F455223

General Info

Members Datasets Scaffolds Average Seq Length
498 242 996 347

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0004030|Ga0395900_0004030_7144_8280
Length 378
Sequence VKVEATAYGDRKVFSVSAFNRGVATWLQRLPTVWVEGEVTELKRHPRWQSVFFTLKDPGDGACLGVSIPRGQFDGLRLDLVDGDRVHAYGRPELYAARGEFRLRALSLERFGLGDHLAALERLKHKLAAEGLFAAQRKRRLPVWPRAIGLVTGNDAAAKRDVLTGIQARFPPAHVIVAETYVQGPRAAAAVVDAIRRLAEVTDVIVVARGGGSFEDLLPFSDERLVRAIAACPVPVVSAVGHEQDTPLCDLAADVRASTPTAAARLVVPDLGELRERLDRSRAALGAGARRSLDRDAQRLAATHARLRRAPTLLLERRRAALEHTAGRLRVLSPQATLNRGYAIVRADESIVRSAKAVQPGDRIDVEVGDGRFGARVE

Samples

Sample ID Description Type Environment
1 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
51 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
126 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
127 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
128 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
129 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
130 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
131 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
132 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
133 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
134 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
135 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
136 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
137 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
138 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
139 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
140 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
141 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
142 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
143 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
144 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
145 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
146 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
147 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
148 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
149 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
150 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
151 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
152 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
153 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
154 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
155 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
156 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
157 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
158 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
159 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
160 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
161 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
162 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
163 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
164 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
165 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
166 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
167 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
168 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
169 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
170 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
171 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
172 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
173 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
174 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
175 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
176 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
177 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
178 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
179 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
180 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
181 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
182 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
183 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
184 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
185 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
186 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
187 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
188 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
189 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
190 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
191 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
192 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
193 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
194 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
195 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
196 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
197 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
198 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
199 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
200 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
201 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
202 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
215 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
216 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
217 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
218 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
219 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
220 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
221 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
222 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
223 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
224 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
225 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
226 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
227 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
228 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
230 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
231 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
232 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
233 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
234 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
235 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
236 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
237 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
238 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
239 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
240 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
241 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
242 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.2
Metatranscriptomes 0.8
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.2
Nodule 0
Rhizoplane 12.85
Rhizosphere 86.75
Stem 0
Stem Tuber 0
Unclassified 4.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395900_0004030 3300037418 Bacteria 15679
2 Ga0070658_10027094 3300005327 Bacteria 4601
3 Ga0070683_100018859 3300005329 Bacteria 6121
4 Ga0070683_100066932 3300005329 Bacteria 3346
5 Ga0070690_100018298 3300005330 Bacteria 4230
6 Ga0068869_100128799 3300005334 Bacteria 1943
7 Ga0070680_100028188 3300005336 Bacteria 4504
8 Ga0070682_100010138 3300005337 Bacteria 5342
9 Ga0070682_100019386 3300005337 Bacteria 3990
10 Ga0068868_100018815 3300005338 Bacteria 5168
11 Ga0068868_100100698 3300005338 Bacteria 2338
12 Ga0070660_100007384 3300005339 Bacteria 7656
13 Ga0070660_100063824 3300005339 Unclassified 2864
14 Ga0070691_10007499 3300005341 Bacteria 5000
15 Ga0070691_10012953 3300005341 Bacteria 3818
16 Ga0070687_100009395 3300005343 Bacteria 4189
17 Ga0070692_10033665 3300005345 Unclassified 2582
18 Ga0070668_100007521 3300005347 Bacteria 8089
19 Ga0070688_100147210 3300005365 Bacteria 1606
20 Ga0070659_100213081 3300005366 Bacteria 1592
21 Ga0070709_10110978 3300005434 Bacteria 1843
22 Ga0070709_10187227 3300005434 Bacteria 1458
23 Ga0070714_100007895 3300005435 Bacteria 8288
24 Ga0070714_100082541 3300005435 Bacteria 2800
25 Ga0070713_100043484 3300005436 Bacteria 3673
26 Ga0070713_100130651 3300005436 Bacteria 2214
27 Ga0070711_100047675 3300005439 Bacteria 2926
28 Ga0070705_100008683 3300005440 Bacteria 5033
29 Ga0070694_100136589 3300005444 Bacteria 1777
30 Ga0070708_100028029 3300005445 Bacteria 4842
31 Ga0070663_100014232 3300005455 Bacteria 5101
32 Ga0070662_100038998 3300005457 Bacteria 3377
33 Ga0070662_100092926 3300005457 Bacteria 2268
34 Ga0070681_10038101 3300005458 Bacteria 4820
35 Ga0070681_10043116 3300005458 Bacteria 4521
36 Ga0070681_10098404 3300005458 Bacteria 2871
37 Ga0068867_100040543 3300005459 Bacteria 3399
38 Ga0068867_100048590 3300005459 Unclassified 3122
39 Ga0070706_100248032 3300005467 Bacteria 1662
40 Ga0070707_100001269 3300005468 Bacteria 24819
41 Ga0070698_100013492 3300005471 Bacteria 8649
42 Ga0070698_100015114 3300005471 Bacteria 8161
43 Ga0070698_100145661 3300005471 Unclassified 2318
44 Ga0070699_100024764 3300005518 Bacteria 5174
45 Ga0070679_100002322 3300005530 Bacteria 17205
46 Ga0070684_100048084 3300005535 Bacteria 3700
47 Ga0070697_100027123 3300005536 Bacteria 4580
48 Ga0070672_100021765 3300005543 Bacteria 4696
49 Ga0070686_100017555 3300005544 Bacteria 4184
50 Ga0070686_100101284 3300005544 Bacteria 1946
51 Ga0070695_100010874 3300005545 Bacteria 5437
52 Ga0070695_100032798 3300005545 Archaea 3247
53 Ga0070696_100016581 3300005546 Bacteria 4965
54 Ga0070696_100202512 3300005546 Bacteria 1482
55 Ga0070693_100000985 3300005547 Bacteria 12684
56 Ga0070665_100179871 3300005548 Bacteria 2116
57 Ga0070704_100009893 3300005549 Bacteria 5785
58 Ga0070704_100040861 3300005549 Bacteria 3196
59 Ga0068855_100023013 3300005563 Bacteria 7467
60 Ga0068855_100180611 3300005563 Bacteria 2386
61 Ga0070664_100148615 3300005564 Bacteria 2068
62 Ga0068857_100008660 3300005577 Bacteria 8804
63 Ga0068854_100013141 3300005578 Bacteria 5428
64 Ga0068854_100023724 3300005578 Bacteria 4192
65 Ga0068856_100034182 3300005614 Bacteria 4980
66 Ga0068856_100198346 3300005614 Bacteria 2021
67 Ga0068861_100004166 3300005719 Bacteria 9695
68 Ga0068861_100017868 3300005719 Bacteria 5040
69 Ga0068863_100114570 3300005841 Bacteria 2568
70 Ga0068862_100092971 3300005844 Unclassified 2629
71 Ga0081455_10025164 3300005937 Bacteria 5498
72 Ga0081538_10001642 3300005981 Bacteria 22944
73 Ga0081538_10004902 3300005981 Bacteria 12193
74 Ga0081540_1004845 3300005983 Bacteria 10141
75 Ga0081539_10000068 3300005985 Bacteria 240998
76 Ga0081539_10002069 3300005985 Bacteria 30045
77 Ga0081539_10002415 3300005985 Bacteria 26433
78 Ga0070717_10060763 3300006028 Bacteria 3130
79 Ga0075365_10132942 3300006038 Bacteria 1723
80 Ga0075432_10012002 3300006058 Bacteria 2944
81 Ga0075432_10014395 3300006058 Bacteria 2695
82 Ga0070715_10007406 3300006163 Bacteria 3777
83 Ga0070716_100117906 3300006173 Bacteria 1656
84 Ga0070712_100046079 3300006175 Unclassified 3013
85 Ga0070712_100164215 3300006175 Bacteria 1717
86 Ga0097621_100033631 3300006237 Bacteria 4084
87 Ga0068871_100021629 3300006358 Bacteria 4947
88 Ga0075428_100000193 3300006844 Bacteria 57756
89 Ga0075428_100010997 3300006844 Bacteria 10065
90 Ga0075428_100484733 3300006844 Bacteria 1323
91 Ga0075431_100051424 3300006847 Bacteria 4249
92 Ga0075431_100071298 3300006847 Bacteria 3585
93 Ga0075433_10006294 3300006852 Bacteria 9375
94 Ga0075433_10009272 3300006852 Bacteria 7869
95 Ga0075433_10106942 3300006852 Bacteria 2480
96 Ga0075434_100001955 3300006871 Bacteria 17864
97 Ga0075434_100049069 3300006871 Bacteria 4190
98 Ga0075434_100062528 3300006871 Unclassified 3706
99 Ga0068865_100008729 3300006881 Bacteria 6270
100 Ga0075436_100010572 3300006914 Bacteria 6329
101 Ga0075436_100022366 3300006914 Bacteria 4342
102 Ga0075435_100002683 3300007076 Bacteria 11878
103 Ga0075435_100003120 3300007076 Bacteria 11194
104 Ga0075435_100015628 3300007076 Bacteria 5710
105 Ga0075435_100021766 3300007076 Bacteria 4938
106 Ga0105240_10107524 3300009093 Bacteria 3381
107 Ga0111539_10000579 3300009094 Bacteria 47092
108 Ga0111539_10022695 3300009094 Bacteria 7708
109 Ga0111539_10355386 3300009094 Bacteria 1705
110 Ga0105245_10004716 3300009098 Bacteria 12049
111 Ga0105245_10011674 3300009098 Bacteria 7645
112 Ga0105245_10013461 3300009098 Bacteria 7125
113 Ga0105245_10015118 3300009098 Bacteria 6722
114 Ga0105245_10041948 3300009098 Bacteria 4081
115 Ga0105245_10074474 3300009098 Bacteria 3090
116 Ga0105245_10120591 3300009098 Bacteria 2449
117 Ga0114129_10165160 3300009147 Bacteria 3022
118 Ga0114129_10210653 3300009147 Bacteria 2627
119 Ga0114129_10302428 3300009147 Bacteria 2131
120 Ga0114129_10397949 3300009147 Bacteria 1816
121 Ga0105243_10021509 3300009148 Bacteria 4897
122 Ga0105243_10029438 3300009148 Bacteria 4223
123 Ga0105243_10130307 3300009148 Bacteria 2133
124 Ga0105248_10055861 3300009177 Bacteria 4429
125 Ga0105249_10007425 3300009553 Bacteria 9561
126 Ga0105249_10228012 3300009553 Bacteria 1836
127 Ga0105249_10345170 3300009553 Bacteria 1507
128 Ga0105239_10009930 3300010375 Bacteria 10687
129 Ga0105239_10138836 3300010375 Bacteria 2707
130 Ga0105239_10298240 3300010375 Bacteria 1815
131 Ga0105246_10054410 3300011119 Bacteria 2758
132 Ga0157373_10076495 3300013100 Bacteria 2361
133 Ga0157370_10007124 3300013104 Bacteria 12201
134 Ga0157372_10012740 3300013307 Bacteria 8959
135 Ga0157372_10079212 3300013307 Unclassified 3715
136 Ga0157375_10020490 3300013308 Bacteria 6042
137 Ga0157375_10029578 3300013308 Bacteria 5155
138 Ga0157375_10093707 3300013308 Bacteria 3069
139 Ga0157375_10204074 3300013308 Bacteria 2133
140 Ga0163163_10032934 3300014325 Bacteria 5008
141 Ga0182008_10001206 3300014497 Bacteria 17813
142 Ga0182008_10098344 3300014497 Bacteria 1445
143 Ga0157377_10016707 3300014745 Bacteria 3779
144 Ga0157377_10173779 3300014745 Bacteria 1349
145 Ga0157379_10089136 3300014968 Bacteria 2767
146 Ga0182006_1012419 3300015261 Bacteria 3724
147 Ga0163161_10043223 3300017792 Bacteria 3244
148 Ga0197907_11482602 3300020069 Bacteria 6010
149 Ga0206354_10638322 3300020081 Bacteria 4521
150 Ga0206354_11155880 3300020081 Bacteria 6149
151 Ga0206353_11486792 3300020082 Bacteria 6490
152 Ga0207653_10000726 3300025885 Bacteria 11278
153 Ga0207653_10030810 3300025885 Bacteria 1732
154 Ga0207642_10012016 3300025899 Bacteria 3111
155 Ga0207642_10023537 3300025899 Bacteria 2462
156 Ga0207688_10030044 3300025901 Unclassified 2995
157 Ga0207688_10034290 3300025901 Bacteria 2810
158 Ga0207699_10020969 3300025906 Bacteria 3513
159 Ga0207699_10039390 3300025906 Bacteria 2715
160 Ga0207705_10043036 3300025909 Bacteria 3243
161 Ga0207684_10162125 3300025910 Bacteria 1926
162 Ga0207684_10172339 3300025910 Bacteria 1865
163 Ga0207707_10035551 3300025912 Bacteria 4356
164 Ga0207707_10123052 3300025912 Bacteria 2268
165 Ga0207693_10005408 3300025915 Bacteria 10668
166 Ga0207693_10011813 3300025915 Bacteria 7057
167 Ga0207693_10012665 3300025915 Bacteria 6811
168 Ga0207693_10021108 3300025915 Bacteria 5177
169 Ga0207693_10021966 3300025915 Bacteria 5073
170 Ga0207693_10057841 3300025915 Bacteria 3038
171 Ga0207693_10099296 3300025915 Bacteria 2283
172 Ga0207693_10129521 3300025915 Bacteria 1983
173 Ga0207663_10002883 3300025916 Bacteria 8306
174 Ga0207663_10015836 3300025916 Bacteria 4169
175 Ga0207660_10091475 3300025917 Bacteria 2256
176 Ga0207662_10092166 3300025918 Bacteria 1865
177 Ga0207657_10020842 3300025919 Bacteria 6186
178 Ga0207657_10021707 3300025919 Bacteria 6035
179 Ga0207649_10050629 3300025920 Bacteria 2569
180 Ga0207652_10017423 3300025921 Bacteria 5879
181 Ga0207646_10007257 3300025922 Bacteria 11300
182 Ga0207646_10052008 3300025922 Bacteria 3665
183 Ga0207687_10009151 3300025927 Bacteria 6478
184 Ga0207687_10024134 3300025927 Bacteria 4060
185 Ga0207687_10024907 3300025927 Bacteria 4002
186 Ga0207700_10000028 3300025928 Bacteria 135555
187 Ga0207700_10062904 3300025928 Bacteria 2820
188 Ga0207664_10051071 3300025929 Bacteria 3263
189 Ga0207664_10269824 3300025929 Bacteria 1490
190 Ga0207706_10011134 3300025933 Bacteria 8197
191 Ga0207706_10019541 3300025933 Bacteria 6094
192 Ga0207706_10035069 3300025933 Bacteria 4463
193 Ga0207706_10155047 3300025933 Bacteria 2014
194 Ga0207709_10099880 3300025935 Bacteria 1916
195 Ga0207704_10177018 3300025938 Bacteria 1537
196 Ga0207665_10003382 3300025939 Bacteria 10677
197 Ga0207665_10016202 3300025939 Bacteria 4894
198 Ga0207665_10035463 3300025939 Bacteria 3312
199 Ga0207665_10037754 3300025939 Bacteria 3216
200 Ga0207691_10061164 3300025940 Bacteria 3421
201 Ga0207661_10029800 3300025944 Unclassified 4195
202 Ga0207661_10087283 3300025944 Bacteria 2590
203 Ga0207667_10036844 3300025949 Bacteria 5237
204 Ga0207640_10014677 3300025981 Bacteria 4514
205 Ga0207640_10017258 3300025981 Bacteria 4220
206 Ga0207639_10257595 3300026041 Bacteria 1524
207 Ga0207708_10001608 3300026075 Bacteria 16828
208 Ga0207708_10040369 3300026075 Bacteria 3558
209 Ga0207708_10070917 3300026075 Bacteria 2668
210 Ga0207648_10002938 3300026089 Bacteria 18038
211 Ga0207648_10057321 3300026089 Bacteria 3398
212 Ga0207648_10067881 3300026089 Bacteria 3108
213 Ga0207648_10068634 3300026089 Bacteria 3089
214 Ga0207674_10002510 3300026116 Bacteria 23138
215 Ga0207674_10037542 3300026116 Bacteria 5037
216 Ga0207675_100001956 3300026118 Bacteria 20587
217 Ga0207675_100015551 3300026118 Bacteria 7098
218 Ga0207683_10007217 3300026121 Bacteria 9528
219 Ga0207683_10062212 3300026121 Bacteria 3287
220 Ga0207683_10124861 3300026121 Bacteria 2313
221 Ga0207698_10290182 3300026142 Bacteria 1518
222 Ga0207428_10000677 3300027907 Bacteria 39885
223 Ga0207428_10001781 3300027907 Bacteria 22060
224 Ga0268265_10050778 3300028380 Bacteria 3127
225 Ga0268265_10120698 3300028380 Bacteria 2159
226 Ga0265338_10000719 3300028800 Bacteria 56662
227 Ga0265330_10072328 3300031235 Bacteria 1491
228 Ga0265325_10028124 3300031241 Bacteria 3033
229 Ga0307408_100046394 3300031548 Bacteria 3108
230 Ga0265342_10085223 3300031712 Bacteria 1819
231 Ga0307410_10021896 3300031852 Bacteria 3940
232 Ga0307406_10003080 3300031901 Bacteria 9075
233 Ga0307406_10137008 3300031901 Bacteria 1727
234 Ga0307407_10020744 3300031903 Bacteria 3373
235 Ga0307412_10020617 3300031911 Bacteria 4015
236 Ga0307412_10109314 3300031911 Bacteria 1971
237 Ga0307409_100058427 3300031995 Bacteria 2995
238 Ga0307409_100091375 3300031995 Bacteria 2495
239 Ga0307416_100079603 3300032002 Bacteria 2762
240 Ga0307416_100215621 3300032002 Unclassified 1836
241 Ga0307416_100295510 3300032002 Bacteria 1606
242 Ga0307414_10056848 3300032004 Bacteria 2747
243 Ga0373938_0000689 3300034957 Bacteria 5455
244 Ga0373940_0002254 3300035088 Unclassified 3713
245 Ga0373951_0004862 3300035091 Bacteria 3156
246 Ga0373952_0003632 3300035092 Bacteria 2783
247 Ga0373945_0007866 3300035116 Bacteria 3459
248 Ga0373943_0096856 3300035170 Bacteria 1537
249 Ga0373961_0041091 3300035241 Bacteria 1335
250 Ga0373947_0001018 3300035725 Bacteria 17130
251 Ga0395899_0013425 3300037312 Bacteria 6266
252 Ga0395899_0014096 3300037312 Bacteria 6102
253 Ga0395899_0112082 3300037312 Bacteria 1960
254 Ga0395900_0018252 3300037418 Bacteria 7156
255 Ga0395900_0047161 3300037418 Bacteria 4436
256 Ga0395900_0067553 3300037418 Bacteria 3673
257 Ga0395900_0081874 3300037418 Bacteria 3316
258 Ga0395900_0265409 3300037418 Bacteria 1713
259 Ga0395900_0268788 3300037418 Bacteria 1700
260 Ga0395900_0289919 3300037418 Bacteria 1626
261 Ga0395898_0004729 3300037466 Bacteria 14820
262 Ga0395898_0024366 3300037466 Bacteria 6102
263 Ga0395898_0057879 3300037466 Bacteria 3775
264 Ga0395898_0376884 3300037466 Bacteria 1353
265 Ga0395905_0004049 3300037471 Bacteria 15373
266 Ga0395905_0015347 3300037471 Bacteria 7282
267 Ga0395905_0054496 3300037471 Bacteria 3742
268 Ga0395905_0076276 3300037471 Bacteria 3142
269 Ga0395905_0102427 3300037471 Bacteria 2687
270 Ga0395905_0186779 3300037471 Bacteria 1945
271 Ga0395901_0002611 3300038443 Bacteria 18245
272 Ga0395901_0013743 3300038443 Bacteria 8229
273 Ga0395901_0020206 3300038443 Bacteria 6818
274 Ga0395901_0021809 3300038443 Bacteria 6565
275 Ga0395901_0052722 3300038443 Bacteria 4227
276 Ga0395901_0052939 3300038443 Bacteria 4219
277 Ga0395901_0128486 3300038443 Bacteria 2664
278 Ga0395901_0201196 3300038443 Bacteria 2088
279 Ga0395901_0225059 3300038443 Bacteria 1960
280 Ga0395901_0248499 3300038443 Bacteria 1854
281 Ga0395901_0284032 3300038443 Unclassified 1719
282 Ga0395901_0419391 3300038443 Unclassified 1373
283 Ga0451853_2194428 3300041512 Bacteria 2756
284 Ga0439445_0013650 3300042004 Bacteria 1968
285 Ga0439448_0011851 3300042005 Bacteria 2600
286 Ga0439446_0001238 3300042156 Bacteria 5727
287 Ga0439446_0017048 3300042156 Bacteria 2027
288 Ga0439458_0007814 3300042157 Bacteria 2381
289 Ga0439458_0023268 3300042157 Bacteria 1444
290 Ga0466965_0032042 3300044683 Bacteria 2567
291 Ga0466966_0056692 3300044684 Bacteria 2478
292 Ga0466961_0013722 3300044693 Bacteria 5192
293 Ga0466963_0000238 3300044694 Bacteria 23872
294 Ga0466963_0002892 3300044694 Bacteria 9695
295 Ga0466963_0023790 3300044694 Bacteria 3894
296 Ga0466963_0030149 3300044694 Bacteria 3497
297 Ga0466963_0082896 3300044694 Bacteria 2174
298 Ga0466964_0001747 3300044706 Bacteria 7527
299 Ga0466964_0031384 3300044706 Bacteria 2107
300 Ga0466968_0050798 3300044735 Bacteria 1770
301 Ga0466957_0027832 3300044842 Bacteria 3361
302 Ga0466957_0079042 3300044842 Bacteria 2046
303 Ga0466959_0000530 3300045049 Bacteria 22154
304 Ga0451576_0322581 3300045051 Bacteria 1616
305 Ga0466967_0036955 3300045976 Bacteria 4174
306 Ga0466967_0037604 3300045976 Bacteria 4143
307 Ga0466967_0090078 3300045976 Bacteria 2786
308 Ga0466967_0117310 3300045976 Bacteria 2453
309 Ga0466967_0125921 3300045976 Bacteria 2373
310 Ga0495592_0150161 3300046454 Bacteria 1612
311 Ga0495603_0003521 3300046455 Bacteria 9320
312 Ga0495603_0050690 3300046455 Bacteria 2468
313 Ga0495629_0003948 3300046459 Bacteria 11157
314 Ga0495629_0007417 3300046459 Bacteria 8083
315 Ga0495641_0001752 3300046461 Bacteria 18080
316 Ga0495641_0035213 3300046461 Bacteria 2363
317 Ga0495651_0037336 3300046462 Bacteria 3782
318 Ga0495653_0054851 3300046463 Bacteria 3044
319 Ga0495584_0054708 3300046491 Bacteria 2008
320 Ga0495584_0089292 3300046491 Bacteria 1554
321 Ga0495594_0005092 3300046499 Bacteria 6765
322 Ga0495608_0041046 3300046511 Bacteria 3098
323 Ga0495608_0162658 3300046511 Unclassified 1419
324 Ga0495628_0184031 3300046516 Bacteria 1579
325 Ga0495667_0063726 3300046559 Bacteria 2412
326 Ga0495634_0068738 3300046642 Bacteria 2339
327 Ga0495588_0001448 3300046674 Bacteria 10166
328 Ga0495657_0019169 3300046675 Bacteria 4939
329 Ga0495647_0047017 3300046681 Bacteria 1664
330 Ga0495613_0044847 3300046689 Bacteria 3270
331 Ga0495671_0062604 3300046692 Bacteria 1833
332 Ga0495589_0073558 3300046794 Bacteria 1667
333 Ga0495581_0034361 3300047315 Bacteria 2934
334 Ga0495674_0060682 3300047319 Bacteria 3299
335 Ga0495676_0013741 3300047321 Bacteria 7263
336 Ga0495676_0020917 3300047321 Bacteria 5729
337 Ga0495684_0157933 3300047471 Bacteria 1693
338 Ga0496100_0009969 3300048903 Bacteria 5361
339 Ga0496100_0052534 3300048903 Bacteria 2650
340 Ga0496100_0236309 3300048903 Bacteria 1347
341 Ga0496101_0007809 3300048904 Bacteria 6955
342 Ga0496101_0028617 3300048904 Unclassified 3891
343 Ga0496101_0064463 3300048904 Bacteria 2669
344 Ga0496102_0064697 3300048905 Bacteria 3350
345 Ga0496102_0093691 3300048905 Bacteria 2782
346 Ga0496102_0346604 3300048905 Bacteria 1398
347 Ga0496103_0040885 3300048906 Bacteria 2849
348 Ga0496103_0044075 3300048906 Bacteria 2748
349 Ga0496103_0045209 3300048906 Bacteria 2717
350 Ga0496104_0001557 3300048907 Bacteria 19750
351 Ga0496104_0007945 3300048907 Bacteria 9407
352 Ga0496104_0035562 3300048907 Bacteria 4650
353 Ga0496104_0070602 3300048907 Bacteria 3320
354 Ga0496104_0075426 3300048907 Bacteria 3211
355 Ga0496104_0295545 3300048907 Bacteria 1532
356 Ga0496105_0000680 3300048908 Bacteria 22840
357 Ga0496105_0016257 3300048908 Bacteria 5938
358 Ga0496105_0028226 3300048908 Bacteria 4589
359 Ga0496105_0051838 3300048908 Bacteria 3388
360 Ga0496105_0079263 3300048908 Bacteria 2712
361 Ga0496106_0009322 3300048909 Bacteria 7256
362 Ga0496106_0105930 3300048909 Bacteria 2185
363 Ga0496107_0005857 3300048910 Bacteria 8414
364 Ga0496107_0049233 3300048910 Unclassified 3036
365 Ga0496107_0064822 3300048910 Bacteria 2649
366 Ga0496108_0002151 3300048911 Bacteria 15780
367 Ga0496108_0005816 3300048911 Bacteria 9995
368 Ga0496108_0026728 3300048911 Bacteria 4763
369 Ga0496108_0067120 3300048911 Bacteria 3025
370 Ga0496108_0216104 3300048911 Bacteria 1665
371 Ga0496109_0002433 3300048912 Bacteria 15585
372 Ga0496109_0008507 3300048912 Bacteria 8725
373 Ga0496109_0040421 3300048912 Bacteria 4224
374 Ga0496109_0064586 3300048912 Bacteria 3350
375 Ga0496109_0103735 3300048912 Bacteria 2639
376 Ga0496109_0107762 3300048912 Bacteria 2588
377 Ga0496109_0132443 3300048912 Bacteria 2327
378 Ga0496110_0001481 3300048913 Bacteria 17015
379 Ga0496110_0008459 3300048913 Bacteria 8282
380 Ga0496110_0010897 3300048913 Bacteria 7412
381 Ga0496110_0024904 3300048913 Bacteria 5107
382 Ga0496110_0050694 3300048913 Bacteria 3645
383 Ga0496110_0060090 3300048913 Bacteria 3351
384 Ga0496111_0000412 3300048914 Bacteria 21482
385 Ga0496111_0000491 3300048914 Bacteria 20365
386 Ga0496111_0003390 3300048914 Bacteria 9853
387 Ga0496111_0005206 3300048914 Bacteria 8294
388 Ga0496111_0176459 3300048914 Bacteria 1588
389 Ga0496112_0006994 3300048915 Bacteria 9960
390 Ga0496112_0017997 3300048915 Bacteria 6649
391 Ga0496112_0033780 3300048915 Bacteria 4974
392 Ga0496112_0078256 3300048915 Bacteria 3270
393 Ga0496112_0099420 3300048915 Bacteria 2879
394 Ga0496113_0003830 3300048916 Bacteria 9101
395 Ga0496113_0011816 3300048916 Bacteria 5849
396 Ga0496113_0023029 3300048916 Bacteria 4413
397 Ga0496113_0026466 3300048916 Bacteria 4148
398 Ga0496114_0043807 3300048917 Unclassified 3711
399 Ga0496114_0055576 3300048917 Bacteria 3302
400 Ga0496115_0097129 3300048918 Unclassified 2413
401 Ga0496115_0184394 3300048918 Bacteria 1724
402 Ga0501031_0000556 3300049568 Bacteria 21831
403 Ga0501031_0006010 3300049568 Bacteria 7923
404 Ga0501031_0010031 3300049568 Bacteria 6169
405 Ga0501031_0042157 3300049568 Bacteria 2980
406 Ga0501032_0022225 3300049569 Bacteria 4399
407 Ga0501033_0054968 3300049570 Bacteria 2944
408 Ga0501034_0049634 3300049571 Bacteria 4234
409 Ga0501036_0010180 3300049572 Bacteria 7747
410 Ga0501036_0015035 3300049572 Bacteria 6459
411 Ga0501036_0202239 3300049572 Bacteria 1670
412 Ga0501037_0108913 3300049573 Bacteria 1996
413 Ga0501039_0027395 3300049575 Bacteria 4382
414 Ga0501039_0199793 3300049575 Bacteria 1572
415 Ga0501040_0002884 3300049576 Bacteria 11114
416 Ga0501040_0025060 3300049576 Bacteria 4007
417 Ga0501041_0018782 3300049577 Bacteria 4117
418 Ga0501041_0021161 3300049577 Bacteria 3897
419 Ga0501041_0025284 3300049577 Bacteria 3569
420 Ga0501041_0058437 3300049577 Bacteria 2359
421 Ga0501042_0004475 3300049578 Bacteria 8913
422 Ga0501042_0170722 3300049578 Bacteria 1569
423 Ga0501046_0024147 3300049580 Bacteria 4992
424 Ga0501046_0069898 3300049580 Bacteria 2731
425 Ga0501048_0004631 3300049582 Bacteria 10465
426 Ga0501048_0039451 3300049582 Bacteria 3388
427 Ga0501048_0051409 3300049582 Bacteria 2933
428 Ga0501048_0119601 3300049582 Bacteria 1861
429 Ga0501067_0007061 3300049583 Bacteria 6237
430 Ga0501067_0087076 3300049583 Bacteria 1733
431 Ga0501068_0004372 3300049584 Bacteria 7688
432 Ga0501068_0004535 3300049584 Bacteria 7558
433 Ga0501068_0012082 3300049584 Bacteria 4887
434 Ga0501068_0033571 3300049584 Bacteria 3056
435 Ga0501069_0022541 3300049585 Bacteria 3427
436 Ga0501070_0072742 3300049586 Bacteria 2846
437 Ga0501070_0079466 3300049586 Bacteria 2714
438 Ga0501071_0002797 3300049587 Bacteria 10731
439 Ga0501071_0052874 3300049587 Bacteria 2929
440 Ga0501071_0056694 3300049587 Bacteria 2831
441 Ga0501071_0092363 3300049587 Bacteria 2224
442 Ga0501072_0005322 3300049588 Bacteria 9797
443 Ga0501072_0067022 3300049588 Bacteria 2832
444 Ga0501072_0136351 3300049588 Unclassified 1957
445 Ga0501074_0009896 3300049590 Bacteria 6927
446 Ga0501074_0021749 3300049590 Bacteria 4657
447 Ga0501075_0015196 3300049591 Bacteria 5521
448 Ga0501075_0211702 3300049591 Bacteria 1478
449 Ga0501076_0001171 3300049592 Bacteria 17362
450 Ga0501076_0017956 3300049592 Bacteria 5381
451 Ga0501077_0017710 3300049593 Bacteria 4499
452 Ga0501077_0021958 3300049593 Bacteria 4041
453 Ga0501079_0011830 3300049741 Bacteria 6662
454 Ga0501079_0019941 3300049741 Bacteria 5122
455 Ga0501079_0201004 3300049741 Bacteria 1556
456 Ga0501080_0026322 3300049742 Bacteria 5405
457 Ga0501080_0031116 3300049742 Bacteria 4972
458 Ga0501080_0077191 3300049742 Bacteria 3097
459 Ga0501081_0004337 3300049743 Bacteria 9098
460 Ga0501081_0014160 3300049743 Bacteria 5256
461 Ga0501083_0004133 3300049744 Bacteria 10219
462 Ga0501083_0015657 3300049744 Bacteria 5308
463 Ga0501083_0024472 3300049744 Bacteria 4183
464 Ga0501035_0037301 3300049822 Bacteria 4402
465 Ga0501045_0003632 3300049824 Bacteria 10604
466 Ga0501045_0009747 3300049824 Bacteria 6719
467 Ga0501045_0060170 3300049824 Bacteria 2784
468 nmdc:mga05p37_51149_c1 3300050507 Bacteria 5082
469 nmdc:mga05p37_528745_c1 3300050507 Bacteria 1347
470 nmdc:mga06r32_103462_c1 3300050510 Bacteria 2796
471 nmdc:mga06r32_65355_c1 3300050510 Bacteria 3508
472 nmdc:mga08y16_44560_c1 3300050511 Bacteria 4648
473 nmdc:mga08y16_6329_c1 3300050511 Bacteria 12416
474 nmdc:mga0n895_72029_c1 3300050512 Unclassified 3428
475 nmdc:mga0n895_812_c1 3300050512 Bacteria 22352
476 nmdc:mga0rr50_14071_c1 3300050513 Bacteria 5234
477 nmdc:mga0rr50_15083_c1 3300050513 Bacteria 5093
478 nmdc:mga0rr50_5897_c1 3300050513 Bacteria 7371
479 nmdc:mga08x19_16604_c1 3300050514 Bacteria 2669
480 nmdc:mga08x19_18855_c1 3300050514 Bacteria 4230
481 nmdc:mga08x19_61886_c1 3300050514 Bacteria 2426
482 nmdc:mga08x19_6908_c1 3300050514 Bacteria 6741
483 nmdc:mga0a205_122190_c1 3300050515 Bacteria 2504
484 nmdc:mga0a205_4452_c1 3300050515 Bacteria 12577
485 Ga0495601_0178775 3300053077 Bacteria 1387
486 Ga0495619_0045496 3300053085 Bacteria 2884
487 Ga0501084_0013570 3300054114 Bacteria 6741
488 Ga0501084_0230176 3300054114 Bacteria 1564
489 Ga0501082_0004034 3300060353 Bacteria 12812
490 Ga0501082_0120836 3300060353 Bacteria 2271
491 Ga0501082_0267308 3300060353 Bacteria 1488
492 Ga0466962_0055217 3300061719 Bacteria 1898
493 Ga0530510_0004089 3300061734 Bacteria 10065
494 Ga0530510_0040219 3300061734 Bacteria 3374
495 Ga0530510_0047643 3300061734 Unclassified 3097
496 Ga0530510_0059857 3300061734 Bacteria 2755
497 Ga0530510_0067744 3300061734 Bacteria 2589
498 Ga0530510_0084972 3300061734 Bacteria 2305
499 Ga0395900_0004030
500 Ga0070658_10027094
501 Ga0070683_100018859
502 Ga0070683_100066932
503 Ga0070690_100018298
504 Ga0068869_100128799
505 Ga0070680_100028188
506 Ga0070682_100010138
507 Ga0070682_100019386
508 Ga0068868_100018815
509 Ga0068868_100100698
510 Ga0070660_100007384
511 Ga0070660_100063824
512 Ga0070691_10007499
513 Ga0070691_10012953
514 Ga0070687_100009395
515 Ga0070692_10033665
516 Ga0070668_100007521
517 Ga0070688_100147210
518 Ga0070659_100213081
519 Ga0070709_10110978
520 Ga0070709_10187227
521 Ga0070714_100007895
522 Ga0070714_100082541
523 Ga0070713_100043484
524 Ga0070713_100130651
525 Ga0070711_100047675
526 Ga0070705_100008683
527 Ga0070694_100136589
528 Ga0070708_100028029
529 Ga0070663_100014232
530 Ga0070662_100038998
531 Ga0070662_100092926
532 Ga0070681_10038101
533 Ga0070681_10043116
534 Ga0070681_10098404
535 Ga0068867_100040543
536 Ga0068867_100048590
537 Ga0070706_100248032
538 Ga0070707_100001269
539 Ga0070698_100013492
540 Ga0070698_100015114
541 Ga0070698_100145661
542 Ga0070699_100024764
543 Ga0070679_100002322
544 Ga0070684_100048084
545 Ga0070697_100027123
546 Ga0070672_100021765
547 Ga0070686_100017555
548 Ga0070686_100101284
549 Ga0070695_100010874
550 Ga0070695_100032798
551 Ga0070696_100016581
552 Ga0070696_100202512
553 Ga0070693_100000985
554 Ga0070665_100179871
555 Ga0070704_100009893
556 Ga0070704_100040861
557 Ga0068855_100023013
558 Ga0068855_100180611
559 Ga0070664_100148615
560 Ga0068857_100008660
561 Ga0068854_100013141
562 Ga0068854_100023724
563 Ga0068856_100034182
564 Ga0068856_100198346
565 Ga0068861_100004166
566 Ga0068861_100017868
567 Ga0068863_100114570
568 Ga0068862_100092971
569 Ga0081455_10025164
570 Ga0081538_10001642
571 Ga0081538_10004902
572 Ga0081540_1004845
573 Ga0081539_10000068
574 Ga0081539_10002069
575 Ga0081539_10002415
576 Ga0070717_10060763
577 Ga0075365_10132942
578 Ga0075432_10012002
579 Ga0075432_10014395
580 Ga0070715_10007406
581 Ga0070716_100117906
582 Ga0070712_100046079
583 Ga0070712_100164215
584 Ga0097621_100033631
585 Ga0068871_100021629
586 Ga0075428_100000193
587 Ga0075428_100010997
588 Ga0075428_100484733
589 Ga0075431_100051424
590 Ga0075431_100071298
591 Ga0075433_10006294
592 Ga0075433_10009272
593 Ga0075433_10106942
594 Ga0075434_100001955
595 Ga0075434_100049069
596 Ga0075434_100062528
597 Ga0068865_100008729
598 Ga0075436_100010572
599 Ga0075436_100022366
600 Ga0075435_100002683
601 Ga0075435_100003120
602 Ga0075435_100015628
603 Ga0075435_100021766
604 Ga0105240_10107524
605 Ga0111539_10000579
606 Ga0111539_10022695
607 Ga0111539_10355386
608 Ga0105245_10004716
609 Ga0105245_10011674
610 Ga0105245_10013461
611 Ga0105245_10015118
612 Ga0105245_10041948
613 Ga0105245_10074474
614 Ga0105245_10120591
615 Ga0114129_10165160
616 Ga0114129_10210653
617 Ga0114129_10302428
618 Ga0114129_10397949
619 Ga0105243_10021509
620 Ga0105243_10029438
621 Ga0105243_10130307
622 Ga0105248_10055861
623 Ga0105249_10007425
624 Ga0105249_10228012
625 Ga0105249_10345170
626 Ga0105239_10009930
627 Ga0105239_10138836
628 Ga0105239_10298240
629 Ga0105246_10054410
630 Ga0157373_10076495
631 Ga0157370_10007124
632 Ga0157372_10012740
633 Ga0157372_10079212
634 Ga0157375_10020490
635 Ga0157375_10029578
636 Ga0157375_10093707
637 Ga0157375_10204074
638 Ga0163163_10032934
639 Ga0182008_10001206
640 Ga0182008_10098344
641 Ga0157377_10016707
642 Ga0157377_10173779
643 Ga0157379_10089136
644 Ga0182006_1012419
645 Ga0163161_10043223
646 Ga0197907_11482602
647 Ga0206354_10638322
648 Ga0206354_11155880
649 Ga0206353_11486792
650 Ga0207653_10000726
651 Ga0207653_10030810
652 Ga0207642_10012016
653 Ga0207642_10023537
654 Ga0207688_10030044
655 Ga0207688_10034290
656 Ga0207699_10020969
657 Ga0207699_10039390
658 Ga0207705_10043036
659 Ga0207684_10162125
660 Ga0207684_10172339
661 Ga0207707_10035551
662 Ga0207707_10123052
663 Ga0207693_10005408
664 Ga0207693_10011813
665 Ga0207693_10012665
666 Ga0207693_10021108
667 Ga0207693_10021966
668 Ga0207693_10057841
669 Ga0207693_10099296
670 Ga0207693_10129521
671 Ga0207663_10002883
672 Ga0207663_10015836
673 Ga0207660_10091475
674 Ga0207662_10092166
675 Ga0207657_10020842
676 Ga0207657_10021707
677 Ga0207649_10050629
678 Ga0207652_10017423
679 Ga0207646_10007257
680 Ga0207646_10052008
681 Ga0207687_10009151
682 Ga0207687_10024134
683 Ga0207687_10024907
684 Ga0207700_10000028
685 Ga0207700_10062904
686 Ga0207664_10051071
687 Ga0207664_10269824
688 Ga0207706_10011134
689 Ga0207706_10019541
690 Ga0207706_10035069
691 Ga0207706_10155047
692 Ga0207709_10099880
693 Ga0207704_10177018
694 Ga0207665_10003382
695 Ga0207665_10016202
696 Ga0207665_10035463
697 Ga0207665_10037754
698 Ga0207691_10061164
699 Ga0207661_10029800
700 Ga0207661_10087283
701 Ga0207667_10036844
702 Ga0207640_10014677
703 Ga0207640_10017258
704 Ga0207639_10257595
705 Ga0207708_10001608
706 Ga0207708_10040369
707 Ga0207708_10070917
708 Ga0207648_10002938
709 Ga0207648_10057321
710 Ga0207648_10067881
711 Ga0207648_10068634
712 Ga0207674_10002510
713 Ga0207674_10037542
714 Ga0207675_100001956
715 Ga0207675_100015551
716 Ga0207683_10007217
717 Ga0207683_10062212
718 Ga0207683_10124861
719 Ga0207698_10290182
720 Ga0207428_10000677
721 Ga0207428_10001781
722 Ga0268265_10050778
723 Ga0268265_10120698
724 Ga0265338_10000719
725 Ga0265330_10072328
726 Ga0265325_10028124
727 Ga0307408_100046394
728 Ga0265342_10085223
729 Ga0307410_10021896
730 Ga0307406_10003080
731 Ga0307406_10137008
732 Ga0307407_10020744
733 Ga0307412_10020617
734 Ga0307412_10109314
735 Ga0307409_100058427
736 Ga0307409_100091375
737 Ga0307416_100079603
738 Ga0307416_100215621
739 Ga0307416_100295510
740 Ga0307414_10056848
741 Ga0373938_0000689
742 Ga0373940_0002254
743 Ga0373951_0004862
744 Ga0373952_0003632
745 Ga0373945_0007866
746 Ga0373943_0096856
747 Ga0373961_0041091
748 Ga0373947_0001018
749 Ga0395899_0013425
750 Ga0395899_0014096
751 Ga0395899_0112082
752 Ga0395900_0018252
753 Ga0395900_0047161
754 Ga0395900_0067553
755 Ga0395900_0081874
756 Ga0395900_0265409
757 Ga0395900_0268788
758 Ga0395900_0289919
759 Ga0395898_0004729
760 Ga0395898_0024366
761 Ga0395898_0057879
762 Ga0395898_0376884
763 Ga0395905_0004049
764 Ga0395905_0015347
765 Ga0395905_0054496
766 Ga0395905_0076276
767 Ga0395905_0102427
768 Ga0395905_0186779
769 Ga0395901_0002611
770 Ga0395901_0013743
771 Ga0395901_0020206
772 Ga0395901_0021809
773 Ga0395901_0052722
774 Ga0395901_0052939
775 Ga0395901_0128486
776 Ga0395901_0201196
777 Ga0395901_0225059
778 Ga0395901_0248499
779 Ga0395901_0284032
780 Ga0395901_0419391
781 Ga0451853_2194428
782 Ga0439445_0013650
783 Ga0439448_0011851
784 Ga0439446_0001238
785 Ga0439446_0017048
786 Ga0439458_0007814
787 Ga0439458_0023268
788 Ga0466965_0032042
789 Ga0466966_0056692
790 Ga0466961_0013722
791 Ga0466963_0000238
792 Ga0466963_0002892
793 Ga0466963_0023790
794 Ga0466963_0030149
795 Ga0466963_0082896
796 Ga0466964_0001747
797 Ga0466964_0031384
798 Ga0466968_0050798
799 Ga0466957_0027832
800 Ga0466957_0079042
801 Ga0466959_0000530
802 Ga0451576_0322581
803 Ga0466967_0036955
804 Ga0466967_0037604
805 Ga0466967_0090078
806 Ga0466967_0117310
807 Ga0466967_0125921
808 Ga0495592_0150161
809 Ga0495603_0003521
810 Ga0495603_0050690
811 Ga0495629_0003948
812 Ga0495629_0007417
813 Ga0495641_0001752
814 Ga0495641_0035213
815 Ga0495651_0037336
816 Ga0495653_0054851
817 Ga0495584_0054708
818 Ga0495584_0089292
819 Ga0495594_0005092
820 Ga0495608_0041046
821 Ga0495608_0162658
822 Ga0495628_0184031
823 Ga0495667_0063726
824 Ga0495634_0068738
825 Ga0495588_0001448
826 Ga0495657_0019169
827 Ga0495647_0047017
828 Ga0495613_0044847
829 Ga0495671_0062604
830 Ga0495589_0073558
831 Ga0495581_0034361
832 Ga0495674_0060682
833 Ga0495676_0013741
834 Ga0495676_0020917
835 Ga0495684_0157933
836 Ga0496100_0009969
837 Ga0496100_0052534
838 Ga0496100_0236309
839 Ga0496101_0007809
840 Ga0496101_0028617
841 Ga0496101_0064463
842 Ga0496102_0064697
843 Ga0496102_0093691
844 Ga0496102_0346604
845 Ga0496103_0040885
846 Ga0496103_0044075
847 Ga0496103_0045209
848 Ga0496104_0001557
849 Ga0496104_0007945
850 Ga0496104_0035562
851 Ga0496104_0070602
852 Ga0496104_0075426
853 Ga0496104_0295545
854 Ga0496105_0000680
855 Ga0496105_0016257
856 Ga0496105_0028226
857 Ga0496105_0051838
858 Ga0496105_0079263
859 Ga0496106_0009322
860 Ga0496106_0105930
861 Ga0496107_0005857
862 Ga0496107_0049233
863 Ga0496107_0064822
864 Ga0496108_0002151
865 Ga0496108_0005816
866 Ga0496108_0026728
867 Ga0496108_0067120
868 Ga0496108_0216104
869 Ga0496109_0002433
870 Ga0496109_0008507
871 Ga0496109_0040421
872 Ga0496109_0064586
873 Ga0496109_0103735
874 Ga0496109_0107762
875 Ga0496109_0132443
876 Ga0496110_0001481
877 Ga0496110_0008459
878 Ga0496110_0010897
879 Ga0496110_0024904
880 Ga0496110_0050694
881 Ga0496110_0060090
882 Ga0496111_0000412
883 Ga0496111_0000491
884 Ga0496111_0003390
885 Ga0496111_0005206
886 Ga0496111_0176459
887 Ga0496112_0006994
888 Ga0496112_0017997
889 Ga0496112_0033780
890 Ga0496112_0078256
891 Ga0496112_0099420
892 Ga0496113_0003830
893 Ga0496113_0011816
894 Ga0496113_0023029
895 Ga0496113_0026466
896 Ga0496114_0043807
897 Ga0496114_0055576
898 Ga0496115_0097129
899 Ga0496115_0184394
900 Ga0501031_0000556
901 Ga0501031_0006010
902 Ga0501031_0010031
903 Ga0501031_0042157
904 Ga0501032_0022225
905 Ga0501033_0054968
906 Ga0501034_0049634
907 Ga0501036_0010180
908 Ga0501036_0015035
909 Ga0501036_0202239
910 Ga0501037_0108913
911 Ga0501039_0027395
912 Ga0501039_0199793
913 Ga0501040_0002884
914 Ga0501040_0025060
915 Ga0501041_0018782
916 Ga0501041_0021161
917 Ga0501041_0025284
918 Ga0501041_0058437
919 Ga0501042_0004475
920 Ga0501042_0170722
921 Ga0501046_0024147
922 Ga0501046_0069898
923 Ga0501048_0004631
924 Ga0501048_0039451
925 Ga0501048_0051409
926 Ga0501048_0119601
927 Ga0501067_0007061
928 Ga0501067_0087076
929 Ga0501068_0004372
930 Ga0501068_0004535
931 Ga0501068_0012082
932 Ga0501068_0033571
933 Ga0501069_0022541
934 Ga0501070_0072742
935 Ga0501070_0079466
936 Ga0501071_0002797
937 Ga0501071_0052874
938 Ga0501071_0056694
939 Ga0501071_0092363
940 Ga0501072_0005322
941 Ga0501072_0067022
942 Ga0501072_0136351
943 Ga0501074_0009896
944 Ga0501074_0021749
945 Ga0501075_0015196
946 Ga0501075_0211702
947 Ga0501076_0001171
948 Ga0501076_0017956
949 Ga0501077_0017710
950 Ga0501077_0021958
951 Ga0501079_0011830
952 Ga0501079_0019941
953 Ga0501079_0201004
954 Ga0501080_0026322
955 Ga0501080_0031116
956 Ga0501080_0077191
957 Ga0501081_0004337
958 Ga0501081_0014160
959 Ga0501083_0004133
960 Ga0501083_0015657
961 Ga0501083_0024472
962 Ga0501035_0037301
963 Ga0501045_0003632
964 Ga0501045_0009747
965 Ga0501045_0060170
966 nmdc:mga05p37_51149_c1
967 nmdc:mga05p37_528745_c1
968 nmdc:mga06r32_103462_c1
969 nmdc:mga06r32_65355_c1
970 nmdc:mga08y16_44560_c1
971 nmdc:mga08y16_6329_c1
972 nmdc:mga0n895_72029_c1
973 nmdc:mga0n895_812_c1
974 nmdc:mga0rr50_14071_c1
975 nmdc:mga0rr50_15083_c1
976 nmdc:mga0rr50_5897_c1
977 nmdc:mga08x19_16604_c1
978 nmdc:mga08x19_18855_c1
979 nmdc:mga08x19_61886_c1
980 nmdc:mga08x19_6908_c1
981 nmdc:mga0a205_122190_c1
982 nmdc:mga0a205_4452_c1
983 Ga0495601_0178775
984 Ga0495619_0045496
985 Ga0501084_0013570
986 Ga0501084_0230176
987 Ga0501082_0004034
988 Ga0501082_0120836
989 Ga0501082_0267308
990 Ga0466962_0055217
991 Ga0530510_0004089
992 Ga0530510_0040219
993 Ga0530510_0047643
994 Ga0530510_0059857
995 Ga0530510_0067744
996 Ga0530510_0084972

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02601

Exonuc_VII_L

Exonuclease VII, large subunit

132

329

0.97

PF02601

Exonuc_VII_L

Exonuclease VII, large subunit

297

376

0.95

PF13742

tRNA_anti_2

OB-fold nucleic acid binding domain

14

109

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1z9f-assembly1.cif.gz_A crystal structure of single stranded dna-binding protein (tm0604) from thermotoga maritima at 2.60 a resolution 0.8209 31 112
3kdf-assembly3.cif.gz_D x-ray crystal structure of the human replication protein a complex from wheat germ cell free expression 0.8126 31 120
3u4z-assembly1.cif.gz_A crystal structure of the tetrahymena telomerase processivity factor teb1 ob-b 0.804 30 113
2z6k-assembly2.cif.gz_B crystal structure of full-length human rpa14/32 heterodimer 0.7999 33 120
5gqo-assembly1.cif.gz_B-2 structure of the second single stranded dna binding protein (ssbb) from mycobacterium smegmatis 0.784 33 112
ID Description Score Start End Superfamily
af_P9WF31_10_105_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9524 15 110 2.40.50.140
af_P9WF31_10_105_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.943 15 110 2.40.50.140
af_P04994_10_103_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8965 15 110 2.40.50.140
af_P04994_10_103_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8877 15 110 2.40.50.140
af_P9WF31_128_342_3.40.50.261 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Succinyl-CoA synthetase domains 0.8837 134 299 3.40.50.261
ID Description Score Start End GO Terms
AF-A0A4U3LKA6-F1-model_v4 Exodeoxyribonuclease VII large subunit (EC 3.1.11.6) 0.9715 158 303 GO:0006308
GO:0008855
GO:0009318
AF-Q71IW7-F1-model_v4 Exodeoxyribonuclease VII large subunit (EC 3.1.11.6) 0.9566 131 274 GO:0006308
GO:0008855
GO:0009318
AF-A0A6L5EKV6-F1-model_v4 Exodeoxyribonuclease VII large subunit 0.9546 163 264 GO:0006308
GO:0008855
GO:0009318
AF-A0A257N8P2-F1-model_v4 Exodeoxyribonuclease VII large subunit (EC 3.1.11.6) 0.9495 71 259 GO:0003676
GO:0005737
GO:0006308
GO:0008855
GO:0009318
AF-T1AAC6-F1-model_v4 Exonuclease VII, large subunit (EC 3.1.11.6) 0.9477 118 285 GO:0006308
GO:0008855
GO:0009318

Map