F455278

General Info

Members Datasets Scaffolds Average Seq Length
498 280 498 151

Family's Representative Sequence

Representative Sequence 3300049593|Ga0501077_0258408|Ga0501077_0258408_261_746
Length 161
Sequence VIAPGAEAPDFTLRDHGGREISLSSLLGSLVMLVFYPLDFSPVCTDQLSIYQEVLEQIEERGLTLIGVSVDSTWAHSAFRKQLGISIPLLSDFEPKGEMIRSYGAYLDAAGHGNRSLVLIDEHGVVRWVHESPTPLEIPGANLIFDALAEVDQGSGESERV

Samples

Sample ID Description Type Environment
1 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
54 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
148 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
149 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
150 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
151 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
152 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
153 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
154 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
155 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
156 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
157 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
158 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
159 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
160 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
161 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
162 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
163 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
164 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
165 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
166 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
167 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
168 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
169 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
170 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
171 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
172 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
174 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
175 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
176 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
177 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
178 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
179 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
180 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
181 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
182 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
183 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
184 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
185 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
186 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
187 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
188 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
189 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
190 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
191 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
192 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
193 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
194 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
195 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
196 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
197 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
198 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
199 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
200 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
201 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
202 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
203 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
204 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
205 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
206 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
207 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
208 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
209 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
210 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
211 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
212 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
213 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
214 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
215 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
216 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
217 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
218 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
219 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
220 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
221 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
222 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
223 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
224 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
225 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
226 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
227 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
228 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
229 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
230 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
231 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
232 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
233 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
234 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
235 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
245 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
246 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
247 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
248 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
249 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
250 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
251 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
252 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
253 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
254 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
255 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
256 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
257 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
258 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
259 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
261 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
262 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
263 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
264 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
265 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
266 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
267 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
268 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
269 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
270 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
271 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
272 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
273 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
274 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
275 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
276 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
277 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
278 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
279 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
280 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.4
Metatranscriptomes 0.6
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.62
Nodule 0
Rhizoplane 10.64
Rhizosphere 83.94
Stem 0
Stem Tuber 0
Unclassified 0.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24738J21930_10030221 3300002075 Bacteria 1106
2 JGI24751J29686_10044781 3300002459 Bacteria 914
3 JGI25407J50210_10004099 3300003373 Bacteria 3538
4 JGI25407J50210_10014098 3300003373 Bacteria 2059
5 JGI25407J50210_10024103 3300003373 Bacteria 1579
6 JGI25407J50210_10034497 3300003373 Bacteria 1305
7 JGI25407J50210_10129969 3300003373 Unclassified 620
8 Ga0058862_12288466 3300004803 Bacteria 815
9 Ga0070676_10135808 3300005328 Bacteria 1560
10 Ga0070683_100009211 3300005329 Bacteria 8433
11 Ga0070683_100045633 3300005329 Bacteria 4045
12 Ga0070683_100061772 3300005329 Bacteria 3483
13 Ga0070683_100074987 3300005329 Bacteria 3160
14 Ga0070683_100104441 3300005329 Bacteria 2670
15 Ga0070683_100917967 3300005329 Bacteria 840
16 Ga0070670_100068363 3300005331 Bacteria 3049
17 Ga0070680_100015195 3300005336 Bacteria 6030
18 Ga0070680_100148274 3300005336 Bacteria 1969
19 Ga0070680_100276903 3300005336 Bacteria 1421
20 Ga0070682_100015778 3300005337 Bacteria 4384
21 Ga0068868_100016482 3300005338 Bacteria 5489
22 Ga0068868_100135247 3300005338 Bacteria 2020
23 Ga0070660_100001597 3300005339 Bacteria 15567
24 Ga0070689_100165032 3300005340 Bacteria 1792
25 Ga0070661_100044128 3300005344 Bacteria 3257
26 Ga0070692_10002364 3300005345 Bacteria 7294
27 Ga0070668_100029447 3300005347 Bacteria 4171
28 Ga0070669_100170107 3300005353 Bacteria 1698
29 Ga0070675_100037444 3300005354 Bacteria 3951
30 Ga0070671_100157943 3300005355 Bacteria 1916
31 Ga0070674_100000012 3300005356 Bacteria 130773
32 Ga0070674_100000023 3300005356 Bacteria 84887
33 Ga0070673_100034198 3300005364 Bacteria 3843
34 Ga0070673_100042577 3300005364 Bacteria 3502
35 Ga0070688_100005806 3300005365 Bacteria 6532
36 Ga0070659_100006778 3300005366 Bacteria 8288
37 Ga0070659_100063542 3300005366 Bacteria 2921
38 Ga0070711_100000890 3300005439 Bacteria 15699
39 Ga0070705_100313479 3300005440 Bacteria 1129
40 Ga0070700_100031473 3300005441 Bacteria 3180
41 Ga0070663_100080369 3300005455 Bacteria 2394
42 Ga0070678_100200630 3300005456 Bacteria 1646
43 Ga0070662_100010770 3300005457 Bacteria 6019
44 Ga0070681_10016016 3300005458 Bacteria 7474
45 Ga0070681_10020573 3300005458 Bacteria 6612
46 Ga0070681_10861009 3300005458 Bacteria 824
47 Ga0068867_100070425 3300005459 Bacteria 2614
48 Ga0070685_10138107 3300005466 Bacteria 1531
49 Ga0070679_100000562 3300005530 Bacteria 31539
50 Ga0070679_100033908 3300005530 Bacteria 5056
51 Ga0070679_100286176 3300005530 Bacteria 1600
52 Ga0070679_100605633 3300005530 Bacteria 1039
53 Ga0070684_100006512 3300005535 Bacteria 9040
54 Ga0070684_100027692 3300005535 Bacteria 4786
55 Ga0070684_100083342 3300005535 Bacteria 2833
56 Ga0070684_100214204 3300005535 Bacteria 1756
57 Ga0068853_100111883 3300005539 Bacteria 2426
58 Ga0068853_100113347 3300005539 Bacteria 2411
59 Ga0068853_101210605 3300005539 Bacteria 729
60 Ga0070672_100029952 3300005543 Bacteria 4085
61 Ga0070693_100705240 3300005547 Bacteria 739
62 Ga0070693_101321333 3300005547 Bacteria 558
63 Ga0070665_100000135 3300005548 Bacteria 138925
64 Ga0070665_100198305 3300005548 Bacteria 2008
65 Ga0070704_100206263 3300005549 Bacteria 1590
66 Ga0068855_100432986 3300005563 Bacteria 1437
67 Ga0068855_100785795 3300005563 Bacteria 1013
68 Ga0070664_100001579 3300005564 Bacteria 18219
69 Ga0070664_100054411 3300005564 Bacteria 3395
70 Ga0068857_100070967 3300005577 Bacteria 3103
71 Ga0068857_101597284 3300005577 Bacteria 637
72 Ga0068854_100025330 3300005578 Bacteria 4070
73 Ga0068854_100095314 3300005578 Bacteria 2221
74 Ga0068856_100012117 3300005614 Bacteria 8350
75 Ga0068856_100150682 3300005614 Bacteria 2335
76 Ga0068856_100313647 3300005614 Bacteria 1586
77 Ga0068856_100344889 3300005614 Bacteria 1508
78 Ga0068852_100003090 3300005616 Bacteria 11592
79 Ga0068852_100030492 3300005616 Bacteria 4440
80 Ga0068859_100697094 3300005617 Bacteria 1106
81 Ga0068864_100308717 3300005618 Bacteria 1483
82 Ga0068866_10000008 3300005718 Bacteria 117658
83 Ga0068866_10000460 3300005718 Bacteria 18634
84 Ga0068863_100000022 3300005841 Bacteria 188278
85 Ga0068858_100003213 3300005842 Bacteria 16316
86 Ga0068858_100222660 3300005842 Bacteria 1787
87 Ga0068860_100010748 3300005843 Bacteria 9034
88 Ga0068862_100040409 3300005844 Bacteria 3964
89 Ga0081455_10009419 3300005937 Bacteria 10047
90 Ga0081455_10035539 3300005937 Bacteria 4451
91 Ga0081455_10158270 3300005937 Bacteria 1739
92 Ga0081455_10712074 3300005937 Bacteria 638
93 Ga0081538_10000020 3300005981 Bacteria 139567
94 Ga0081538_10000087 3300005981 Bacteria 88954
95 Ga0081538_10000141 3300005981 Bacteria 74085
96 Ga0081538_10000200 3300005981 Bacteria 66229
97 Ga0081538_10000316 3300005981 Bacteria 55223
98 Ga0081538_10001262 3300005981 Bacteria 26407
99 Ga0081538_10002984 3300005981 Bacteria 16132
100 Ga0081538_10003006 3300005981 Bacteria 16055
101 Ga0081538_10011351 3300005981 Bacteria 7224
102 Ga0081538_10014003 3300005981 Bacteria 6312
103 Ga0081538_10023516 3300005981 Bacteria 4426
104 Ga0081538_10056569 3300005981 Bacteria 2296
105 Ga0081538_10141096 3300005981 Unclassified 1111
106 Ga0081540_1002030 3300005983 Bacteria 16890
107 Ga0081540_1019200 3300005983 Bacteria 4165
108 Ga0081539_10017083 3300005985 Bacteria 5122
109 Ga0075365_10026747 3300006038 Bacteria 3666
110 Ga0075365_10065816 3300006038 Bacteria 2430
111 Ga0075363_100003127 3300006048 Bacteria 6953
112 Ga0075363_100028232 3300006048 Bacteria 2884
113 Ga0075363_100043885 3300006048 Bacteria 2366
114 Ga0075363_100063340 3300006048 Bacteria 1996
115 Ga0075363_100183933 3300006048 Bacteria 1190
116 Ga0075363_100800964 3300006048 Unclassified 573
117 Ga0075364_10003821 3300006051 Bacteria 8621
118 Ga0075364_10187439 3300006051 Bacteria 1401
119 Ga0070716_100873427 3300006173 Bacteria 702
120 Ga0075367_10058807 3300006178 Bacteria 2287
121 Ga0075367_10367945 3300006178 Bacteria 908
122 Ga0068871_100437571 3300006358 Bacteria 1170
123 Ga0068871_100481622 3300006358 Bacteria 1116
124 Ga0068871_101941500 3300006358 Bacteria 560
125 Ga0075428_100036072 3300006844 Bacteria 5449
126 Ga0075428_100517024 3300006844 Bacteria 1277
127 Ga0075430_100017993 3300006846 Bacteria 6016
128 Ga0075430_100024067 3300006846 Bacteria 5185
129 Ga0075431_100040268 3300006847 Bacteria 4815
130 Ga0075434_100112979 3300006871 Bacteria 2728
131 Ga0075429_100145956 3300006880 Bacteria 2071
132 Ga0068865_100044422 3300006881 Bacteria 3041
133 Ga0097620_100697096 3300006931 Bacteria 1106
134 Ga0105240_10211296 3300009093 Bacteria 2267
135 Ga0111539_11083164 3300009094 Bacteria 931
136 Ga0105245_10000130 3300009098 Bacteria 72166
137 Ga0105245_10000415 3300009098 Bacteria 39764
138 Ga0105245_10035564 3300009098 Bacteria 4421
139 Ga0105245_10167138 3300009098 Bacteria 2092
140 Ga0114129_10045892 3300009147 Bacteria 6141
141 Ga0114129_10281490 3300009147 Bacteria 2222
142 Ga0105243_10200652 3300009148 Bacteria 1749
143 Ga0105241_10351538 3300009174 Bacteria 1280
144 Ga0105242_10066584 3300009176 Bacteria 2976
145 Ga0105242_10331211 3300009176 Bacteria 1400
146 Ga0105237_10143140 3300009545 Bacteria 2385
147 Ga0105237_10367605 3300009545 Bacteria 1443
148 Ga0105238_10000055 3300009551 Bacteria 139232
149 Ga0105238_10207681 3300009551 Bacteria 1934
150 Ga0105249_10000143 3300009553 Bacteria 92539
151 Ga0105249_10131265 3300009553 Bacteria 2392
152 Ga0105249_10554212 3300009553 Bacteria 1200
153 Ga0105249_12322378 3300009553 Unclassified 609
154 Ga0105033_105796 3300009986 Bacteria 1064
155 Ga0105239_10047701 3300010375 Bacteria 4694
156 Ga0105239_10953679 3300010375 Bacteria 985
157 Ga0105246_10611236 3300011119 Bacteria 943
158 Ga0157371_10386651 3300013102 Bacteria 1022
159 Ga0157370_10018240 3300013104 Bacteria 7060
160 Ga0157374_10362195 3300013296 Bacteria 1442
161 Ga0157378_10605080 3300013297 Bacteria 1108
162 Ga0163162_10936127 3300013306 Bacteria 978
163 Ga0157372_10252137 3300013307 Bacteria 2049
164 Ga0157375_10009814 3300013308 Bacteria 8416
165 Ga0157375_10027112 3300013308 Bacteria 5351
166 Ga0157375_13363780 3300013308 Bacteria 533
167 Ga0163163_10476680 3300014325 Bacteria 1309
168 Ga0157380_10050523 3300014326 Bacteria 3285
169 Ga0157377_10017055 3300014745 Bacteria 3751
170 Ga0157379_10050879 3300014968 Bacteria 3699
171 Ga0206350_11216546 3300020080 Bacteria 846
172 Ga0224712_10178088 3300022467 Bacteria 957
173 Ga0207682_10000091 3300025893 Bacteria 41479
174 Ga0207642_10000002 3300025899 Bacteria 658166
175 Ga0207642_10000275 3300025899 Bacteria 15398
176 Ga0207685_10000028 3300025905 Bacteria 97935
177 Ga0207699_10588049 3300025906 Bacteria 810
178 Ga0207645_10035432 3300025907 Bacteria 3204
179 Ga0207645_10370058 3300025907 Bacteria 961
180 Ga0207643_10026611 3300025908 Bacteria 3202
181 Ga0207705_10068595 3300025909 Bacteria 2568
182 Ga0207707_10034275 3300025912 Bacteria 4441
183 Ga0207707_10333504 3300025912 Bacteria 1308
184 Ga0207707_10665330 3300025912 Bacteria 877
185 Ga0207695_10148199 3300025913 Bacteria 2288
186 Ga0207693_10782471 3300025915 Bacteria 736
187 Ga0207663_10000409 3300025916 Bacteria 18629
188 Ga0207660_10163643 3300025917 Bacteria 1718
189 Ga0207660_10328994 3300025917 Bacteria 1221
190 Ga0207657_10001730 3300025919 Bacteria 23530
191 Ga0207649_10024835 3300025920 Bacteria 3487
192 Ga0207652_10007110 3300025921 Bacteria 9022
193 Ga0207652_10023724 3300025921 Bacteria 5085
194 Ga0207652_10048894 3300025921 Bacteria 3617
195 Ga0207652_10785116 3300025921 Bacteria 846
196 Ga0207681_10648894 3300025923 Bacteria 875
197 Ga0207694_10000063 3300025924 Bacteria 139700
198 Ga0207694_10052609 3300025924 Bacteria 3156
199 Ga0207650_10137294 3300025925 Bacteria 1919
200 Ga0207659_10050631 3300025926 Bacteria 2952
201 Ga0207687_10000032 3300025927 Bacteria 143196
202 Ga0207687_10001820 3300025927 Bacteria 14678
203 Ga0207687_10124930 3300025927 Bacteria 1930
204 Ga0207687_10266839 3300025927 Bacteria 1367
205 Ga0207687_10493252 3300025927 Bacteria 1021
206 Ga0207687_11094806 3300025927 Bacteria 684
207 Ga0207690_10005375 3300025932 Bacteria 7547
208 Ga0207706_10013020 3300025933 Bacteria 7570
209 Ga0207686_10119007 3300025934 Bacteria 1795
210 Ga0207709_10037526 3300025935 Bacteria 2880
211 Ga0207670_10074491 3300025936 Bacteria 2357
212 Ga0207669_10000017 3300025937 Bacteria 119878
213 Ga0207669_10000026 3300025937 Bacteria 92199
214 Ga0207704_10162587 3300025938 Bacteria 1590
215 Ga0207665_10199671 3300025939 Bacteria 1457
216 Ga0207691_10043066 3300025940 Bacteria 4161
217 Ga0207711_10613165 3300025941 Bacteria 1015
218 Ga0207689_10591714 3300025942 Bacteria 933
219 Ga0207661_10004833 3300025944 Bacteria 9441
220 Ga0207661_10009986 3300025944 Bacteria 6821
221 Ga0207661_10050338 3300025944 Bacteria 3318
222 Ga0207661_10431579 3300025944 Bacteria 1198
223 Ga0207679_10029452 3300025945 Bacteria 3823
224 Ga0207679_10039656 3300025945 Bacteria 3365
225 Ga0207667_10537124 3300025949 Bacteria 1183
226 Ga0207667_10695065 3300025949 Bacteria 1020
227 Ga0207651_10077887 3300025960 Bacteria 2375
228 Ga0207712_10000058 3300025961 Bacteria 140948
229 Ga0207668_10646896 3300025972 Bacteria 925
230 Ga0207640_10018376 3300025981 Bacteria 4109
231 Ga0207640_10083523 3300025981 Bacteria 2190
232 Ga0207677_10000284 3300026023 Bacteria 37886
233 Ga0207677_10021626 3300026023 Bacteria 3935
234 Ga0207677_10256613 3300026023 Unclassified 1423
235 Ga0207677_10784633 3300026023 Bacteria 852
236 Ga0207703_10000088 3300026035 Bacteria 106080
237 Ga0207703_10000287 3300026035 Bacteria 55757
238 Ga0207639_10043346 3300026041 Bacteria 3378
239 Ga0207639_10165960 3300026041 Bacteria 1865
240 Ga0207639_10205621 3300026041 Bacteria 1691
241 Ga0207678_10046454 3300026067 Bacteria 3754
242 Ga0207708_10085173 3300026075 Bacteria 2431
243 Ga0207702_10000789 3300026078 Bacteria 33612
244 Ga0207702_10153732 3300026078 Bacteria 2095
245 Ga0207702_10871807 3300026078 Bacteria 892
246 Ga0207641_10000016 3300026088 Bacteria 307363
247 Ga0207641_10662573 3300026088 Bacteria 1026
248 Ga0207648_10010849 3300026089 Bacteria 8612
249 Ga0207674_10214947 3300026116 Bacteria 1871
250 Ga0207674_10241948 3300026116 Bacteria 1751
251 Ga0207683_10116184 3300026121 Bacteria 2398
252 Ga0207698_10108699 3300026142 Bacteria 2319
253 Ga0207698_10284776 3300026142 Bacteria 1530
254 Ga0268266_10000056 3300028379 Bacteria 289176
255 Ga0268266_11477169 3300028379 Bacteria 655
256 Ga0268265_10104081 3300028380 Bacteria 2300
257 Ga0268264_10009842 3300028381 Bacteria 7914
258 Ga0265337_1000066 3300028556 Bacteria 48673
259 Ga0265326_10000258 3300028558 Bacteria 24473
260 Ga0265323_10126925 3300028653 Bacteria 828
261 Ga0265322_10000011 3300028654 Bacteria 167597
262 Ga0265324_10001593 3300029957 Bacteria 12632
263 Ga0265332_10023227 3300031238 Bacteria 2735
264 Ga0265328_10020121 3300031239 Bacteria 2557
265 Ga0265320_10000011 3300031240 Bacteria 249534
266 Ga0265339_10046644 3300031249 Bacteria 2380
267 Ga0265331_10017439 3300031250 Bacteria 3743
268 Ga0265327_10000015 3300031251 Bacteria 496677
269 Ga0265316_10103852 3300031344 Bacteria 2157
270 Ga0307408_100736171 3300031548 Bacteria 889
271 Ga0265314_10000640 3300031711 Bacteria 42944
272 Ga0265342_10196036 3300031712 Bacteria 1100
273 Ga0307405_10161819 3300031731 Bacteria 1586
274 Ga0307405_11098232 3300031731 Bacteria 683
275 Ga0307410_10272076 3300031852 Bacteria 1325
276 Ga0307406_10225235 3300031901 Bacteria 1396
277 Ga0307407_10129227 3300031903 Bacteria 1613
278 Ga0307412_10221951 3300031911 Bacteria 1449
279 Ga0307409_100115851 3300031995 Bacteria 2257
280 Ga0307409_100349521 3300031995 Unclassified 1394
281 Ga0307416_100342552 3300032002 Bacteria 1508
282 Ga0307416_100386518 3300032002 Bacteria 1432
283 Ga0307414_10090789 3300032004 Bacteria 2268
284 Ga0307411_10371944 3300032005 Bacteria 1172
285 Ga0307415_100095274 3300032126 Bacteria 2166
286 Ga0373937_0030944 3300036401 Bacteria 4847
287 Ga0395899_0044635 3300037312 Bacteria 3302
288 Ga0395900_0037978 3300037418 Bacteria 4965
289 Ga0395900_0159347 3300037418 Bacteria 2303
290 Ga0395900_0310620 3300037418 Bacteria 1560
291 Ga0395900_0321962 3300037418 Bacteria 1526
292 Ga0395900_0748311 3300037418 Bacteria 908
293 Ga0395900_0959134 3300037418 Bacteria 776
294 Ga0395898_0002264 3300037466 Bacteria 23336
295 Ga0395898_0046596 3300037466 Bacteria 4259
296 Ga0395898_0108918 3300037466 Bacteria 2656
297 Ga0395898_0586944 3300037466 Bacteria 1057
298 Ga0395898_0935414 3300037466 Bacteria 804
299 Ga0395905_0010918 3300037471 Bacteria 8790
300 Ga0395905_0315538 3300037471 Bacteria 1452
301 Ga0395905_0509410 3300037471 Unclassified 1104
302 Ga0395905_0811888 3300037471 Bacteria 838
303 Ga0316581_0083452 3300037588 Bacteria 983
304 Ga0395901_0008042 3300038443 Bacteria 10652
305 Ga0395901_0160268 3300038443 Bacteria 2363
306 Ga0395901_0209883 3300038443 Bacteria 2039
307 Ga0395901_0331268 3300038443 Unclassified 1574
308 Ga0395901_0485665 3300038443 Unclassified 1259
309 Ga0395901_1309508 3300038443 Bacteria 686
310 Ga0395901_1419740 3300038443 Bacteria 652
311 Ga0395901_1462684 3300038443 Bacteria 640
312 Ga0395901_1570750 3300038443 Bacteria 612
313 Ga0395901_1923930 3300038443 Bacteria 539
314 Ga0451800_0524523 3300041459 Bacteria 1273
315 Ga0451802_1963968 3300041460 Bacteria 887
316 Ga0451839_0771604 3300041496 Bacteria 721
317 Ga0451853_0167364 3300041512 Bacteria 606
318 Ga0451853_1381199 3300041512 Bacteria 1159
319 Ga0439463_065184 3300042016 Bacteria 932
320 Ga0439440_0062209 3300042993 Bacteria 955
321 Ga0466963_0011820 3300044694 Bacteria 5326
322 Ga0466967_0488317 3300045976 Unclassified 1207
323 Ga0466967_0608231 3300045976 Bacteria 1079
324 Ga0466967_1006729 3300045976 Bacteria 830
325 Ga0466967_1788770 3300045976 Bacteria 612
326 Ga0495592_0000261 3300046454 Bacteria 44965
327 Ga0495603_0000098 3300046455 Bacteria 40307
328 Ga0495603_0012212 3300046455 Bacteria 5202
329 Ga0495641_0000312 3300046461 Bacteria 39169
330 Ga0495641_0214414 3300046461 Bacteria 863
331 Ga0495651_0097078 3300046462 Bacteria 2201
332 Ga0495584_0323592 3300046491 Unclassified 783
333 Ga0495608_0001909 3300046511 Bacteria 14948
334 Ga0495616_0263003 3300046513 Unclassified 738
335 Ga0495620_0000139 3300046515 Bacteria 59244
336 Ga0495628_0020312 3300046516 Bacteria 5481
337 Ga0495628_0391221 3300046516 Bacteria 1017
338 Ga0495630_0951757 3300046517 Unclassified 653
339 Ga0495644_0003637 3300046523 Bacteria 6074
340 Ga0495644_0051710 3300046523 Bacteria 1543
341 Ga0495586_0001484 3300046535 Bacteria 12933
342 Ga0495598_0009877 3300046537 Bacteria 2269
343 Ga0495645_0543970 3300046543 Bacteria 720
344 Ga0495667_0000020 3300046559 Bacteria 180876
345 Ga0495667_0121481 3300046559 Bacteria 1686
346 Ga0495656_0023058 3300046615 Unclassified 2446
347 Ga0495635_0000076 3300046663 Bacteria 61665
348 Ga0495635_0357469 3300046663 Bacteria 974
349 Ga0495661_0283172 3300046665 Bacteria 835
350 Ga0495657_0040035 3300046675 Bacteria 3217
351 Ga0495599_0044192 3300046678 Bacteria 2794
352 Ga0495646_0396312 3300046680 Bacteria 718
353 Ga0495647_0023040 3300046681 Bacteria 2255
354 Ga0495669_0000113 3300046684 Bacteria 52780
355 Ga0495613_0000005 3300046689 Bacteria 222558
356 Ga0495670_0029226 3300046691 Bacteria 2735
357 Ga0495670_0160536 3300046691 Bacteria 1181
358 Ga0495649_0003735 3300046694 Bacteria 10123
359 Ga0495604_0038729 3300047317 Bacteria 3751
360 Ga0495676_0000621 3300047321 Bacteria 29385
361 Ga0495679_010872 3300047446 Bacteria 3548
362 Ga0495679_103654 3300047446 Unclassified 788
363 Ga0495593_0083183 3300047673 Bacteria 1654
364 Ga0495602_0188232 3300048088 Bacteria 1585
365 Ga0495614_0026577 3300048089 Bacteria 2495
366 Ga0496100_0000013 3300048903 Bacteria 177476
367 Ga0496101_0000035 3300048904 Bacteria 177237
368 Ga0496101_0147054 3300048904 Bacteria 1800
369 Ga0496102_0227953 3300048905 Bacteria 1757
370 Ga0496104_0000052 3300048907 Bacteria 137286
371 Ga0496104_1505935 3300048907 Bacteria 576
372 Ga0496105_0000030 3300048908 Bacteria 137325
373 Ga0496106_0000959 3300048909 Bacteria 21012
374 Ga0496106_0218779 3300048909 Bacteria 1518
375 Ga0496106_0321234 3300048909 Bacteria 1242
376 Ga0496107_0000020 3300048910 Bacteria 148990
377 Ga0496107_0034339 3300048910 Bacteria 3633
378 Ga0496107_0058453 3300048910 Bacteria 2788
379 Ga0496107_0097351 3300048910 Bacteria 2154
380 Ga0496107_1030288 3300048910 Unclassified 596
381 Ga0496108_0000006 3300048911 Bacteria 469473
382 Ga0496108_0097565 3300048911 Bacteria 2504
383 Ga0496108_0149270 3300048911 Bacteria 2017
384 Ga0496108_0752360 3300048911 Unclassified 843
385 Ga0496108_0872152 3300048911 Bacteria 774
386 Ga0496109_0000009 3300048912 Bacteria 236561
387 Ga0496109_0002374 3300048912 Bacteria 15731
388 Ga0496109_0030582 3300048912 Bacteria 4827
389 Ga0496109_0056672 3300048912 Bacteria 3575
390 Ga0496109_0863316 3300048912 Bacteria 843
391 Ga0496110_0024399 3300048913 Bacteria 5154
392 Ga0496110_0102093 3300048913 Bacteria 2572
393 Ga0496110_0200089 3300048913 Bacteria 1815
394 Ga0496110_0270200 3300048913 Bacteria 1548
395 Ga0496110_0407145 3300048913 Unclassified 1240
396 Ga0496110_0471689 3300048913 Bacteria 1143
397 Ga0496110_0624467 3300048913 Bacteria 976
398 Ga0496110_0885656 3300048913 Bacteria 798
399 Ga0496111_0047372 3300048914 Bacteria 3096
400 Ga0496111_0107362 3300048914 Bacteria 2055
401 Ga0496111_0182103 3300048914 Bacteria 1562
402 Ga0496111_0613863 3300048914 Bacteria 795
403 Ga0496111_0645935 3300048914 Bacteria 772
404 Ga0496112_0209887 3300048915 Bacteria 1905
405 Ga0496112_0450546 3300048915 Bacteria 1225
406 Ga0496112_0592178 3300048915 Bacteria 1041
407 Ga0496112_1044441 3300048915 Bacteria 736
408 Ga0496113_0029550 3300048916 Bacteria 3960
409 Ga0496113_0095770 3300048916 Bacteria 2294
410 Ga0496113_0188617 3300048916 Bacteria 1636
411 Ga0496113_0454456 3300048916 Bacteria 1029
412 Ga0496113_1135460 3300048916 Bacteria 612
413 Ga0496114_0024789 3300048917 Bacteria 4898
414 Ga0496114_0155266 3300048917 Bacteria 1987
415 Ga0496114_0764962 3300048917 Bacteria 843
416 Ga0496115_0015153 3300048918 Bacteria 5842
417 Ga0496125_0144539 3300048928 Bacteria 1647
418 Ga0501031_0312567 3300049568 Bacteria 1018
419 Ga0501032_0713240 3300049569 Unclassified 635
420 Ga0501036_0261934 3300049572 Bacteria 1448
421 Ga0501038_0303982 3300049574 Bacteria 1251
422 Ga0501039_0087018 3300049575 Bacteria 2434
423 Ga0501039_0096184 3300049575 Bacteria 2309
424 Ga0501040_0210967 3300049576 Bacteria 1381
425 Ga0501041_0293434 3300049577 Bacteria 1024
426 Ga0501042_0168954 3300049578 Bacteria 1578
427 Ga0501042_0325449 3300049578 Bacteria 1111
428 Ga0501042_0523410 3300049578 Bacteria 861
429 Ga0501046_0226583 3300049580 Bacteria 1382
430 Ga0501046_0620739 3300049580 Bacteria 766
431 Ga0501067_0265607 3300049583 Bacteria 955
432 Ga0501068_0081190 3300049584 Bacteria 1990
433 Ga0501068_0144907 3300049584 Bacteria 1490
434 Ga0501069_0030990 3300049585 Bacteria 2939
435 Ga0501070_0064719 3300049586 Bacteria 3027
436 Ga0501070_0068029 3300049586 Bacteria 2949
437 Ga0501070_0113726 3300049586 Bacteria 2236
438 Ga0501071_0011903 3300049587 Bacteria 5877
439 Ga0501071_0227839 3300049587 Bacteria 1404
440 Ga0501071_0401560 3300049587 Bacteria 1046
441 Ga0501071_0422086 3300049587 Bacteria 1019
442 Ga0501072_0019175 3300049588 Bacteria 5284
443 Ga0501072_0037582 3300049588 Bacteria 3798
444 Ga0501072_0383728 3300049588 Unclassified 1115
445 Ga0501072_0913327 3300049588 Unclassified 686
446 Ga0501073_0012474 3300049589 Bacteria 6201
447 Ga0501074_0029691 3300049590 Bacteria 3960
448 Ga0501075_0205618 3300049591 Bacteria 1502
449 Ga0501076_0013062 3300049592 Bacteria 6218
450 Ga0501076_0020528 3300049592 Bacteria 5057
451 Ga0501076_0121940 3300049592 Bacteria 2111
452 Ga0501077_0258408 3300049593 Bacteria 1108
453 Ga0501079_0244895 3300049741 Bacteria 1401
454 Ga0501079_0824507 3300049741 Bacteria 730
455 Ga0501079_1023594 3300049741 Unclassified 651
456 Ga0501080_0021239 3300049742 Bacteria 6008
457 Ga0501081_0006533 3300049743 Bacteria 7574
458 Ga0501081_0140755 3300049743 Bacteria 1729
459 Ga0501081_0297472 3300049743 Bacteria 1184
460 Ga0501083_0026625 3300049744 Bacteria 3996
461 Ga0501083_0275587 3300049744 Bacteria 1094
462 Ga0501035_0349816 3300049822 Bacteria 1237
463 Ga0501035_1295033 3300049822 Unclassified 562
464 Ga0501045_0031387 3300049824 Bacteria 3848
465 Ga0501045_0034325 3300049824 Bacteria 3683
466 Ga0501045_0428556 3300049824 Bacteria 984
467 nmdc:mga03n38_12408_c1 3300050490 Bacteria 3205
468 nmdc:mga03n38_62622_c1 3300050490 Bacteria 1698
469 nmdc:mga03n38_806394_c1 3300050490 Unclassified 547
470 nmdc:mga03n38_87607_c1 3300050490 Bacteria 1476
471 nmdc:mga00v17_159556_c1 3300050491 Bacteria 1451
472 nmdc:mga00v17_6297_c1 3300050491 Bacteria 6293
473 nmdc:mga0yw44_350690_c1 3300050492 Bacteria 993
474 nmdc:mga0yw44_54734_c1 3300050492 Bacteria 2426
475 nmdc:mga0yw44_58766_c1 3300050492 Bacteria 2350
476 nmdc:mga06z11_131291_c1 3300050494 Bacteria 1407
477 nmdc:mga05p37_296888_c1 3300050507 Bacteria 1921
478 nmdc:mga05p37_5570_c1 3300050507 Bacteria 14808
479 nmdc:mga09592_153506_c1 3300050508 Bacteria 1987
480 nmdc:mga0qj67_71953_c1 3300050509 Bacteria 2760
481 nmdc:mga06r32_8783_c1 3300050510 Bacteria 9106
482 nmdc:mga08y16_295725_c1 3300050511 Bacteria 1669
483 nmdc:mga0n895_723001_c1 3300050512 Bacteria 990
484 nmdc:mga08x19_830496_c1 3300050514 Bacteria 656
485 nmdc:mga0a205_62793_c1 3300050515 Bacteria 3589
486 Ga0495601_0000060 3300053077 Bacteria 60600
487 Ga0495612_0001300 3300053078 Bacteria 10304
488 Ga0495655_0047404 3300053083 Bacteria 1124
489 Ga0495619_0000008 3300053085 Bacteria 305999
490 Ga0495619_0009341 3300053085 Bacteria 6190
491 Ga0500614_001518 3300053123 Bacteria 5521
492 Ga0501084_0053133 3300054114 Bacteria 3389
493 Ga0501084_0059575 3300054114 Bacteria 3196
494 Ga0501082_0069697 3300060353 Bacteria 3028
495 Ga0501082_0166744 3300060353 Bacteria 1914
496 Ga0530510_0042026 3300061734 Bacteria 3302
497 Ga0530510_0668231 3300061734 Unclassified 791
498 Ga0530510_1550613 3300061734 Bacteria 509

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025927 Ga0207687_10266839 Ga0207687_102668393 125
2 3300046665 Ga0495661_0283172 Ga0495661_0283172_24_416 130
3 3300049568 Ga0501031_0312567 Ga0501031_0312567_603_1001 132
4 3300025939 Ga0207665_10199671 Ga0207665_101996712 133
5 3300046517 Ga0495630_0951757 Ga0495630_0951757_136_540 133
6 3300037418 Ga0395900_0310620 Ga0395900_0310620_650_1099 134
7 3300037466 Ga0395898_0108918 Ga0395898_0108918_884_1333 134
8 3300045976 Ga0466967_1006729 Ga0466967_1006729_295_759 136
9 3300005329 Ga0070683_100917967 Ga0070683_1009179671 137
10 3300005458 Ga0070681_10020573 Ga0070681_100205734 137
11 3300005539 Ga0068853_101210605 Ga0068853_1012106052 137
12 3300005614 Ga0068856_100150682 Ga0068856_1001506824 137
13 3300006173 Ga0070716_100873427 Ga0070716_1008734272 137
14 3300006358 Ga0068871_100437571 Ga0068871_1004375711 137
15 3300025906 Ga0207699_10588049 Ga0207699_105880491 137
16 3300025912 Ga0207707_10333504 Ga0207707_103335042 137
17 3300025927 Ga0207687_11094806 Ga0207687_110948062 137
18 3300025944 Ga0207661_10431579 Ga0207661_104315793 137
19 3300026041 Ga0207639_10205621 Ga0207639_102056212 137
20 3300026078 Ga0207702_10153732 Ga0207702_101537324 137
21 3300048911 Ga0496108_0872152 Ga0496108_0872152_282_746 137
22 3300048913 Ga0496110_0624467 Ga0496110_0624467_387_851 137
23 3300048916 Ga0496113_1135460 Ga0496113_1135460_105_569 137
24 3300005981 Ga0081538_10000141 Ga0081538_1000014143 145
25 3300009098 Ga0105245_10167138 Ga0105245_101671382 148
26 3300041496 Ga0451839_0771604 Ga0451839_0771604_17_463 148
27 3300048907 Ga0496104_1505935 Ga0496104_1505935_35_481 148
28 3300048916 Ga0496113_0188617 Ga0496113_0188617_1152_1598 148
29 3300005329 Ga0070683_100045633 Ga0070683_1000456333 149
30 3300005336 Ga0070680_100148274 Ga0070680_1001482743 149
31 3300005458 Ga0070681_10861009 Ga0070681_108610091 149
32 3300005530 Ga0070679_100033908 Ga0070679_1000339085 149
33 3300005535 Ga0070684_100214204 Ga0070684_1002142041 149
34 3300005547 Ga0070693_100705240 Ga0070693_1007052402 149
35 3300005548 Ga0070665_100000135 Ga0070665_10000013551 149
36 3300005578 Ga0068854_100025330 Ga0068854_1000253305 149
37 3300005842 Ga0068858_100003213 Ga0068858_10000321316 149
38 3300005937 Ga0081455_10712074 Ga0081455_107120741 149
39 3300005985 Ga0081539_10017083 Ga0081539_100170838 149
40 3300006038 Ga0075365_10065816 Ga0075365_100658163 149
41 3300006048 Ga0075363_100183933 Ga0075363_1001839333 149
42 3300006051 Ga0075364_10187439 Ga0075364_101874391 149
43 3300006358 Ga0068871_101941500 Ga0068871_1019415001 149
44 3300009098 Ga0105245_10000415 Ga0105245_1000041536 149
45 3300009553 Ga0105249_10000143 Ga0105249_1000014341 149
46 3300009553 Ga0105249_10554212 Ga0105249_105542122 149
47 3300009553 Ga0105249_12322378 Ga0105249_123223782 149
48 3300009986 Ga0105033_105796 Ga0105033_1057961 149
49 3300010375 Ga0105239_10953679 Ga0105239_109536792 149
50 3300013296 Ga0157374_10362195 Ga0157374_103621952 149
51 3300013306 Ga0163162_10936127 Ga0163162_109361272 149
52 3300013308 Ga0157375_13363780 Ga0157375_133637801 149
53 3300014968 Ga0157379_10050879 Ga0157379_100508793 149
54 3300025912 Ga0207707_10665330 Ga0207707_106653301 149
55 3300025917 Ga0207660_10163643 Ga0207660_101636433 149
56 3300025921 Ga0207652_10023724 Ga0207652_100237243 149
57 3300025927 Ga0207687_10001820 Ga0207687_100018209 149
58 3300025927 Ga0207687_10493252 Ga0207687_104932522 149
59 3300025944 Ga0207661_10009986 Ga0207661_100099863 149
60 3300025961 Ga0207712_10000058 Ga0207712_1000005891 149
61 3300025972 Ga0207668_10646896 Ga0207668_106468962 149
62 3300025981 Ga0207640_10018376 Ga0207640_100183765 149
63 3300026023 Ga0207677_10784633 Ga0207677_107846332 149
64 3300026035 Ga0207703_10000287 Ga0207703_1000028727 149
65 3300028379 Ga0268266_10000056 Ga0268266_10000056200 149
66 3300036401 Ga0373937_0030944 Ga0373937_0030944_224_673 149
67 3300037418 Ga0395900_0159347 Ga0395900_0159347_1754_2203 149
68 3300037418 Ga0395900_0748311 Ga0395900_0748311_245_694 149
69 3300037466 Ga0395898_0935414 Ga0395898_0935414_106_555 149
70 3300037471 Ga0395905_0315538 Ga0395905_0315538_876_1325 149
71 3300037471 Ga0395905_0509410 Ga0395905_0509410_451_900 149
72 3300038443 Ga0395901_0160268 Ga0395901_0160268_1077_1526 149
73 3300038443 Ga0395901_0209883 Ga0395901_0209883_1335_1784 149
74 3300038443 Ga0395901_1462684 Ga0395901_1462684_26_475 149
75 3300041459 Ga0451800_0524523 Ga0451800_0524523_59_508 149
76 3300041512 Ga0451853_0167364 Ga0451853_0167364_52_501 149
77 3300046461 Ga0495641_0000312 Ga0495641_0000312_3026_3475 149
78 3300046461 Ga0495641_0214414 Ga0495641_0214414_200_649 149
79 3300046511 Ga0495608_0001909 Ga0495608_0001909_4269_4718 149
80 3300046684 Ga0495669_0000113 Ga0495669_0000113_608_1057 149
81 3300046694 Ga0495649_0003735 Ga0495649_0003735_6121_6570 149
82 3300047317 Ga0495604_0038729 Ga0495604_0038729_3102_3551 149
83 3300047446 Ga0495679_010872 Ga0495679_010872_1261_1710 149
84 3300048903 Ga0496100_0000013 Ga0496100_0000013_90519_90968 149
85 3300048904 Ga0496101_0000035 Ga0496101_0000035_90519_90968 149
86 3300048905 Ga0496102_0227953 Ga0496102_0227953_576_1025 149
87 3300048907 Ga0496104_0000052 Ga0496104_0000052_54223_54672 149
88 3300048908 Ga0496105_0000030 Ga0496105_0000030_82654_83103 149
89 3300048909 Ga0496106_0218779 Ga0496106_0218779_442_891 149
90 3300048910 Ga0496107_0000020 Ga0496107_0000020_61668_62117 149
91 3300048910 Ga0496107_1030288 Ga0496107_1030288_69_518 149
92 3300048911 Ga0496108_0000006 Ga0496108_0000006_316554_317003 149
93 3300048912 Ga0496109_0000009 Ga0496109_0000009_83642_84091 149
94 3300048913 Ga0496110_0024399 Ga0496110_0024399_2977_3426 149
95 3300048914 Ga0496111_0107362 Ga0496111_0107362_144_593 149
96 3300048917 Ga0496114_0024789 Ga0496114_0024789_1581_2030 149
97 3300048928 Ga0496125_0144539 Ga0496125_0144539_504_953 149
98 3300049741 Ga0501079_1023594 Ga0501079_1023594_135_584 149
99 3300050490 nmdc:mga03n38_806394_c1 nmdc:mga03n38_806394_c1_62_511 149
100 3300050491 nmdc:mga00v17_159556_c1 nmdc:mga00v17_159556_c1_91_540 149
101 3300050492 nmdc:mga0yw44_58766_c1 nmdc:mga0yw44_58766_c1_11_460 149
102 3300053077 Ga0495601_0000060 Ga0495601_0000060_58031_58480 149
103 3300053078 Ga0495612_0001300 Ga0495612_0001300_3253_3702 149
104 3300053123 Ga0500614_001518 Ga0500614_001518_2955_3404 149
105 3300005356 Ga0070674_100000012 Ga0070674_10000001259 150
106 3300005718 Ga0068866_10000460 Ga0068866_100004603 150
107 3300005843 Ga0068860_100010748 Ga0068860_1000107488 150
108 3300005937 Ga0081455_10035539 Ga0081455_100355394 150
109 3300005983 Ga0081540_1002030 Ga0081540_100203010 150
110 3300006048 Ga0075363_100800964 Ga0075363_1008009641 150
111 3300006871 Ga0075434_100112979 Ga0075434_1001129792 150
112 3300009094 Ga0111539_11083164 Ga0111539_110831641 150
113 3300009147 Ga0114129_10045892 Ga0114129_100458925 150
114 3300009148 Ga0105243_10200652 Ga0105243_102006523 150
115 3300009176 Ga0105242_10066584 Ga0105242_100665843 150
116 3300011119 Ga0105246_10611236 Ga0105246_106112362 150
117 3300013297 Ga0157378_10605080 Ga0157378_106050803 150
118 3300025899 Ga0207642_10000275 Ga0207642_1000027515 150
119 3300025915 Ga0207693_10782471 Ga0207693_107824711 150
120 3300025937 Ga0207669_10000017 Ga0207669_1000001744 150
121 3300028381 Ga0268264_10009842 Ga0268264_100098427 150
122 3300031548 Ga0307408_100736171 Ga0307408_1007361712 150
123 3300031901 Ga0307406_10225235 Ga0307406_102252351 150
124 3300032002 Ga0307416_100386518 Ga0307416_1003865182 150
125 3300037418 Ga0395900_0959134 Ga0395900_0959134_104_556 150
126 3300038443 Ga0395901_0331268 Ga0395901_0331268_760_1212 150
127 3300038443 Ga0395901_1923930 Ga0395901_1923930_30_482 150
128 3300044694 Ga0466963_0011820 Ga0466963_0011820_2520_2972 150
129 3300045976 Ga0466967_0488317 Ga0466967_0488317_213_665 150
130 3300046491 Ga0495584_0323592 Ga0495584_0323592_87_539 150
131 3300046535 Ga0495586_0001484 Ga0495586_0001484_4879_5331 150
132 3300046615 Ga0495656_0023058 Ga0495656_0023058_1935_2387 150
133 3300046691 Ga0495670_0160536 Ga0495670_0160536_593_1045 150
134 3300047446 Ga0495679_103654 Ga0495679_103654_208_660 150
135 3300048088 Ga0495602_0188232 Ga0495602_0188232_252_704 150
136 3300048910 Ga0496107_0034339 Ga0496107_0034339_1996_2448 150
137 3300048911 Ga0496108_0752360 Ga0496108_0752360_100_552 150
138 3300048912 Ga0496109_0030582 Ga0496109_0030582_2771_3223 150
139 3300048913 Ga0496110_0471689 Ga0496110_0471689_338_790 150
140 3300048917 Ga0496114_0764962 Ga0496114_0764962_105_557 150
141 3300048918 Ga0496115_0015153 Ga0496115_0015153_550_1002 150
142 3300049583 Ga0501067_0265607 Ga0501067_0265607_282_734 150
143 3300049584 Ga0501068_0144907 Ga0501068_0144907_740_1192 150
144 3300049585 Ga0501069_0030990 Ga0501069_0030990_1043_1495 150
145 3300049586 Ga0501070_0064719 Ga0501070_0064719_1150_1602 150
146 3300049586 Ga0501070_0068029 Ga0501070_0068029_770_1222 150
147 3300049586 Ga0501070_0113726 Ga0501070_0113726_1444_1896 150
148 3300049588 Ga0501072_0037582 Ga0501072_0037582_994_1446 150
149 3300049588 Ga0501072_0913327 Ga0501072_0913327_195_647 150
150 3300049589 Ga0501073_0012474 Ga0501073_0012474_2880_3332 150
151 3300049590 Ga0501074_0029691 Ga0501074_0029691_1693_2145 150
152 3300049742 Ga0501080_0021239 Ga0501080_0021239_4880_5332 150
153 3300049744 Ga0501083_0026625 Ga0501083_0026625_1700_2152 150
154 3300050507 nmdc:mga05p37_296888_c1 nmdc:mga05p37_296888_c1_65_517 150
155 3300050511 nmdc:mga08y16_295725_c1 nmdc:mga08y16_295725_c1_810_1262 150
156 3300050512 nmdc:mga0n895_723001_c1 nmdc:mga0n895_723001_c1_119_571 150
157 3300005356 Ga0070674_100000023 Ga0070674_10000002328 151
158 3300005364 Ga0070673_100034198 Ga0070673_1000341983 151
159 3300005563 Ga0068855_100785795 Ga0068855_1007857951 151
160 3300005718 Ga0068866_10000008 Ga0068866_1000000894 151
161 3300006048 Ga0075363_100043885 Ga0075363_1000438854 151
162 3300006048 Ga0075363_100063340 Ga0075363_1000633402 151
163 3300006178 Ga0075367_10367945 Ga0075367_103679452 151
164 3300025899 Ga0207642_10000002 Ga0207642_10000002575 151
165 3300025907 Ga0207645_10370058 Ga0207645_103700581 151
166 3300025937 Ga0207669_10000026 Ga0207669_1000002635 151
167 3300025949 Ga0207667_10695065 Ga0207667_106950651 151
168 3300025960 Ga0207651_10077887 Ga0207651_100778872 151
169 3300028556 Ga0265337_1000066 Ga0265337_100006649 151
170 3300028558 Ga0265326_10000258 Ga0265326_1000025825 151
171 3300028653 Ga0265323_10126925 Ga0265323_101269251 151
172 3300028654 Ga0265322_10000011 Ga0265322_10000011169 151
173 3300029957 Ga0265324_10001593 Ga0265324_1000159314 151
174 3300031238 Ga0265332_10023227 Ga0265332_100232274 151
175 3300031239 Ga0265328_10020121 Ga0265328_100201214 151
176 3300031240 Ga0265320_10000011 Ga0265320_10000011169 151
177 3300031249 Ga0265339_10046644 Ga0265339_100466442 151
178 3300031250 Ga0265331_10017439 Ga0265331_100174394 151
179 3300031251 Ga0265327_10000015 Ga0265327_10000015277 151
180 3300031344 Ga0265316_10103852 Ga0265316_101038523 151
181 3300031711 Ga0265314_10000640 Ga0265314_100006408 151
182 3300031712 Ga0265342_10196036 Ga0265342_101960361 151
183 3300037588 Ga0316581_0083452 Ga0316581_0083452_157_612 151
184 3300041460 Ga0451802_1963968 Ga0451802_1963968_291_746 151
185 3300045976 Ga0466967_1788770 Ga0466967_1788770_94_549 151
186 3300046455 Ga0495603_0000098 Ga0495603_0000098_27119_27574 151
187 3300049576 Ga0501040_0210967 Ga0501040_0210967_275_730 151
188 3300049578 Ga0501042_0325449 Ga0501042_0325449_26_481 151
189 3300049592 Ga0501076_0121940 Ga0501076_0121940_250_705 151
190 3300049822 Ga0501035_1295033 Ga0501035_1295033_65_520 151
191 3300049824 Ga0501045_0428556 Ga0501045_0428556_325_780 151
192 3300050490 nmdc:mga03n38_12408_c1 nmdc:mga03n38_12408_c1_418_873 151
193 3300061734 Ga0530510_0668231 Ga0530510_0668231_163_618 151
194 3300005329 Ga0070683_100074987 Ga0070683_1000749873 152
195 3300005340 Ga0070689_100165032 Ga0070689_1001650322 152
196 3300005439 Ga0070711_100000890 Ga0070711_10000089016 152
197 3300005535 Ga0070684_100083342 Ga0070684_1000833421 152
198 3300005539 Ga0068853_100111883 Ga0068853_1001118833 152
199 3300005549 Ga0070704_100206263 Ga0070704_1002062633 152
200 3300005614 Ga0068856_100313647 Ga0068856_1003136472 152
201 3300005841 Ga0068863_100000022 Ga0068863_10000002296 152
202 3300005937 Ga0081455_10009419 Ga0081455_100094197 152
203 3300006048 Ga0075363_100003127 Ga0075363_1000031274 152
204 3300006178 Ga0075367_10058807 Ga0075367_100588073 152
205 3300009551 Ga0105238_10000055 Ga0105238_1000005550 152
206 3300025916 Ga0207663_10000409 Ga0207663_1000040919 152
207 3300025924 Ga0207694_10000063 Ga0207694_1000006391 152
208 3300025936 Ga0207670_10074491 Ga0207670_100744914 152
209 3300025944 Ga0207661_10004833 Ga0207661_100048338 152
210 3300026023 Ga0207677_10256613 Ga0207677_102566131 152
211 3300026041 Ga0207639_10043346 Ga0207639_100433463 152
212 3300026088 Ga0207641_10000016 Ga0207641_10000016217 152
213 3300046455 Ga0495603_0012212 Ga0495603_0012212_4672_5130 152
214 3300046516 Ga0495628_0020312 Ga0495628_0020312_4586_5044 152
215 3300046523 Ga0495644_0003637 Ga0495644_0003637_2859_3317 152
216 3300046537 Ga0495598_0009877 Ga0495598_0009877_93_551 152
217 3300046663 Ga0495635_0000076 Ga0495635_0000076_30930_31388 152
218 3300046675 Ga0495657_0040035 Ga0495657_0040035_1405_1863 152
219 3300046681 Ga0495647_0023040 Ga0495647_0023040_1106_1564 152
220 3300046689 Ga0495613_0000005 Ga0495613_0000005_76528_76986 152
221 3300048909 Ga0496106_0000959 Ga0496106_0000959_19983_20441 152
222 3300048910 Ga0496107_0058453 Ga0496107_0058453_1767_2225 152
223 3300048916 Ga0496113_0095770 Ga0496113_0095770_706_1164 152
224 3300049575 Ga0501039_0087018 Ga0501039_0087018_886_1344 152
225 3300049580 Ga0501046_0620739 Ga0501046_0620739_153_611 152
226 3300049584 Ga0501068_0081190 Ga0501068_0081190_311_769 152
227 3300049587 Ga0501071_0227839 Ga0501071_0227839_734_1192 152
228 3300049587 Ga0501071_0422086 Ga0501071_0422086_167_625 152
229 3300049588 Ga0501072_0383728 Ga0501072_0383728_64_522 152
230 3300049592 Ga0501076_0020528 Ga0501076_0020528_784_1242 152
231 3300049741 Ga0501079_0244895 Ga0501079_0244895_544_1002 152
232 3300049741 Ga0501079_0824507 Ga0501079_0824507_18_476 152
233 3300049743 Ga0501081_0006533 Ga0501081_0006533_7083_7541 152
234 3300049743 Ga0501081_0140755 Ga0501081_0140755_1196_1654 152
235 3300049824 Ga0501045_0034325 Ga0501045_0034325_399_857 152
236 3300050490 nmdc:mga03n38_62622_c1 nmdc:mga03n38_62622_c1_342_800 152
237 3300050494 nmdc:mga06z11_131291_c1 nmdc:mga06z11_131291_c1_530_988 152
238 3300053085 Ga0495619_0009341 Ga0495619_0009341_4544_5002 152
239 3300054114 Ga0501084_0053133 Ga0501084_0053133_1785_2243 152
240 3300060353 Ga0501082_0166744 Ga0501082_0166744_60_518 152
241 3300061734 Ga0530510_1550613 Ga0530510_1550613_17_475 152
242 3300002459 JGI24751J29686_10044781 JGI24751J29686_100447812 153
243 3300003373 JGI25407J50210_10004099 JGI25407J50210_100040993 153
244 3300003373 JGI25407J50210_10014098 JGI25407J50210_100140983 153
245 3300003373 JGI25407J50210_10024103 JGI25407J50210_100241033 153
246 3300003373 JGI25407J50210_10034497 JGI25407J50210_100344972 153
247 3300003373 JGI25407J50210_10129969 JGI25407J50210_101299692 153
248 3300004803 Ga0058862_12288466 Ga0058862_122884661 153
249 3300005329 Ga0070683_100009211 Ga0070683_1000092113 153
250 3300005329 Ga0070683_100061772 Ga0070683_1000617723 153
251 3300005336 Ga0070680_100015195 Ga0070680_1000151955 153
252 3300005338 Ga0068868_100135247 Ga0068868_1001352472 153
253 3300005344 Ga0070661_100044128 Ga0070661_1000441281 153
254 3300005366 Ga0070659_100006778 Ga0070659_1000067782 153
255 3300005456 Ga0070678_100200630 Ga0070678_1002006302 153
256 3300005458 Ga0070681_10016016 Ga0070681_100160166 153
257 3300005530 Ga0070679_100000562 Ga0070679_1000005624 153
258 3300005530 Ga0070679_100605633 Ga0070679_1006056332 153
259 3300005535 Ga0070684_100006512 Ga0070684_1000065127 153
260 3300005539 Ga0068853_100113347 Ga0068853_1001133474 153
261 3300005563 Ga0068855_100432986 Ga0068855_1004329863 153
262 3300005564 Ga0070664_100054411 Ga0070664_1000544114 153
263 3300005577 Ga0068857_100070967 Ga0068857_1000709674 153
264 3300005614 Ga0068856_100012117 Ga0068856_1000121177 153
265 3300005616 Ga0068852_100003090 Ga0068852_1000030904 153
266 3300005618 Ga0068864_100308717 Ga0068864_1003087172 153
267 3300005937 Ga0081455_10158270 Ga0081455_101582702 153
268 3300005981 Ga0081538_10000020 Ga0081538_1000002058 153
269 3300005981 Ga0081538_10000087 Ga0081538_100000876 153
270 3300005981 Ga0081538_10000200 Ga0081538_1000020046 153
271 3300005981 Ga0081538_10000316 Ga0081538_1000031647 153
272 3300005981 Ga0081538_10001262 Ga0081538_100012625 153
273 3300005981 Ga0081538_10002984 Ga0081538_1000298410 153
274 3300005981 Ga0081538_10003006 Ga0081538_1000300615 153
275 3300005981 Ga0081538_10011351 Ga0081538_100113514 153
276 3300005981 Ga0081538_10014003 Ga0081538_100140035 153
277 3300005981 Ga0081538_10023516 Ga0081538_100235163 153
278 3300005981 Ga0081538_10056569 Ga0081538_100565694 153
279 3300005981 Ga0081538_10141096 Ga0081538_101410962 153
280 3300005983 Ga0081540_1019200 Ga0081540_10192003 153
281 3300006844 Ga0075428_100036072 Ga0075428_1000360723 153
282 3300006844 Ga0075428_100517024 Ga0075428_1005170241 153
283 3300006846 Ga0075430_100017993 Ga0075430_1000179934 153
284 3300006846 Ga0075430_100024067 Ga0075430_1000240675 153
285 3300006847 Ga0075431_100040268 Ga0075431_1000402685 153
286 3300006880 Ga0075429_100145956 Ga0075429_1001459562 153
287 3300009093 Ga0105240_10211296 Ga0105240_102112962 153
288 3300009098 Ga0105245_10000130 Ga0105245_100001309 153
289 3300009147 Ga0114129_10281490 Ga0114129_102814903 153
290 3300009174 Ga0105241_10351538 Ga0105241_103515382 153
291 3300009545 Ga0105237_10143140 Ga0105237_101431401 153
292 3300009551 Ga0105238_10207681 Ga0105238_102076813 153
293 3300013102 Ga0157371_10386651 Ga0157371_103866512 153
294 3300013104 Ga0157370_10018240 Ga0157370_100182406 153
295 3300013307 Ga0157372_10252137 Ga0157372_102521373 153
296 3300020080 Ga0206350_11216546 Ga0206350_112165462 153
297 3300022467 Ga0224712_10178088 Ga0224712_101780883 153
298 3300025893 Ga0207682_10000091 Ga0207682_1000009127 153
299 3300025912 Ga0207707_10034275 Ga0207707_100342757 153
300 3300025913 Ga0207695_10148199 Ga0207695_101481992 153
301 3300025920 Ga0207649_10024835 Ga0207649_100248352 153
302 3300025921 Ga0207652_10007110 Ga0207652_100071107 153
303 3300025921 Ga0207652_10048894 Ga0207652_100488942 153
304 3300025924 Ga0207694_10052609 Ga0207694_100526094 153
305 3300025927 Ga0207687_10000032 Ga0207687_1000003248 153
306 3300025932 Ga0207690_10005375 Ga0207690_100053755 153
307 3300025944 Ga0207661_10050338 Ga0207661_100503382 153
308 3300025945 Ga0207679_10029452 Ga0207679_100294523 153
309 3300025949 Ga0207667_10537124 Ga0207667_105371243 153
310 3300026023 Ga0207677_10000284 Ga0207677_1000028428 153
311 3300026041 Ga0207639_10165960 Ga0207639_101659602 153
312 3300026078 Ga0207702_10000789 Ga0207702_100007894 153
313 3300026116 Ga0207674_10214947 Ga0207674_102149473 153
314 3300026121 Ga0207683_10116184 Ga0207683_101161842 153
315 3300026142 Ga0207698_10284776 Ga0207698_102847762 153
316 3300037466 Ga0395898_0046596 Ga0395898_0046596_782_1243 153
317 3300038443 Ga0395901_0485665 Ga0395901_0485665_673_1134 153
318 3300041512 Ga0451853_1381199 Ga0451853_1381199_203_664 153
319 3300042016 Ga0439463_065184 Ga0439463_065184_221_682 153
320 3300042993 Ga0439440_0062209 Ga0439440_0062209_308_769 153
321 3300046513 Ga0495616_0263003 Ga0495616_0263003_182_643 153
322 3300046515 Ga0495620_0000139 Ga0495620_0000139_35206_35670 153
323 3300046523 Ga0495644_0051710 Ga0495644_0051710_981_1442 153
324 3300046543 Ga0495645_0543970 Ga0495645_0543970_23_487 153
325 3300046678 Ga0495599_0044192 Ga0495599_0044192_1328_1792 153
326 3300046680 Ga0495646_0396312 Ga0495646_0396312_202_666 153
327 3300047321 Ga0495676_0000621 Ga0495676_0000621_12247_12711 153
328 3300048913 Ga0496110_0885656 Ga0496110_0885656_313_774 153
329 3300048914 Ga0496111_0182103 Ga0496111_0182103_626_1087 153
330 3300048915 Ga0496112_0592178 Ga0496112_0592178_552_1013 153
331 3300049572 Ga0501036_0261934 Ga0501036_0261934_398_859 153
332 3300049574 Ga0501038_0303982 Ga0501038_0303982_527_988 153
333 3300049575 Ga0501039_0096184 Ga0501039_0096184_322_783 153
334 3300049577 Ga0501041_0293434 Ga0501041_0293434_349_810 153
335 3300049578 Ga0501042_0168954 Ga0501042_0168954_657_1118 153
336 3300049580 Ga0501046_0226583 Ga0501046_0226583_177_638 153
337 3300049587 Ga0501071_0011903 Ga0501071_0011903_1431_1892 153
338 3300049588 Ga0501072_0019175 Ga0501072_0019175_641_1102 153
339 3300049591 Ga0501075_0205618 Ga0501075_0205618_613_1074 153
340 3300049592 Ga0501076_0013062 Ga0501076_0013062_4266_4727 153
341 3300049744 Ga0501083_0275587 Ga0501083_0275587_554_1015 153
342 3300049822 Ga0501035_0349816 Ga0501035_0349816_429_890 153
343 3300049824 Ga0501045_0031387 Ga0501045_0031387_2288_2749 153
344 3300050507 nmdc:mga05p37_5570_c1 nmdc:mga05p37_5570_c1_568_1029 153
345 3300050508 nmdc:mga09592_153506_c1 nmdc:mga09592_153506_c1_322_783 153
346 3300050509 nmdc:mga0qj67_71953_c1 nmdc:mga0qj67_71953_c1_1478_1939 153
347 3300050510 nmdc:mga06r32_8783_c1 nmdc:mga06r32_8783_c1_3023_3484 153
348 3300050514 nmdc:mga08x19_830496_c1 nmdc:mga08x19_830496_c1_69_530 153
349 3300054114 Ga0501084_0059575 Ga0501084_0059575_2028_2489 153
350 3300060353 Ga0501082_0069697 Ga0501082_0069697_2064_2525 153
351 3300061734 Ga0530510_0042026 Ga0530510_0042026_973_1434 153
352 3300002075 JGI24738J21930_10030221 JGI24738J21930_100302213 154
353 3300005328 Ga0070676_10135808 Ga0070676_101358083 154
354 3300005329 Ga0070683_100104441 Ga0070683_1001044412 154
355 3300005331 Ga0070670_100068363 Ga0070670_1000683634 154
356 3300005336 Ga0070680_100276903 Ga0070680_1002769032 154
357 3300005337 Ga0070682_100015778 Ga0070682_1000157783 154
358 3300005338 Ga0068868_100016482 Ga0068868_1000164825 154
359 3300005339 Ga0070660_100001597 Ga0070660_10000159716 154
360 3300005345 Ga0070692_10002364 Ga0070692_100023643 154
361 3300005347 Ga0070668_100029447 Ga0070668_1000294473 154
362 3300005353 Ga0070669_100170107 Ga0070669_1001701073 154
363 3300005354 Ga0070675_100037444 Ga0070675_1000374443 154
364 3300005355 Ga0070671_100157943 Ga0070671_1001579433 154
365 3300005364 Ga0070673_100042577 Ga0070673_1000425773 154
366 3300005365 Ga0070688_100005806 Ga0070688_1000058065 154
367 3300005366 Ga0070659_100063542 Ga0070659_1000635423 154
368 3300005440 Ga0070705_100313479 Ga0070705_1003134792 154
369 3300005441 Ga0070700_100031473 Ga0070700_1000314733 154
370 3300005455 Ga0070663_100080369 Ga0070663_1000803693 154
371 3300005457 Ga0070662_100010770 Ga0070662_1000107702 154
372 3300005459 Ga0068867_100070425 Ga0068867_1000704254 154
373 3300005466 Ga0070685_10138107 Ga0070685_101381073 154
374 3300005530 Ga0070679_100286176 Ga0070679_1002861763 154
375 3300005535 Ga0070684_100027692 Ga0070684_1000276923 154
376 3300005543 Ga0070672_100029952 Ga0070672_1000299523 154
377 3300005547 Ga0070693_101321333 Ga0070693_1013213331 154
378 3300005548 Ga0070665_100198305 Ga0070665_1001983053 154
379 3300005564 Ga0070664_100001579 Ga0070664_10000157919 154
380 3300005577 Ga0068857_101597284 Ga0068857_1015972841 154
381 3300005578 Ga0068854_100095314 Ga0068854_1000953142 154
382 3300005614 Ga0068856_100344889 Ga0068856_1003448893 154
383 3300005616 Ga0068852_100030492 Ga0068852_1000304924 154
384 3300005617 Ga0068859_100697094 Ga0068859_1006970942 154
385 3300005842 Ga0068858_100222660 Ga0068858_1002226603 154
386 3300005844 Ga0068862_100040409 Ga0068862_1000404093 154
387 3300006038 Ga0075365_10026747 Ga0075365_100267475 154
388 3300006048 Ga0075363_100028232 Ga0075363_1000282324 154
389 3300006051 Ga0075364_10003821 Ga0075364_100038218 154
390 3300006358 Ga0068871_100481622 Ga0068871_1004816221 154
391 3300006881 Ga0068865_100044422 Ga0068865_1000444223 154
392 3300006931 Ga0097620_100697096 Ga0097620_1006970962 154
393 3300009098 Ga0105245_10035564 Ga0105245_100355644 154
394 3300009176 Ga0105242_10331211 Ga0105242_103312113 154
395 3300009545 Ga0105237_10367605 Ga0105237_103676053 154
396 3300009553 Ga0105249_10131265 Ga0105249_101312652 154
397 3300010375 Ga0105239_10047701 Ga0105239_100477017 154
398 3300013308 Ga0157375_10009814 Ga0157375_100098143 154
399 3300013308 Ga0157375_10027112 Ga0157375_100271125 154
400 3300014325 Ga0163163_10476680 Ga0163163_104766802 154
401 3300014326 Ga0157380_10050523 Ga0157380_100505233 154
402 3300014745 Ga0157377_10017055 Ga0157377_100170553 154
403 3300025905 Ga0207685_10000028 Ga0207685_1000002891 154
404 3300025907 Ga0207645_10035432 Ga0207645_100354323 154
405 3300025908 Ga0207643_10026611 Ga0207643_100266112 154
406 3300025909 Ga0207705_10068595 Ga0207705_100685952 154
407 3300025917 Ga0207660_10328994 Ga0207660_103289942 154
408 3300025919 Ga0207657_10001730 Ga0207657_100017308 154
409 3300025921 Ga0207652_10785116 Ga0207652_107851162 154
410 3300025923 Ga0207681_10648894 Ga0207681_106488942 154
411 3300025925 Ga0207650_10137294 Ga0207650_101372942 154
412 3300025926 Ga0207659_10050631 Ga0207659_100506314 154
413 3300025927 Ga0207687_10124930 Ga0207687_101249304 154
414 3300025933 Ga0207706_10013020 Ga0207706_100130203 154
415 3300025934 Ga0207686_10119007 Ga0207686_101190073 154
416 3300025935 Ga0207709_10037526 Ga0207709_100375263 154
417 3300025938 Ga0207704_10162587 Ga0207704_101625873 154
418 3300025940 Ga0207691_10043066 Ga0207691_100430664 154
419 3300025941 Ga0207711_10613165 Ga0207711_106131651 154
420 3300025942 Ga0207689_10591714 Ga0207689_105917142 154
421 3300025945 Ga0207679_10039656 Ga0207679_100396564 154
422 3300025981 Ga0207640_10083523 Ga0207640_100835232 154
423 3300026023 Ga0207677_10021626 Ga0207677_100216265 154
424 3300026035 Ga0207703_10000088 Ga0207703_1000008829 154
425 3300026067 Ga0207678_10046454 Ga0207678_100464543 154
426 3300026075 Ga0207708_10085173 Ga0207708_100851733 154
427 3300026078 Ga0207702_10871807 Ga0207702_108718072 154
428 3300026088 Ga0207641_10662573 Ga0207641_106625732 154
429 3300026089 Ga0207648_10010849 Ga0207648_100108497 154
430 3300026116 Ga0207674_10241948 Ga0207674_102419482 154
431 3300026142 Ga0207698_10108699 Ga0207698_101086992 154
432 3300028379 Ga0268266_11477169 Ga0268266_114771691 154
433 3300028380 Ga0268265_10104081 Ga0268265_101040813 154
434 3300031731 Ga0307405_10161819 Ga0307405_101618193 154
435 3300031731 Ga0307405_11098232 Ga0307405_110982322 154
436 3300031852 Ga0307410_10272076 Ga0307410_102720763 154
437 3300031903 Ga0307407_10129227 Ga0307407_101292273 154
438 3300031911 Ga0307412_10221951 Ga0307412_102219513 154
439 3300031995 Ga0307409_100115851 Ga0307409_1001158512 154
440 3300031995 Ga0307409_100349521 Ga0307409_1003495211 154
441 3300032002 Ga0307416_100342552 Ga0307416_1003425523 154
442 3300032004 Ga0307414_10090789 Ga0307414_100907892 154
443 3300032005 Ga0307411_10371944 Ga0307411_103719443 154
444 3300032126 Ga0307415_100095274 Ga0307415_1000952743 154
445 3300037312 Ga0395899_0044635 Ga0395899_0044635_2074_2547 154
446 3300037418 Ga0395900_0037978 Ga0395900_0037978_2506_2979 154
447 3300037418 Ga0395900_0321962 Ga0395900_0321962_29_502 154
448 3300037466 Ga0395898_0002264 Ga0395898_0002264_14135_14608 154
449 3300037466 Ga0395898_0586944 Ga0395898_0586944_459_932 154
450 3300037471 Ga0395905_0010918 Ga0395905_0010918_2749_3222 154
451 3300037471 Ga0395905_0811888 Ga0395905_0811888_334_807 154
452 3300038443 Ga0395901_0008042 Ga0395901_0008042_3538_4011 154
453 3300038443 Ga0395901_1309508 Ga0395901_1309508_69_542 154
454 3300038443 Ga0395901_1419740 Ga0395901_1419740_97_570 154
455 3300038443 Ga0395901_1570750 Ga0395901_1570750_119_592 154
456 3300045976 Ga0466967_0608231 Ga0466967_0608231_353_817 154
457 3300046454 Ga0495592_0000261 Ga0495592_0000261_38861_39328 154
458 3300046462 Ga0495651_0097078 Ga0495651_0097078_844_1311 154
459 3300046516 Ga0495628_0391221 Ga0495628_0391221_256_723 154
460 3300046559 Ga0495667_0000020 Ga0495667_0000020_93644_94111 154
461 3300046559 Ga0495667_0121481 Ga0495667_0121481_1072_1539 154
462 3300046663 Ga0495635_0357469 Ga0495635_0357469_164_640 154
463 3300046691 Ga0495670_0029226 Ga0495670_0029226_608_1072 154
464 3300047673 Ga0495593_0083183 Ga0495593_0083183_1017_1484 154
465 3300048089 Ga0495614_0026577 Ga0495614_0026577_1584_2051 154
466 3300048904 Ga0496101_0147054 Ga0496101_0147054_1082_1546 154
467 3300048909 Ga0496106_0321234 Ga0496106_0321234_656_1120 154
468 3300048910 Ga0496107_0097351 Ga0496107_0097351_1152_1616 154
469 3300048911 Ga0496108_0097565 Ga0496108_0097565_596_1060 154
470 3300048911 Ga0496108_0149270 Ga0496108_0149270_938_1411 154
471 3300048912 Ga0496109_0002374 Ga0496109_0002374_11889_12353 154
472 3300048912 Ga0496109_0056672 Ga0496109_0056672_2621_3094 154
473 3300048912 Ga0496109_0863316 Ga0496109_0863316_100_576 154
474 3300048913 Ga0496110_0102093 Ga0496110_0102093_1415_1879 154
475 3300048913 Ga0496110_0200089 Ga0496110_0200089_64_531 154
476 3300048913 Ga0496110_0270200 Ga0496110_0270200_814_1281 154
477 3300048913 Ga0496110_0407145 Ga0496110_0407145_696_1169 154
478 3300048914 Ga0496111_0047372 Ga0496111_0047372_1711_2175 154
479 3300048914 Ga0496111_0613863 Ga0496111_0613863_318_785 154
480 3300048914 Ga0496111_0645935 Ga0496111_0645935_119_586 154
481 3300048915 Ga0496112_0209887 Ga0496112_0209887_1193_1666 154
482 3300048915 Ga0496112_0450546 Ga0496112_0450546_465_947 154
483 3300048915 Ga0496112_1044441 Ga0496112_1044441_154_621 154
484 3300048916 Ga0496113_0029550 Ga0496113_0029550_1821_2294 154
485 3300048916 Ga0496113_0454456 Ga0496113_0454456_156_620 154
486 3300048917 Ga0496114_0155266 Ga0496114_0155266_166_630 154
487 3300049569 Ga0501032_0713240 Ga0501032_0713240_100_564 154
488 3300049578 Ga0501042_0523410 Ga0501042_0523410_333_800 154
489 3300049587 Ga0501071_0401560 Ga0501071_0401560_230_697 154
490 3300049593 Ga0501077_0258408 Ga0501077_0258408_261_746 154
491 3300049743 Ga0501081_0297472 Ga0501081_0297472_577_1041 154
492 3300050490 nmdc:mga03n38_87607_c1 nmdc:mga03n38_87607_c1_114_578 154
493 3300050491 nmdc:mga00v17_6297_c1 nmdc:mga00v17_6297_c1_5652_6116 154
494 3300050492 nmdc:mga0yw44_350690_c1 nmdc:mga0yw44_350690_c1_313_777 154
495 3300050492 nmdc:mga0yw44_54734_c1 nmdc:mga0yw44_54734_c1_1403_1867 154
496 3300050515 nmdc:mga0a205_62793_c1 nmdc:mga0a205_62793_c1_2336_2803 154
497 3300053083 Ga0495655_0047404 Ga0495655_0047404_62_532 154
498 3300053085 Ga0495619_0000008 Ga0495619_0000008_217348_217815 154

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

4

129

0.99

PF08534

Redoxin

Redoxin

3

143

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5c04-assembly1.cif.gz_B crystal structure of the f37h mutant ahpe from mycobacterium tuberculosis 0.9591 1 150
5id2-assembly1.cif.gz_B asymmetry in the active site of mycobacterium tuberculosis ahpe upon exposure to mycothiol 0.9483 1 150
4xih-assembly1.cif.gz_B-2 crystal structure of the r116a mutant ahpe from mycobacterium tuberculosis 0.9458 2 150
1xvw-assembly1.cif.gz_B crystal structure of ahpe from mycobacterium tuberculosis, a 1-cys peroxiredoxin 0.9419 1 150
5c04-assembly1.cif.gz_B crystal structure of the f37h mutant ahpe from mycobacterium tuberculosis 0.9347 1 150
ID Description Score Start End Superfamily
5id2B00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9483 1 150 3.40.30.10
af_Q559T9_1_157_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9201 2 150 3.40.30.10
5id2B00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9186 1 150 3.40.30.10
af_P9WQB7_4_193_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9123 2 150 3.40.30.10
4af2A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9122 1 148 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A538A886-F1-model_v4 Redoxin domain-containing protein 0.9937 1 150 GO:0016209
GO:0016491
AF-A0A2W5YSI4-F1-model_v4 Alkyl hydroperoxide reductase 0.9854 2 149 GO:0016209
GO:0016491
AF-A0A7W0A7D4-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9848 1 148 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A1Q7ZC26-F1-model_v4 Thioredoxin domain-containing protein 0.9848 19 150 GO:0005829
GO:0006979
GO:0008379
GO:0033554
GO:0042744
GO:0045454
AF-A0A2V6A5L3-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9821 21 150 GO:0005737
GO:0008379
GO:0034599
GO:0045454

Feature Viewer

pLDDT pTM Quality
94.46 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map