synthase from pyrococcus horikoshii 0.7016 31 315
ID Description Score Start End Superfamily
1ma3A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.6884 54 314 3.40.50.1220
4p63B00 Alpha Beta;3-Layer(aba) Sandwich;Deoxyhypusine Synthase;Deoxyhypusine synthase 0.6791 31 315 3.40.910.10
1ma3A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.6642 54 314 3.40.50.1220
af_Q6NYK1_8_355_3.40.910.10 Alpha Beta;3-Layer(aba) Sandwich;Deoxyhypusine Synthase;Deoxyhypusine synthase 0.6558 18 314 3.40.910.10
1upaA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.6501 54 313 3.40.50.1220
ID Description Score Start End GO Terms
AF-A0A7W0LFT4-F1-model_v4 Amidohydrolase-related domain-containing protein 0.9882 82 313
AF-A0A7C0YJJ9-F1-model_v4 Uncharacterized protein 0.9858 177 314
AF-A0A523VEU0-F1-model_v4 Uncharacterized protein 0.9842 42 314
AF-A0A661KMU3-F1-model_v4 Uncharacterized protein 0.983 207 314
AF-A0A6V8PPJ0-F1-model_v4 Uncharacterized protein 0.9825 173 314

Map