F455218
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 498 | 244 | 498 | 197 |
Family's Representative Sequence
| Representative Sequence | 3300035410|Ga0373924_0143950|Ga0373924_0143950_30_725 |
| Length | 231 |
| Sequence | MKKRVAILISGRGSNMTALIEAAKAKDYPAEIALVVSNRPDAAGLDRARSCGIPTAVIDHTTFGGDRETFEQALDRQLREQRIDLVCLAGFMRLLTPWFVNRWSGRMLNIHPSLLPSYPGLDTHARALADGVRVHGCTVHFVTADVDHGPIVMQGAVAVHDADDEQSLAARVLAIEHRLLPAAVRAFCERRLVIAGRRVRVKDEVAPAAAFVVPSPVAPADARGDDSSHSA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 2 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 5 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 49 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 59 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 60 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 61 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 66 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 72 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 73 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 76 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 77 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 78 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 79 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 80 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 81 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 83 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 95 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 111 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 164 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 167 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 168 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 169 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 170 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 171 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 172 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 173 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 174 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 175 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 176 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 177 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 178 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 179 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 180 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 181 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 182 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 183 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 184 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 185 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 186 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 187 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 188 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 189 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 190 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 191 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 226 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 227 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 228 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 229 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 230 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 231 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 232 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 233 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 234 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 235 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 236 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 237 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 238 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 239 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 240 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 3.21 |
| Rhizosphere | 95.98 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.8 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24748J21848_1000001 | 3300002074 | Bacteria | 444271 |
| 2 | JGI24034J26672_10000001 | 3300002239 | Bacteria | 1118280 |
| 3 | JGI25406J46586_10004972 | 3300003203 | Bacteria | 6176 |
| 4 | rootL2_10270263 | 3300003322 | Bacteria | 1575 |
| 5 | Ga0065704_10226521 | 3300005289 | Bacteria | 1057 |
| 6 | Ga0065712_10007428 | 3300005290 | Bacteria | 2776 |
| 7 | Ga0065712_10097629 | 3300005290 | Bacteria | 2145 |
| 8 | Ga0065712_10230829 | 3300005290 | Unclassified | 990 |
| 9 | Ga0065712_10261260 | 3300005290 | Unclassified | 936 |
| 10 | Ga0065715_10006849 | 3300005293 | Bacteria | 3230 |
| 11 | Ga0065715_10089819 | 3300005293 | Bacteria | 8424 |
| 12 | Ga0065715_10096528 | 3300005293 | Unclassified | 3863 |
| 13 | Ga0065715_10234882 | 3300005293 | Bacteria | 1220 |
| 14 | Ga0065715_10288674 | 3300005293 | Bacteria | 1068 |
| 15 | Ga0065715_10452523 | 3300005293 | Unclassified | 824 |
| 16 | Ga0065707_10092664 | 3300005295 | Bacteria | 3706 |
| 17 | Ga0070676_10117649 | 3300005328 | Bacteria | 1664 |
| 18 | Ga0070676_10189056 | 3300005328 | Bacteria | 1343 |
| 19 | Ga0070683_100129090 | 3300005329 | Bacteria | 2391 |
| 20 | Ga0070690_100071973 | 3300005330 | Bacteria | 2247 |
| 21 | Ga0070690_100110116 | 3300005330 | Bacteria | 1836 |
| 22 | Ga0070690_100181611 | 3300005330 | Bacteria | 1454 |
| 23 | Ga0070690_100550259 | 3300005330 | Bacteria | 870 |
| 24 | Ga0070670_100001205 | 3300005331 | Bacteria | 20532 |
| 25 | Ga0070670_100098707 | 3300005331 | Unclassified | 2513 |
| 26 | Ga0068869_100063965 | 3300005334 | Bacteria | 2705 |
| 27 | Ga0068869_100152273 | 3300005334 | Bacteria | 1794 |
| 28 | Ga0070666_10210886 | 3300005335 | Bacteria | 1368 |
| 29 | Ga0070680_100025267 | 3300005336 | Bacteria | 4746 |
| 30 | Ga0070682_100117422 | 3300005337 | Unclassified | 1781 |
| 31 | Ga0068868_100086036 | 3300005338 | Unclassified | 2527 |
| 32 | Ga0068868_100486995 | 3300005338 | Bacteria | 1078 |
| 33 | Ga0070660_100015860 | 3300005339 | Bacteria | 5454 |
| 34 | Ga0070660_100111992 | 3300005339 | Bacteria | 2172 |
| 35 | Ga0070660_100378574 | 3300005339 | Bacteria | 1168 |
| 36 | Ga0070689_100073043 | 3300005340 | Bacteria | 2682 |
| 37 | Ga0070689_100125021 | 3300005340 | Bacteria | 2057 |
| 38 | Ga0070689_100367016 | 3300005340 | Unclassified | 1211 |
| 39 | Ga0070687_100032970 | 3300005343 | Bacteria | 2552 |
| 40 | Ga0070687_100136644 | 3300005343 | Unclassified | 1422 |
| 41 | Ga0070661_100024590 | 3300005344 | Bacteria | 4321 |
| 42 | Ga0070661_100046710 | 3300005344 | Bacteria | 3168 |
| 43 | Ga0070661_100171093 | 3300005344 | Bacteria | 1650 |
| 44 | Ga0070661_100435726 | 3300005344 | Bacteria | 1041 |
| 45 | Ga0070692_10212327 | 3300005345 | Unclassified | 1139 |
| 46 | Ga0070669_100072967 | 3300005353 | Bacteria | 2542 |
| 47 | Ga0070669_100100644 | 3300005353 | Bacteria | 2179 |
| 48 | Ga0070669_100316382 | 3300005353 | Bacteria | 1259 |
| 49 | Ga0070669_100473890 | 3300005353 | Bacteria | 1035 |
| 50 | Ga0070675_100170986 | 3300005354 | Unclassified | 1874 |
| 51 | Ga0070675_100264740 | 3300005354 | Bacteria | 1507 |
| 52 | Ga0070671_100008298 | 3300005355 | Bacteria | 8312 |
| 53 | Ga0070671_100035876 | 3300005355 | Bacteria | 4110 |
| 54 | Ga0070671_100041069 | 3300005355 | Bacteria | 3843 |
| 55 | Ga0070671_100311708 | 3300005355 | Unclassified | 1340 |
| 56 | Ga0070671_100409967 | 3300005355 | Bacteria | 1160 |
| 57 | Ga0070673_100000212 | 3300005364 | Bacteria | 28926 |
| 58 | Ga0070673_100791978 | 3300005364 | Unclassified | 875 |
| 59 | Ga0070688_100158442 | 3300005365 | Bacteria | 1554 |
| 60 | Ga0070659_100000997 | 3300005366 | Bacteria | 20800 |
| 61 | Ga0070659_100001017 | 3300005366 | Bacteria | 20562 |
| 62 | Ga0070659_100173016 | 3300005366 | Bacteria | 1770 |
| 63 | Ga0070667_100159222 | 3300005367 | Unclassified | 1987 |
| 64 | Ga0070667_100828340 | 3300005367 | Unclassified | 860 |
| 65 | Ga0070703_10000049 | 3300005406 | Bacteria | 58073 |
| 66 | Ga0070710_10185525 | 3300005437 | Bacteria | 1305 |
| 67 | Ga0070701_10013106 | 3300005438 | Bacteria | 3761 |
| 68 | Ga0070701_10024328 | 3300005438 | Bacteria | 2929 |
| 69 | Ga0070701_10031103 | 3300005438 | Bacteria | 2647 |
| 70 | Ga0070700_100001704 | 3300005441 | Bacteria | 11035 |
| 71 | Ga0070694_100220977 | 3300005444 | Bacteria | 1421 |
| 72 | Ga0070708_100000191 | 3300005445 | Bacteria | 44404 |
| 73 | Ga0070708_100000712 | 3300005445 | Bacteria | 25260 |
| 74 | Ga0070708_100115867 | 3300005445 | Bacteria | 2467 |
| 75 | Ga0070708_100401702 | 3300005445 | Archaea | 1292 |
| 76 | Ga0070663_100021070 | 3300005455 | Bacteria | 4328 |
| 77 | Ga0070663_100142005 | 3300005455 | Bacteria | 1834 |
| 78 | Ga0070678_100669402 | 3300005456 | Unclassified | 932 |
| 79 | Ga0070662_100004111 | 3300005457 | Bacteria | 9145 |
| 80 | Ga0070662_100096935 | 3300005457 | Bacteria | 2225 |
| 81 | Ga0070681_10002824 | 3300005458 | Bacteria | 16037 |
| 82 | Ga0070681_10090269 | 3300005458 | Bacteria | 3014 |
| 83 | Ga0070681_10279524 | 3300005458 | Bacteria | 1580 |
| 84 | Ga0068867_100157560 | 3300005459 | Bacteria | 1788 |
| 85 | Ga0068867_100200518 | 3300005459 | Bacteria | 1597 |
| 86 | Ga0070685_10176710 | 3300005466 | Bacteria | 1371 |
| 87 | Ga0070706_100014813 | 3300005467 | Bacteria | 7207 |
| 88 | Ga0070706_100015375 | 3300005467 | Bacteria | 7068 |
| 89 | Ga0070706_100130596 | 3300005467 | Unclassified | 2344 |
| 90 | Ga0070706_100178958 | 3300005467 | Bacteria | 1980 |
| 91 | Ga0070707_100073837 | 3300005468 | Bacteria | 3289 |
| 92 | Ga0070707_100085947 | 3300005468 | Bacteria | 3041 |
| 93 | Ga0070707_100120193 | 3300005468 | Bacteria | 2550 |
| 94 | Ga0070707_100157293 | 3300005468 | Archaea | 2214 |
| 95 | Ga0070698_100015126 | 3300005471 | Bacteria | 8159 |
| 96 | Ga0070698_100588645 | 3300005471 | Archaea | 1053 |
| 97 | Ga0070698_100751163 | 3300005471 | Bacteria | 918 |
| 98 | Ga0070699_100032163 | 3300005518 | Bacteria | 4530 |
| 99 | Ga0070699_100154971 | 3300005518 | Bacteria | 2027 |
| 100 | Ga0070679_100002739 | 3300005530 | Bacteria | 16044 |
| 101 | Ga0070679_100020243 | 3300005530 | Bacteria | 6484 |
| 102 | Ga0070697_100047176 | 3300005536 | Bacteria | 3494 |
| 103 | Ga0070697_100066533 | 3300005536 | Bacteria | 2946 |
| 104 | Ga0070697_100177249 | 3300005536 | Bacteria | 1806 |
| 105 | Ga0070697_100254496 | 3300005536 | Bacteria | 1502 |
| 106 | Ga0070697_100255843 | 3300005536 | Bacteria | 1498 |
| 107 | Ga0068853_100005087 | 3300005539 | Bacteria | 10262 |
| 108 | Ga0068853_100010682 | 3300005539 | Bacteria | 7433 |
| 109 | Ga0068853_100101570 | 3300005539 | Bacteria | 2543 |
| 110 | Ga0070672_100175728 | 3300005543 | Bacteria | 1783 |
| 111 | Ga0070672_100178755 | 3300005543 | Bacteria | 1767 |
| 112 | Ga0070686_100097347 | 3300005544 | Bacteria | 1980 |
| 113 | Ga0070695_100291205 | 3300005545 | Bacteria | 1203 |
| 114 | Ga0070695_100476441 | 3300005545 | Bacteria | 961 |
| 115 | Ga0070695_100951287 | 3300005545 | Unclassified | 696 |
| 116 | Ga0070696_100046765 | 3300005546 | Unclassified | 3002 |
| 117 | Ga0070696_100072022 | 3300005546 | Bacteria | 2433 |
| 118 | Ga0070696_100092786 | 3300005546 | Bacteria | 2152 |
| 119 | Ga0070693_100098482 | 3300005547 | Bacteria | 1777 |
| 120 | Ga0070693_100435347 | 3300005547 | Bacteria | 917 |
| 121 | Ga0070665_100237784 | 3300005548 | Bacteria | 1822 |
| 122 | Ga0070704_100077876 | 3300005549 | Bacteria | 2430 |
| 123 | Ga0070704_100391633 | 3300005549 | Bacteria | 1183 |
| 124 | Ga0068855_100457794 | 3300005563 | Bacteria | 1391 |
| 125 | Ga0068855_100459814 | 3300005563 | Bacteria | 1388 |
| 126 | Ga0070664_100002145 | 3300005564 | Bacteria | 15812 |
| 127 | Ga0070664_100021164 | 3300005564 | Bacteria | 5357 |
| 128 | Ga0068857_100241658 | 3300005577 | Bacteria | 1653 |
| 129 | Ga0068854_100065028 | 3300005578 | Bacteria | 2651 |
| 130 | Ga0068856_100005065 | 3300005614 | Bacteria | 13041 |
| 131 | Ga0068856_100995567 | 3300005614 | Bacteria | 857 |
| 132 | Ga0070702_100250650 | 3300005615 | Bacteria | 1200 |
| 133 | Ga0070702_100273481 | 3300005615 | Bacteria | 1156 |
| 134 | Ga0068852_100025692 | 3300005616 | Bacteria | 4776 |
| 135 | Ga0068852_100312414 | 3300005616 | Bacteria | 1524 |
| 136 | Ga0068852_100790209 | 3300005616 | Unclassified | 963 |
| 137 | Ga0068859_100008267 | 3300005617 | Bacteria | 10551 |
| 138 | Ga0068859_100028738 | 3300005617 | Bacteria | 5574 |
| 139 | Ga0068859_100086895 | 3300005617 | Bacteria | 3174 |
| 140 | Ga0068859_100131903 | 3300005617 | Bacteria | 2570 |
| 141 | Ga0068859_100164248 | 3300005617 | Unclassified | 2299 |
| 142 | Ga0068864_100050313 | 3300005618 | Bacteria | 3586 |
| 143 | Ga0068864_100135768 | 3300005618 | Bacteria | 2215 |
| 144 | Ga0068864_100233899 | 3300005618 | Bacteria | 1700 |
| 145 | Ga0068864_100345073 | 3300005618 | Bacteria | 1404 |
| 146 | Ga0068864_100494665 | 3300005618 | Bacteria | 1176 |
| 147 | Ga0068861_100006204 | 3300005719 | Bacteria | 8134 |
| 148 | Ga0068861_100448513 | 3300005719 | Unclassified | 1155 |
| 149 | Ga0068870_10089753 | 3300005840 | Unclassified | 1716 |
| 150 | Ga0068870_10208448 | 3300005840 | Bacteria | 1189 |
| 151 | Ga0068870_10274290 | 3300005840 | Unclassified | 1055 |
| 152 | Ga0068863_100204215 | 3300005841 | Bacteria | 1901 |
| 153 | Ga0068863_100270716 | 3300005841 | Bacteria | 1644 |
| 154 | Ga0068863_100473260 | 3300005841 | Bacteria | 1231 |
| 155 | Ga0068858_100000051 | 3300005842 | Bacteria | 120692 |
| 156 | Ga0068858_100108593 | 3300005842 | Bacteria | 2590 |
| 157 | Ga0068858_100147301 | 3300005842 | Bacteria | 2212 |
| 158 | Ga0068858_100620755 | 3300005842 | Bacteria | 1049 |
| 159 | Ga0068858_100813773 | 3300005842 | Bacteria | 912 |
| 160 | Ga0068860_100061286 | 3300005843 | Unclassified | 3574 |
| 161 | Ga0068860_100423456 | 3300005843 | Bacteria | 1320 |
| 162 | Ga0068860_101317523 | 3300005843 | Unclassified | 743 |
| 163 | Ga0068862_100008314 | 3300005844 | Bacteria | 8587 |
| 164 | Ga0068862_100053059 | 3300005844 | Bacteria | 3470 |
| 165 | Ga0068862_100088469 | 3300005844 | Bacteria | 2695 |
| 166 | Ga0068862_100122516 | 3300005844 | Bacteria | 2293 |
| 167 | Ga0068862_100416813 | 3300005844 | Bacteria | 1259 |
| 168 | Ga0081455_10414226 | 3300005937 | Bacteria | 931 |
| 169 | Ga0081539_10001244 | 3300005985 | Bacteria | 45293 |
| 170 | Ga0070716_100000003 | 3300006173 | Bacteria | 312721 |
| 171 | Ga0070716_100295903 | 3300006173 | Bacteria | 1124 |
| 172 | Ga0097621_100081546 | 3300006237 | Unclassified | 2692 |
| 173 | Ga0097621_100102507 | 3300006237 | Bacteria | 2409 |
| 174 | Ga0097621_100134105 | 3300006237 | Bacteria | 2110 |
| 175 | Ga0068871_100477828 | 3300006358 | Bacteria | 1120 |
| 176 | Ga0075428_100143367 | 3300006844 | Bacteria | 2597 |
| 177 | Ga0075428_100308704 | 3300006844 | Bacteria | 1700 |
| 178 | Ga0075433_10027319 | 3300006852 | Bacteria | 4838 |
| 179 | Ga0075434_100418798 | 3300006871 | Bacteria | 1360 |
| 180 | Ga0075434_100424810 | 3300006871 | Bacteria | 1350 |
| 181 | Ga0075429_100008602 | 3300006880 | Bacteria | 8878 |
| 182 | Ga0075429_100046987 | 3300006880 | Bacteria | 3756 |
| 183 | Ga0068865_100038472 | 3300006881 | Bacteria | 3238 |
| 184 | Ga0068865_100107062 | 3300006881 | Unclassified | 2056 |
| 185 | Ga0068865_100861070 | 3300006881 | Bacteria | 786 |
| 186 | Ga0068865_101024061 | 3300006881 | Unclassified | 724 |
| 187 | Ga0097620_100008267 | 3300006931 | Bacteria | 10551 |
| 188 | Ga0097620_100028740 | 3300006931 | Bacteria | 5574 |
| 189 | Ga0097620_100086894 | 3300006931 | Bacteria | 3174 |
| 190 | Ga0097620_100131901 | 3300006931 | Bacteria | 2570 |
| 191 | Ga0097620_100164243 | 3300006931 | Unclassified | 2299 |
| 192 | Ga0075435_100624793 | 3300007076 | Bacteria | 934 |
| 193 | Ga0105251_10238313 | 3300009011 | Unclassified | 819 |
| 194 | Ga0111539_10065088 | 3300009094 | Bacteria | 4310 |
| 195 | Ga0111539_10144414 | 3300009094 | Bacteria | 2786 |
| 196 | Ga0111539_10384707 | 3300009094 | Bacteria | 1634 |
| 197 | Ga0105245_10045151 | 3300009098 | Bacteria | 3934 |
| 198 | Ga0105247_10000004 | 3300009101 | Bacteria | 455497 |
| 199 | Ga0114129_10021399 | 3300009147 | Bacteria | 9181 |
| 200 | Ga0114129_10035058 | 3300009147 | Bacteria | 7089 |
| 201 | Ga0114129_10300936 | 3300009147 | Bacteria | 2138 |
| 202 | Ga0114129_10514373 | 3300009147 | Bacteria | 1562 |
| 203 | Ga0114129_11446692 | 3300009147 | Unclassified | 846 |
| 204 | Ga0105243_10000446 | 3300009148 | Bacteria | 43049 |
| 205 | Ga0105243_10470793 | 3300009148 | Bacteria | 1183 |
| 206 | Ga0105243_10549971 | 3300009148 | Bacteria | 1103 |
| 207 | Ga0105241_10549829 | 3300009174 | Bacteria | 1036 |
| 208 | Ga0105241_10590782 | 3300009174 | Bacteria | 1002 |
| 209 | Ga0105241_10612916 | 3300009174 | Bacteria | 984 |
| 210 | Ga0105241_11041697 | 3300009174 | Bacteria | 767 |
| 211 | Ga0105242_10001013 | 3300009176 | Bacteria | 22070 |
| 212 | Ga0105242_10003928 | 3300009176 | Bacteria | 11551 |
| 213 | Ga0105242_10023838 | 3300009176 | Bacteria | 4827 |
| 214 | Ga0105242_10081745 | 3300009176 | Bacteria | 2702 |
| 215 | Ga0105242_10918653 | 3300009176 | Unclassified | 877 |
| 216 | Ga0105248_10013612 | 3300009177 | Bacteria | 8955 |
| 217 | Ga0105248_10421429 | 3300009177 | Bacteria | 1503 |
| 218 | Ga0105248_10695275 | 3300009177 | Bacteria | 1147 |
| 219 | Ga0105248_10814322 | 3300009177 | Bacteria | 1054 |
| 220 | Ga0105248_10854147 | 3300009177 | Bacteria | 1027 |
| 221 | Ga0105248_11105142 | 3300009177 | Unclassified | 896 |
| 222 | Ga0105237_10050235 | 3300009545 | Bacteria | 4190 |
| 223 | Ga0105249_10017805 | 3300009553 | Bacteria | 6313 |
| 224 | Ga0105249_10106766 | 3300009553 | Bacteria | 2642 |
| 225 | Ga0105249_10799596 | 3300009553 | Bacteria | 1007 |
| 226 | Ga0105249_11169482 | 3300009553 | Unclassified | 840 |
| 227 | Ga0099796_10246599 | 3300010159 | Bacteria | 740 |
| 228 | Ga0105239_10298715 | 3300010375 | Unclassified | 1813 |
| 229 | Ga0105239_10426036 | 3300010375 | Bacteria | 1504 |
| 230 | Ga0105246_10057378 | 3300011119 | Bacteria | 2694 |
| 231 | Ga0105246_10187732 | 3300011119 | Unclassified | 1597 |
| 232 | Ga0157373_10009902 | 3300013100 | Bacteria | 7026 |
| 233 | Ga0157373_10025815 | 3300013100 | Unclassified | 4247 |
| 234 | Ga0157371_10002099 | 3300013102 | Bacteria | 19457 |
| 235 | Ga0157370_10304894 | 3300013104 | Bacteria | 1470 |
| 236 | Ga0157369_10346478 | 3300013105 | Bacteria | 1543 |
| 237 | Ga0157369_10357543 | 3300013105 | Bacteria | 1516 |
| 238 | Ga0157374_10096903 | 3300013296 | Bacteria | 2821 |
| 239 | Ga0157378_10000004 | 3300013297 | Bacteria | 201051 |
| 240 | Ga0157378_10008455 | 3300013297 | Bacteria | 8965 |
| 241 | Ga0157378_10015793 | 3300013297 | Bacteria | 6612 |
| 242 | Ga0157378_10019632 | 3300013297 | Bacteria | 5941 |
| 243 | Ga0157378_10116895 | 3300013297 | Bacteria | 2453 |
| 244 | Ga0157378_10214352 | 3300013297 | Unclassified | 1827 |
| 245 | Ga0157378_10546937 | 3300013297 | Bacteria | 1163 |
| 246 | Ga0157378_10623294 | 3300013297 | Bacteria | 1092 |
| 247 | Ga0157378_11265022 | 3300013297 | Unclassified | 778 |
| 248 | Ga0163162_10026360 | 3300013306 | Bacteria | 5744 |
| 249 | Ga0163162_10047575 | 3300013306 | Bacteria | 4299 |
| 250 | Ga0163162_10118009 | 3300013306 | Bacteria | 2755 |
| 251 | Ga0163162_10207060 | 3300013306 | Bacteria | 2091 |
| 252 | Ga0163162_10985617 | 3300013306 | Unclassified | 952 |
| 253 | Ga0157372_10002796 | 3300013307 | Bacteria | 18867 |
| 254 | Ga0157372_10010938 | 3300013307 | Bacteria | 9657 |
| 255 | Ga0157372_10070958 | 3300013307 | Bacteria | 3921 |
| 256 | Ga0157375_10000479 | 3300013308 | Bacteria | 36426 |
| 257 | Ga0157375_10054284 | 3300013308 | Bacteria | 3946 |
| 258 | Ga0157375_10066315 | 3300013308 | Unclassified | 3603 |
| 259 | Ga0157375_10145214 | 3300013308 | Bacteria | 2503 |
| 260 | Ga0157375_10236150 | 3300013308 | Unclassified | 1987 |
| 261 | Ga0157375_10499273 | 3300013308 | Bacteria | 1381 |
| 262 | Ga0157375_10759080 | 3300013308 | Bacteria | 1121 |
| 263 | Ga0157375_10843862 | 3300013308 | Bacteria | 1063 |
| 264 | Ga0163163_10003828 | 3300014325 | Bacteria | 12813 |
| 265 | Ga0163163_10063185 | 3300014325 | Unclassified | 3670 |
| 266 | Ga0163163_10229485 | 3300014325 | Bacteria | 1905 |
| 267 | Ga0163163_10638982 | 3300014325 | Unclassified | 1128 |
| 268 | Ga0163163_10693279 | 3300014325 | Unclassified | 1082 |
| 269 | Ga0163163_10720689 | 3300014325 | Unclassified | 1061 |
| 270 | Ga0163163_10803800 | 3300014325 | Bacteria | 1004 |
| 271 | Ga0157380_10001887 | 3300014326 | Bacteria | 13902 |
| 272 | Ga0157380_10002797 | 3300014326 | Bacteria | 11862 |
| 273 | Ga0157380_10041947 | 3300014326 | Bacteria | 3574 |
| 274 | Ga0157377_10174066 | 3300014745 | Unclassified | 1348 |
| 275 | Ga0157377_10738961 | 3300014745 | Bacteria | 719 |
| 276 | Ga0163161_10410496 | 3300017792 | Unclassified | 1087 |
| 277 | Ga0163161_10599949 | 3300017792 | Bacteria | 908 |
| 278 | Ga0213876_10000112 | 3300021384 | Bacteria | 89665 |
| 279 | Ga0207672_1000002 | 3300025223 | Bacteria | 31879 |
| 280 | Ga0207653_10000163 | 3300025885 | Bacteria | 47337 |
| 281 | Ga0207692_10315608 | 3300025898 | Bacteria | 955 |
| 282 | Ga0207642_10070031 | 3300025899 | Bacteria | 1665 |
| 283 | Ga0207642_10131299 | 3300025899 | Bacteria | 1308 |
| 284 | Ga0207710_10000002 | 3300025900 | Bacteria | 1251998 |
| 285 | Ga0207680_10034812 | 3300025903 | Bacteria | 2884 |
| 286 | Ga0207645_10014191 | 3300025907 | Bacteria | 5336 |
| 287 | Ga0207645_10340095 | 3300025907 | Bacteria | 1003 |
| 288 | Ga0207643_10103372 | 3300025908 | Bacteria | 1672 |
| 289 | Ga0207684_10001129 | 3300025910 | Bacteria | 29818 |
| 290 | Ga0207684_10067409 | 3300025910 | Bacteria | 3042 |
| 291 | Ga0207684_10119015 | 3300025910 | Bacteria | 2264 |
| 292 | Ga0207684_10470421 | 3300025910 | Archaea | 1079 |
| 293 | Ga0207684_10520722 | 3300025910 | Unclassified | 1019 |
| 294 | Ga0207654_10505856 | 3300025911 | Bacteria | 853 |
| 295 | Ga0207707_10000008 | 3300025912 | Bacteria | 330313 |
| 296 | Ga0207707_10026167 | 3300025912 | Bacteria | 5101 |
| 297 | Ga0207707_10512896 | 3300025912 | Bacteria | 1022 |
| 298 | Ga0207660_10019420 | 3300025917 | Bacteria | 4544 |
| 299 | Ga0207662_10016043 | 3300025918 | Unclassified | 4222 |
| 300 | Ga0207662_10064160 | 3300025918 | Bacteria | 2209 |
| 301 | Ga0207662_10252639 | 3300025918 | Unclassified | 1158 |
| 302 | Ga0207657_10001461 | 3300025919 | Bacteria | 25304 |
| 303 | Ga0207657_10056266 | 3300025919 | Bacteria | 3394 |
| 304 | Ga0207657_10120581 | 3300025919 | Bacteria | 2158 |
| 305 | Ga0207657_10335503 | 3300025919 | Bacteria | 1194 |
| 306 | Ga0207649_10186955 | 3300025920 | Bacteria | 1454 |
| 307 | Ga0207649_10490050 | 3300025920 | Bacteria | 933 |
| 308 | Ga0207652_10000085 | 3300025921 | Bacteria | 101176 |
| 309 | Ga0207652_10155141 | 3300025921 | Bacteria | 2051 |
| 310 | Ga0207652_10193390 | 3300025921 | Bacteria | 1830 |
| 311 | Ga0207646_10042513 | 3300025922 | Unclassified | 4082 |
| 312 | Ga0207646_10250256 | 3300025922 | Archaea | 1601 |
| 313 | Ga0207646_10274039 | 3300025922 | Unclassified | 1525 |
| 314 | Ga0207646_10524731 | 3300025922 | Unclassified | 1066 |
| 315 | Ga0207681_10115201 | 3300025923 | Bacteria | 1962 |
| 316 | Ga0207681_10170327 | 3300025923 | Bacteria | 1650 |
| 317 | Ga0207681_10553045 | 3300025923 | Bacteria | 947 |
| 318 | Ga0207650_10000675 | 3300025925 | Bacteria | 26793 |
| 319 | Ga0207659_10142165 | 3300025926 | Bacteria | 1864 |
| 320 | Ga0207659_10387846 | 3300025926 | Bacteria | 1166 |
| 321 | Ga0207687_10281420 | 3300025927 | Bacteria | 1333 |
| 322 | Ga0207644_10000179 | 3300025931 | Bacteria | 45397 |
| 323 | Ga0207644_10003580 | 3300025931 | Bacteria | 10053 |
| 324 | Ga0207644_10043980 | 3300025931 | Bacteria | 3171 |
| 325 | Ga0207690_10002569 | 3300025932 | Bacteria | 10965 |
| 326 | Ga0207690_10045877 | 3300025932 | Bacteria | 2890 |
| 327 | Ga0207706_10000040 | 3300025933 | Bacteria | 132285 |
| 328 | Ga0207706_10047991 | 3300025933 | Bacteria | 3776 |
| 329 | Ga0207706_10088891 | 3300025933 | Bacteria | 2716 |
| 330 | Ga0207706_10491213 | 3300025933 | Unclassified | 1060 |
| 331 | Ga0207686_10000003 | 3300025934 | Bacteria | 376934 |
| 332 | Ga0207686_10000127 | 3300025934 | Bacteria | 61880 |
| 333 | Ga0207686_10000965 | 3300025934 | Bacteria | 17144 |
| 334 | Ga0207686_10075763 | 3300025934 | Bacteria | 2179 |
| 335 | Ga0207709_10000017 | 3300025935 | Bacteria | 470753 |
| 336 | Ga0207709_10003560 | 3300025935 | Bacteria | 9208 |
| 337 | Ga0207709_10259618 | 3300025935 | Bacteria | 1273 |
| 338 | Ga0207670_10059209 | 3300025936 | Bacteria | 2605 |
| 339 | Ga0207670_10497503 | 3300025936 | Unclassified | 989 |
| 340 | Ga0207704_10072800 | 3300025938 | Unclassified | 2186 |
| 341 | Ga0207704_10160850 | 3300025938 | Bacteria | 1597 |
| 342 | Ga0207665_10000003 | 3300025939 | Bacteria | 220666 |
| 343 | Ga0207691_10000845 | 3300025940 | Bacteria | 30493 |
| 344 | Ga0207691_10071431 | 3300025940 | Bacteria | 3132 |
| 345 | Ga0207691_10200522 | 3300025940 | Bacteria | 1737 |
| 346 | Ga0207711_10524895 | 3300025941 | Bacteria | 1104 |
| 347 | Ga0207711_10586191 | 3300025941 | Bacteria | 1040 |
| 348 | Ga0207689_10001578 | 3300025942 | Bacteria | 21602 |
| 349 | Ga0207689_10013933 | 3300025942 | Bacteria | 6848 |
| 350 | Ga0207689_10075365 | 3300025942 | Bacteria | 2773 |
| 351 | Ga0207689_10477356 | 3300025942 | Unclassified | 1044 |
| 352 | Ga0207661_10206394 | 3300025944 | Bacteria | 1730 |
| 353 | Ga0207679_10014249 | 3300025945 | Bacteria | 5223 |
| 354 | Ga0207679_10085908 | 3300025945 | Bacteria | 2418 |
| 355 | Ga0207679_10122103 | 3300025945 | Bacteria | 2076 |
| 356 | Ga0207667_10016457 | 3300025949 | Bacteria | 8356 |
| 357 | Ga0207667_10370712 | 3300025949 | Bacteria | 1459 |
| 358 | Ga0207667_11093036 | 3300025949 | Unclassified | 781 |
| 359 | Ga0207651_10000458 | 3300025960 | Bacteria | 17210 |
| 360 | Ga0207651_10083005 | 3300025960 | Bacteria | 2316 |
| 361 | Ga0207651_10217531 | 3300025960 | Bacteria | 1542 |
| 362 | Ga0207651_10842905 | 3300025960 | Unclassified | 814 |
| 363 | Ga0207712_10407046 | 3300025961 | Bacteria | 1145 |
| 364 | Ga0207640_10038600 | 3300025981 | Bacteria | 3015 |
| 365 | Ga0207640_10095816 | 3300025981 | Bacteria | 2067 |
| 366 | Ga0207658_10801764 | 3300025986 | Bacteria | 855 |
| 367 | Ga0207677_10196867 | 3300026023 | Bacteria | 1598 |
| 368 | Ga0207677_10384693 | 3300026023 | Unclassified | 1185 |
| 369 | Ga0207703_10000114 | 3300026035 | Bacteria | 96051 |
| 370 | Ga0207703_10529451 | 3300026035 | Unclassified | 1109 |
| 371 | Ga0207703_11451440 | 3300026035 | Unclassified | 660 |
| 372 | Ga0207639_10022909 | 3300026041 | Bacteria | 4504 |
| 373 | Ga0207639_10024805 | 3300026041 | Bacteria | 4345 |
| 374 | Ga0207639_10126280 | 3300026041 | Bacteria | 2110 |
| 375 | Ga0207678_10193285 | 3300026067 | Bacteria | 1740 |
| 376 | Ga0207708_10003764 | 3300026075 | Bacteria | 11175 |
| 377 | Ga0207708_10068329 | 3300026075 | Bacteria | 2720 |
| 378 | Ga0207702_10143299 | 3300026078 | Bacteria | 2165 |
| 379 | Ga0207641_10049788 | 3300026088 | Bacteria | 3542 |
| 380 | Ga0207641_10284056 | 3300026088 | Bacteria | 1558 |
| 381 | Ga0207641_11055260 | 3300026088 | Unclassified | 810 |
| 382 | Ga0207648_10166571 | 3300026089 | Unclassified | 1947 |
| 383 | Ga0207648_10222715 | 3300026089 | Bacteria | 1677 |
| 384 | Ga0207648_10421987 | 3300026089 | Bacteria | 1211 |
| 385 | Ga0207676_10011521 | 3300026095 | Bacteria | 6324 |
| 386 | Ga0207676_10045523 | 3300026095 | Bacteria | 3391 |
| 387 | Ga0207676_10179495 | 3300026095 | Bacteria | 1853 |
| 388 | Ga0207676_10269075 | 3300026095 | Unclassified | 1542 |
| 389 | Ga0207676_10379037 | 3300026095 | Unclassified | 1316 |
| 390 | Ga0207674_10002177 | 3300026116 | Bacteria | 24786 |
| 391 | Ga0207674_10203461 | 3300026116 | Bacteria | 1929 |
| 392 | Ga0207675_100005128 | 3300026118 | Bacteria | 12611 |
| 393 | Ga0207675_100580907 | 3300026118 | Bacteria | 1122 |
| 394 | Ga0207683_10436456 | 3300026121 | Bacteria | 1207 |
| 395 | Ga0209983_1044634 | 3300027665 | Bacteria | 963 |
| 396 | Ga0207428_10001780 | 3300027907 | Bacteria | 22062 |
| 397 | Ga0207428_10038699 | 3300027907 | Bacteria | 3875 |
| 398 | Ga0268265_10025222 | 3300028380 | Bacteria | 4217 |
| 399 | Ga0268265_10325009 | 3300028380 | Bacteria | 1395 |
| 400 | Ga0268265_10377246 | 3300028380 | Bacteria | 1303 |
| 401 | Ga0268265_10382835 | 3300028380 | Unclassified | 1295 |
| 402 | Ga0268264_10664672 | 3300028381 | Bacteria | 1032 |
| 403 | Ga0307405_10011070 | 3300031731 | Bacteria | 4709 |
| 404 | Ga0307413_10114587 | 3300031824 | Bacteria | 1812 |
| 405 | Ga0307407_10069112 | 3300031903 | Bacteria | 2095 |
| 406 | Ga0307412_10111368 | 3300031911 | Bacteria | 1955 |
| 407 | Ga0307414_10038324 | 3300032004 | Bacteria | 3218 |
| 408 | Ga0307414_10194859 | 3300032004 | Bacteria | 1643 |
| 409 | Ga0307415_100242011 | 3300032126 | Bacteria | 1460 |
| 410 | Ga0373952_0025361 | 3300035092 | Bacteria | 1280 |
| 411 | Ga0373923_0027593 | 3300035111 | Bacteria | 2266 |
| 412 | Ga0373936_0143241 | 3300035113 | Bacteria | 1033 |
| 413 | Ga0373954_0008910 | 3300035118 | Bacteria | 4415 |
| 414 | Ga0373955_0001640 | 3300035172 | Bacteria | 9578 |
| 415 | Ga0373924_0143950 | 3300035410 | Bacteria | 1041 |
| 416 | Ga0373927_0041502 | 3300035695 | Bacteria | 2984 |
| 417 | Ga0373933_0002364 | 3300035724 | Bacteria | 10666 |
| 418 | Ga0373947_0570968 | 3300035725 | Bacteria | 770 |
| 419 | Ga0373937_0002367 | 3300036401 | Bacteria | 15699 |
| 420 | Ga0373925_0436168 | 3300037068 | Bacteria | 1071 |
| 421 | Ga0395898_0161219 | 3300037466 | Bacteria | 2145 |
| 422 | Ga0395905_0004964 | 3300037471 | Bacteria | 13707 |
| 423 | Ga0242420_000770 | 3300038996 | Bacteria | 3882 |
| 424 | Ga0436365_1425589 | 3300039437 | Bacteria | 204653 |
| 425 | Ga0436363_0593977 | 3300039450 | Unclassified | 1238 |
| 426 | Ga0453683_0279070 | 3300044673 | Bacteria | 1067 |
| 427 | Ga0466957_0091648 | 3300044842 | Bacteria | 1905 |
| 428 | Ga0451576_0026804 | 3300045051 | Bacteria | 6194 |
| 429 | Ga0451576_0264042 | 3300045051 | Bacteria | 1800 |
| 430 | Ga0495592_0134551 | 3300046454 | Bacteria | 1725 |
| 431 | Ga0495629_0006722 | 3300046459 | Bacteria | 8503 |
| 432 | Ga0495651_0000265 | 3300046462 | Bacteria | 40572 |
| 433 | Ga0495653_0000794 | 3300046463 | Bacteria | 24254 |
| 434 | Ga0495664_0030987 | 3300046477 | Bacteria | 3134 |
| 435 | Ga0495594_0371333 | 3300046499 | Bacteria | 814 |
| 436 | Ga0495618_0001577 | 3300046514 | Bacteria | 15250 |
| 437 | Ga0495628_0024335 | 3300046516 | Bacteria | 4957 |
| 438 | Ga0495630_0261906 | 3300046517 | Bacteria | 1321 |
| 439 | Ga0495652_0010236 | 3300046529 | Bacteria | 8503 |
| 440 | Ga0495587_0003591 | 3300046536 | Bacteria | 10327 |
| 441 | Ga0495598_0014643 | 3300046537 | Bacteria | 1965 |
| 442 | Ga0495621_0085482 | 3300046539 | Bacteria | 1182 |
| 443 | Ga0495667_0002082 | 3300046559 | Bacteria | 13299 |
| 444 | Ga0495634_0019596 | 3300046642 | Bacteria | 4805 |
| 445 | Ga0495635_0075401 | 3300046663 | Bacteria | 2310 |
| 446 | Ga0495659_0191392 | 3300046664 | Unclassified | 836 |
| 447 | Ga0495657_0082049 | 3300046675 | Bacteria | 2084 |
| 448 | Ga0495599_0157125 | 3300046678 | Bacteria | 1406 |
| 449 | Ga0495623_0150082 | 3300046679 | Bacteria | 1378 |
| 450 | Ga0495646_0005043 | 3300046680 | Bacteria | 8328 |
| 451 | Ga0495613_0400363 | 3300046689 | Bacteria | 936 |
| 452 | Ga0495624_0028165 | 3300046690 | Bacteria | 3673 |
| 453 | Ga0495600_0015406 | 3300046809 | Bacteria | 4833 |
| 454 | Ga0495581_0055077 | 3300047315 | Bacteria | 2296 |
| 455 | Ga0495604_0000118 | 3300047317 | Bacteria | 66698 |
| 456 | Ga0495636_0014016 | 3300047318 | Bacteria | 3186 |
| 457 | Ga0495674_0035843 | 3300047319 | Bacteria | 4472 |
| 458 | Ga0495676_0024770 | 3300047321 | Bacteria | 5187 |
| 459 | Ga0495680_0001567 | 3300047322 | Bacteria | 24484 |
| 460 | Ga0495675_0017097 | 3300047444 | Bacteria | 4592 |
| 461 | Ga0495684_0094079 | 3300047471 | Bacteria | 2270 |
| 462 | Ga0495593_0042124 | 3300047673 | Bacteria | 2452 |
| 463 | Ga0495602_0171041 | 3300048088 | Bacteria | 1686 |
| 464 | Ga0496101_0783079 | 3300048904 | Bacteria | 752 |
| 465 | Ga0496102_0417597 | 3300048905 | Bacteria | 1260 |
| 466 | Ga0496102_0494783 | 3300048905 | Bacteria | 1144 |
| 467 | Ga0496103_0385706 | 3300048906 | Bacteria | 900 |
| 468 | Ga0496104_0126305 | 3300048907 | Bacteria | 2456 |
| 469 | Ga0496104_0154561 | 3300048907 | Bacteria | 2202 |
| 470 | Ga0496106_0001061 | 3300048909 | Bacteria | 20265 |
| 471 | Ga0496106_0013867 | 3300048909 | Bacteria | 5955 |
| 472 | Ga0496106_0114781 | 3300048909 | Bacteria | 2100 |
| 473 | Ga0496107_0521092 | 3300048910 | Bacteria | 881 |
| 474 | Ga0496109_0387194 | 3300048912 | Bacteria | 1321 |
| 475 | Ga0496109_0471231 | 3300048912 | Unclassified | 1186 |
| 476 | Ga0496109_0689132 | 3300048912 | Bacteria | 959 |
| 477 | Ga0496111_0783394 | 3300048914 | Bacteria | 691 |
| 478 | Ga0496114_0015654 | 3300048917 | Bacteria | 6102 |
| 479 | Ga0496115_0244161 | 3300048918 | Bacteria | 1480 |
| 480 | Ga0501048_0949693 | 3300049582 | Bacteria | 618 |
| 481 | nmdc:mga05p37_1251401_c1 | 3300050507 | Unclassified | 761 |
| 482 | nmdc:mga05p37_131870_c1 | 3300050507 | Bacteria | 3066 |
| 483 | nmdc:mga05p37_370776_c1 | 3300050507 | Bacteria | 1680 |
| 484 | nmdc:mga05p37_494463_c1 | 3300050507 | Bacteria | 1405 |
| 485 | nmdc:mga09592_44391_c1 | 3300050508 | Bacteria | 3741 |
| 486 | nmdc:mga09592_57792_c1 | 3300050508 | Bacteria | 3279 |
| 487 | nmdc:mga0n895_303321_c1 | 3300050512 | Bacteria | 1619 |
| 488 | nmdc:mga0n895_511244_c1 | 3300050512 | Bacteria | 1209 |
| 489 | nmdc:mga0n895_655403_c1 | 3300050512 | Bacteria | 1048 |
| 490 | nmdc:mga0a205_321973_c1 | 3300050515 | Bacteria | 1417 |
| 491 | nmdc:mga0a205_785940_c1 | 3300050515 | Bacteria | 800 |
| 492 | nmdc:mga0a205_79798_c1 | 3300050515 | Unclassified | 3162 |
| 493 | Ga0495601_0088382 | 3300053077 | Bacteria | 1992 |
| 494 | Ga0495601_0139145 | 3300053077 | Bacteria | 1583 |
| 495 | Ga0495612_0003390 | 3300053078 | Bacteria | 6603 |
| 496 | Ga0495595_0000324 | 3300053084 | Bacteria | 18614 |
| 497 | Ga0495619_0135725 | 3300053085 | Bacteria | 1692 |
| 498 | Ga0530510_0087213 | 3300061734 | Bacteria | 2274 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005467 | Ga0070706_100015375 | Ga0070706_1000153751 | 165 |
| 2 | 3300005468 | Ga0070707_100157293 | Ga0070707_1001572932 | 165 |
| 3 | 3300025910 | Ga0207684_10067409 | Ga0207684_100674093 | 165 |
| 4 | 3300025922 | Ga0207646_10250256 | Ga0207646_102502562 | 165 |
| 5 | 3300005437 | Ga0070710_10185525 | Ga0070710_101855252 | 170 |
| 6 | 3300005577 | Ga0068857_100241658 | Ga0068857_1002416582 | 170 |
| 7 | 3300013306 | Ga0163162_10985617 | Ga0163162_109856172 | 170 |
| 8 | 3300025898 | Ga0207692_10315608 | Ga0207692_103156082 | 170 |
| 9 | 3300026116 | Ga0207674_10203461 | Ga0207674_102034612 | 170 |
| 10 | 3300028380 | Ga0268265_10382835 | Ga0268265_103828352 | 170 |
| 11 | 3300035111 | Ga0373923_0027593 | Ga0373923_0027593_1655_2242 | 170 |
| 12 | 3300035113 | Ga0373936_0143241 | Ga0373936_0143241_153_740 | 170 |
| 13 | 3300035118 | Ga0373954_0008910 | Ga0373954_0008910_1863_2450 | 170 |
| 14 | 3300035172 | Ga0373955_0001640 | Ga0373955_0001640_6651_7238 | 170 |
| 15 | 3300035695 | Ga0373927_0041502 | Ga0373927_0041502_111_698 | 170 |
| 16 | 3300035724 | Ga0373933_0002364 | Ga0373933_0002364_1381_1968 | 170 |
| 17 | 3300035725 | Ga0373947_0570968 | Ga0373947_0570968_131_718 | 170 |
| 18 | 3300036401 | Ga0373937_0002367 | Ga0373937_0002367_4187_4774 | 170 |
| 19 | 3300037068 | Ga0373925_0436168 | Ga0373925_0436168_10_597 | 170 |
| 20 | 3300046454 | Ga0495592_0134551 | Ga0495592_0134551_1098_1685 | 170 |
| 21 | 3300046459 | Ga0495629_0006722 | Ga0495629_0006722_4708_5295 | 170 |
| 22 | 3300046462 | Ga0495651_0000265 | Ga0495651_0000265_28342_28929 | 170 |
| 23 | 3300046463 | Ga0495653_0000794 | Ga0495653_0000794_9874_10461 | 170 |
| 24 | 3300046477 | Ga0495664_0030987 | Ga0495664_0030987_283_870 | 170 |
| 25 | 3300046499 | Ga0495594_0371333 | Ga0495594_0371333_132_719 | 170 |
| 26 | 3300046514 | Ga0495618_0001577 | Ga0495618_0001577_14403_14990 | 170 |
| 27 | 3300046516 | Ga0495628_0024335 | Ga0495628_0024335_2460_3047 | 170 |
| 28 | 3300046517 | Ga0495630_0261906 | Ga0495630_0261906_47_634 | 170 |
| 29 | 3300046529 | Ga0495652_0010236 | Ga0495652_0010236_1736_2323 | 170 |
| 30 | 3300046536 | Ga0495587_0003591 | Ga0495587_0003591_4527_5114 | 170 |
| 31 | 3300046559 | Ga0495667_0002082 | Ga0495667_0002082_4112_4699 | 170 |
| 32 | 3300046642 | Ga0495634_0019596 | Ga0495634_0019596_459_1046 | 170 |
| 33 | 3300046663 | Ga0495635_0075401 | Ga0495635_0075401_785_1372 | 170 |
| 34 | 3300046675 | Ga0495657_0082049 | Ga0495657_0082049_1484_2071 | 170 |
| 35 | 3300046678 | Ga0495599_0157125 | Ga0495599_0157125_422_1009 | 170 |
| 36 | 3300046679 | Ga0495623_0150082 | Ga0495623_0150082_422_1009 | 170 |
| 37 | 3300046680 | Ga0495646_0005043 | Ga0495646_0005043_4328_4915 | 170 |
| 38 | 3300046689 | Ga0495613_0400363 | Ga0495613_0400363_94_681 | 170 |
| 39 | 3300046690 | Ga0495624_0028165 | Ga0495624_0028165_137_724 | 170 |
| 40 | 3300046809 | Ga0495600_0015406 | Ga0495600_0015406_4163_4750 | 170 |
| 41 | 3300047315 | Ga0495581_0055077 | Ga0495581_0055077_1173_1760 | 170 |
| 42 | 3300047317 | Ga0495604_0000118 | Ga0495604_0000118_23461_24048 | 170 |
| 43 | 3300047319 | Ga0495674_0035843 | Ga0495674_0035843_3627_4214 | 170 |
| 44 | 3300047321 | Ga0495676_0024770 | Ga0495676_0024770_3209_3796 | 170 |
| 45 | 3300047322 | Ga0495680_0001567 | Ga0495680_0001567_95_682 | 170 |
| 46 | 3300047444 | Ga0495675_0017097 | Ga0495675_0017097_124_711 | 170 |
| 47 | 3300047673 | Ga0495593_0042124 | Ga0495593_0042124_298_885 | 170 |
| 48 | 3300048088 | Ga0495602_0171041 | Ga0495602_0171041_680_1267 | 170 |
| 49 | 3300048912 | Ga0496109_0689132 | Ga0496109_0689132_71_661 | 170 |
| 50 | 3300053077 | Ga0495601_0088382 | Ga0495601_0088382_970_1557 | 170 |
| 51 | 3300053078 | Ga0495612_0003390 | Ga0495612_0003390_5910_6497 | 170 |
| 52 | 3300053084 | Ga0495595_0000324 | Ga0495595_0000324_222_809 | 170 |
| 53 | 3300053085 | Ga0495619_0135725 | Ga0495619_0135725_436_1023 | 170 |
| 54 | 3300061734 | Ga0530510_0087213 | Ga0530510_0087213_1198_1764 | 170 |
| 55 | 3300005330 | Ga0070690_100550259 | Ga0070690_1005502592 | 172 |
| 56 | 3300006881 | Ga0068865_100107062 | Ga0068865_1001070623 | 172 |
| 57 | 3300025938 | Ga0207704_10072800 | Ga0207704_100728003 | 172 |
| 58 | 3300005290 | Ga0065712_10230829 | Ga0065712_102308292 | 173 |
| 59 | 3300005293 | Ga0065715_10006849 | Ga0065715_100068493 | 173 |
| 60 | 3300005618 | Ga0068864_100494665 | Ga0068864_1004946651 | 173 |
| 61 | 3300013296 | Ga0157374_10096903 | Ga0157374_100969033 | 173 |
| 62 | 3300044842 | Ga0466957_0091648 | Ga0466957_0091648_875_1504 | 173 |
| 63 | 3300048904 | Ga0496101_0783079 | Ga0496101_0783079_147_734 | 173 |
| 64 | 3300048907 | Ga0496104_0154561 | Ga0496104_0154561_1004_1591 | 173 |
| 65 | 3300048912 | Ga0496109_0387194 | Ga0496109_0387194_82_669 | 173 |
| 66 | 3300048917 | Ga0496114_0015654 | Ga0496114_0015654_499_1086 | 173 |
| 67 | 3300048918 | Ga0496115_0244161 | Ga0496115_0244161_807_1442 | 173 |
| 68 | 3300053077 | Ga0495601_0139145 | Ga0495601_0139145_280_867 | 173 |
| 69 | 3300003203 | JGI25406J46586_10004972 | JGI25406J46586_100049728 | 174 |
| 70 | 3300003322 | rootL2_10270263 | rootL2_102702632 | 174 |
| 71 | 3300005330 | Ga0070690_100071973 | Ga0070690_1000719732 | 174 |
| 72 | 3300005340 | Ga0070689_100367016 | Ga0070689_1003670161 | 174 |
| 73 | 3300005353 | Ga0070669_100100644 | Ga0070669_1001006442 | 174 |
| 74 | 3300005353 | Ga0070669_100473890 | Ga0070669_1004738902 | 174 |
| 75 | 3300005438 | Ga0070701_10031103 | Ga0070701_100311033 | 174 |
| 76 | 3300005615 | Ga0070702_100250650 | Ga0070702_1002506502 | 174 |
| 77 | 3300005615 | Ga0070702_100273481 | Ga0070702_1002734812 | 174 |
| 78 | 3300005617 | Ga0068859_100028738 | Ga0068859_1000287382 | 174 |
| 79 | 3300005840 | Ga0068870_10208448 | Ga0068870_102084482 | 174 |
| 80 | 3300005842 | Ga0068858_100813773 | Ga0068858_1008137732 | 174 |
| 81 | 3300005843 | Ga0068860_100423456 | Ga0068860_1004234562 | 174 |
| 82 | 3300005844 | Ga0068862_100008314 | Ga0068862_1000083144 | 174 |
| 83 | 3300005844 | Ga0068862_100053059 | Ga0068862_1000530592 | 174 |
| 84 | 3300005844 | Ga0068862_100088469 | Ga0068862_1000884693 | 174 |
| 85 | 3300005937 | Ga0081455_10414226 | Ga0081455_104142262 | 174 |
| 86 | 3300006173 | Ga0070716_100000003 | Ga0070716_10000000336 | 174 |
| 87 | 3300006173 | Ga0070716_100295903 | Ga0070716_1002959031 | 174 |
| 88 | 3300006844 | Ga0075428_100308704 | Ga0075428_1003087042 | 174 |
| 89 | 3300006880 | Ga0075429_100008602 | Ga0075429_1000086029 | 174 |
| 90 | 3300006880 | Ga0075429_100046987 | Ga0075429_1000469874 | 174 |
| 91 | 3300006881 | Ga0068865_100861070 | Ga0068865_1008610701 | 174 |
| 92 | 3300006931 | Ga0097620_100028740 | Ga0097620_1000287402 | 174 |
| 93 | 3300009094 | Ga0111539_10144414 | Ga0111539_101444142 | 174 |
| 94 | 3300009147 | Ga0114129_11446692 | Ga0114129_114466921 | 174 |
| 95 | 3300009174 | Ga0105241_11041697 | Ga0105241_110416972 | 174 |
| 96 | 3300009176 | Ga0105242_10918653 | Ga0105242_109186532 | 174 |
| 97 | 3300009553 | Ga0105249_10017805 | Ga0105249_100178052 | 174 |
| 98 | 3300009553 | Ga0105249_10106766 | Ga0105249_101067662 | 174 |
| 99 | 3300013297 | Ga0157378_10019632 | Ga0157378_100196322 | 174 |
| 100 | 3300013297 | Ga0157378_10546937 | Ga0157378_105469372 | 174 |
| 101 | 3300013308 | Ga0157375_10759080 | Ga0157375_107590802 | 174 |
| 102 | 3300013308 | Ga0157375_10843862 | Ga0157375_108438622 | 174 |
| 103 | 3300014325 | Ga0163163_10693279 | Ga0163163_106932791 | 174 |
| 104 | 3300014326 | Ga0157380_10002797 | Ga0157380_1000279710 | 174 |
| 105 | 3300025918 | Ga0207662_10064160 | Ga0207662_100641602 | 174 |
| 106 | 3300025923 | Ga0207681_10115201 | Ga0207681_101152011 | 174 |
| 107 | 3300025926 | Ga0207659_10387846 | Ga0207659_103878461 | 174 |
| 108 | 3300025933 | Ga0207706_10047991 | Ga0207706_100479912 | 174 |
| 109 | 3300025939 | Ga0207665_10000003 | Ga0207665_1000000382 | 174 |
| 110 | 3300025961 | Ga0207712_10407046 | Ga0207712_104070461 | 174 |
| 111 | 3300026089 | Ga0207648_10421987 | Ga0207648_104219872 | 174 |
| 112 | 3300026095 | Ga0207676_10379037 | Ga0207676_103790372 | 174 |
| 113 | 3300027907 | Ga0207428_10001780 | Ga0207428_100017809 | 174 |
| 114 | 3300028380 | Ga0268265_10025222 | Ga0268265_100252223 | 174 |
| 115 | 3300037466 | Ga0395898_0161219 | Ga0395898_0161219_627_1196 | 174 |
| 116 | 3300046537 | Ga0495598_0014643 | Ga0495598_0014643_117_713 | 174 |
| 117 | 3300046664 | Ga0495659_0191392 | Ga0495659_0191392_19_615 | 174 |
| 118 | 3300049582 | Ga0501048_0949693 | Ga0501048_0949693_26_604 | 174 |
| 119 | 3300050507 | nmdc:mga05p37_494463_c1 | nmdc:mga05p37_494463_c1_213_791 | 174 |
| 120 | 3300050508 | nmdc:mga09592_57792_c1 | nmdc:mga09592_57792_c1_1740_2336 | 174 |
| 121 | 3300005445 | Ga0070708_100401702 | Ga0070708_1004017021 | 175 |
| 122 | 3300005293 | Ga0065715_10234882 | Ga0065715_102348821 | 176 |
| 123 | 3300005328 | Ga0070676_10117649 | Ga0070676_101176492 | 176 |
| 124 | 3300005339 | Ga0070660_100015860 | Ga0070660_1000158603 | 176 |
| 125 | 3300005344 | Ga0070661_100171093 | Ga0070661_1001710932 | 176 |
| 126 | 3300005353 | Ga0070669_100316382 | Ga0070669_1003163822 | 176 |
| 127 | 3300005354 | Ga0070675_100264740 | Ga0070675_1002647401 | 176 |
| 128 | 3300005355 | Ga0070671_100035876 | Ga0070671_1000358762 | 176 |
| 129 | 3300005366 | Ga0070659_100001017 | Ga0070659_1000010174 | 176 |
| 130 | 3300005455 | Ga0070663_100021070 | Ga0070663_1000210702 | 176 |
| 131 | 3300005457 | Ga0070662_100004111 | Ga0070662_1000041115 | 176 |
| 132 | 3300005458 | Ga0070681_10279524 | Ga0070681_102795242 | 176 |
| 133 | 3300005539 | Ga0068853_100005087 | Ga0068853_1000050875 | 176 |
| 134 | 3300005543 | Ga0070672_100175728 | Ga0070672_1001757282 | 176 |
| 135 | 3300005563 | Ga0068855_100457794 | Ga0068855_1004577942 | 176 |
| 136 | 3300005564 | Ga0070664_100021164 | Ga0070664_1000211642 | 176 |
| 137 | 3300005578 | Ga0068854_100065028 | Ga0068854_1000650282 | 176 |
| 138 | 3300005614 | Ga0068856_100005065 | Ga0068856_1000050658 | 176 |
| 139 | 3300005616 | Ga0068852_100025692 | Ga0068852_1000256924 | 176 |
| 140 | 3300005841 | Ga0068863_100473260 | Ga0068863_1004732602 | 176 |
| 141 | 3300006871 | Ga0075434_100424810 | Ga0075434_1004248102 | 176 |
| 142 | 3300009174 | Ga0105241_10612916 | Ga0105241_106129161 | 176 |
| 143 | 3300013100 | Ga0157373_10009902 | Ga0157373_100099023 | 176 |
| 144 | 3300013102 | Ga0157371_10002099 | Ga0157371_1000209911 | 176 |
| 145 | 3300013307 | Ga0157372_10002796 | Ga0157372_1000279610 | 176 |
| 146 | 3300014325 | Ga0163163_10720689 | Ga0163163_107206892 | 176 |
| 147 | 3300014745 | Ga0157377_10738961 | Ga0157377_107389611 | 176 |
| 148 | 3300025907 | Ga0207645_10014191 | Ga0207645_100141914 | 176 |
| 149 | 3300025912 | Ga0207707_10512896 | Ga0207707_105128961 | 176 |
| 150 | 3300025919 | Ga0207657_10001461 | Ga0207657_1000146114 | 176 |
| 151 | 3300025923 | Ga0207681_10170327 | Ga0207681_101703272 | 176 |
| 152 | 3300025926 | Ga0207659_10142165 | Ga0207659_101421652 | 176 |
| 153 | 3300025931 | Ga0207644_10043980 | Ga0207644_100439801 | 176 |
| 154 | 3300025932 | Ga0207690_10002569 | Ga0207690_100025699 | 176 |
| 155 | 3300025933 | Ga0207706_10000040 | Ga0207706_1000004096 | 176 |
| 156 | 3300025940 | Ga0207691_10071431 | Ga0207691_100714312 | 176 |
| 157 | 3300025945 | Ga0207679_10014249 | Ga0207679_100142495 | 176 |
| 158 | 3300025949 | Ga0207667_10016457 | Ga0207667_100164577 | 176 |
| 159 | 3300025981 | Ga0207640_10038600 | Ga0207640_100386002 | 176 |
| 160 | 3300026041 | Ga0207639_10022909 | Ga0207639_100229093 | 176 |
| 161 | 3300026067 | Ga0207678_10193285 | Ga0207678_101932852 | 176 |
| 162 | 3300035092 | Ga0373952_0025361 | Ga0373952_0025361_651_1262 | 176 |
| 163 | 3300048905 | Ga0496102_0417597 | Ga0496102_0417597_245_856 | 176 |
| 164 | 3300048909 | Ga0496106_0013867 | Ga0496106_0013867_22_585 | 176 |
| 165 | 3300048910 | Ga0496107_0521092 | Ga0496107_0521092_203_805 | 176 |
| 166 | 3300050512 | nmdc:mga0n895_511244_c1 | nmdc:mga0n895_511244_c1_384_995 | 176 |
| 167 | 3300005289 | Ga0065704_10226521 | Ga0065704_102265212 | 177 |
| 168 | 3300005293 | Ga0065715_10452523 | Ga0065715_104525231 | 177 |
| 169 | 3300005328 | Ga0070676_10189056 | Ga0070676_101890562 | 177 |
| 170 | 3300005331 | Ga0070670_100098707 | Ga0070670_1000987073 | 177 |
| 171 | 3300005334 | Ga0068869_100063965 | Ga0068869_1000639652 | 177 |
| 172 | 3300005338 | Ga0068868_100486995 | Ga0068868_1004869952 | 177 |
| 173 | 3300005406 | Ga0070703_10000049 | Ga0070703_1000004915 | 177 |
| 174 | 3300005441 | Ga0070700_100001704 | Ga0070700_1000017045 | 177 |
| 175 | 3300005445 | Ga0070708_100115867 | Ga0070708_1001158672 | 177 |
| 176 | 3300005458 | Ga0070681_10002824 | Ga0070681_1000282410 | 177 |
| 177 | 3300005530 | Ga0070679_100002739 | Ga0070679_10000273910 | 177 |
| 178 | 3300005536 | Ga0070697_100047176 | Ga0070697_1000471762 | 177 |
| 179 | 3300005536 | Ga0070697_100177249 | Ga0070697_1001772492 | 177 |
| 180 | 3300005536 | Ga0070697_100254496 | Ga0070697_1002544962 | 177 |
| 181 | 3300005545 | Ga0070695_100476441 | Ga0070695_1004764412 | 177 |
| 182 | 3300005546 | Ga0070696_100046765 | Ga0070696_1000467652 | 177 |
| 183 | 3300005547 | Ga0070693_100435347 | Ga0070693_1004353471 | 177 |
| 184 | 3300005549 | Ga0070704_100391633 | Ga0070704_1003916332 | 177 |
| 185 | 3300005617 | Ga0068859_100008267 | Ga0068859_1000082672 | 177 |
| 186 | 3300005618 | Ga0068864_100135768 | Ga0068864_1001357683 | 177 |
| 187 | 3300005843 | Ga0068860_100061286 | Ga0068860_1000612864 | 177 |
| 188 | 3300005844 | Ga0068862_100416813 | Ga0068862_1004168132 | 177 |
| 189 | 3300005985 | Ga0081539_10001244 | Ga0081539_1000124412 | 177 |
| 190 | 3300006931 | Ga0097620_100008267 | Ga0097620_1000082672 | 177 |
| 191 | 3300007076 | Ga0075435_100624793 | Ga0075435_1006247932 | 177 |
| 192 | 3300009094 | Ga0111539_10384707 | Ga0111539_103847072 | 177 |
| 193 | 3300009147 | Ga0114129_10035058 | Ga0114129_100350584 | 177 |
| 194 | 3300009177 | Ga0105248_10421429 | Ga0105248_104214292 | 177 |
| 195 | 3300009553 | Ga0105249_10799596 | Ga0105249_107995962 | 177 |
| 196 | 3300009553 | Ga0105249_11169482 | Ga0105249_111694821 | 177 |
| 197 | 3300013306 | Ga0163162_10047575 | Ga0163162_100475755 | 177 |
| 198 | 3300013306 | Ga0163162_10118009 | Ga0163162_101180093 | 177 |
| 199 | 3300013308 | Ga0157375_10066315 | Ga0157375_100663154 | 177 |
| 200 | 3300013308 | Ga0157375_10145214 | Ga0157375_101452142 | 177 |
| 201 | 3300014325 | Ga0163163_10063185 | Ga0163163_100631854 | 177 |
| 202 | 3300021384 | Ga0213876_10000112 | Ga0213876_1000011224 | 177 |
| 203 | 3300025885 | Ga0207653_10000163 | Ga0207653_1000016333 | 177 |
| 204 | 3300025910 | Ga0207684_10520722 | Ga0207684_105207221 | 177 |
| 205 | 3300025912 | Ga0207707_10000008 | Ga0207707_100000089 | 177 |
| 206 | 3300025921 | Ga0207652_10000085 | Ga0207652_1000008579 | 177 |
| 207 | 3300025922 | Ga0207646_10524731 | Ga0207646_105247312 | 177 |
| 208 | 3300025940 | Ga0207691_10200522 | Ga0207691_102005221 | 177 |
| 209 | 3300025942 | Ga0207689_10075365 | Ga0207689_100753652 | 177 |
| 210 | 3300025981 | Ga0207640_10095816 | Ga0207640_100958162 | 177 |
| 211 | 3300026075 | Ga0207708_10003764 | Ga0207708_100037643 | 177 |
| 212 | 3300026095 | Ga0207676_10045523 | Ga0207676_100455234 | 177 |
| 213 | 3300028380 | Ga0268265_10325009 | Ga0268265_103250092 | 177 |
| 214 | 3300028381 | Ga0268264_10664672 | Ga0268264_106646722 | 177 |
| 215 | 3300037471 | Ga0395905_0004964 | Ga0395905_0004964_5095_5694 | 177 |
| 216 | 3300039437 | Ga0436365_1425589 | Ga0436365_1425589_79780_80403 | 177 |
| 217 | 3300050507 | nmdc:mga05p37_370776_c1 | nmdc:mga05p37_370776_c1_986_1603 | 177 |
| 218 | 3300050512 | nmdc:mga0n895_303321_c1 | nmdc:mga0n895_303321_c1_14_622 | 177 |
| 219 | 3300050515 | nmdc:mga0a205_321973_c1 | nmdc:mga0a205_321973_c1_97_657 | 177 |
| 220 | 3300050515 | nmdc:mga0a205_785940_c1 | nmdc:mga0a205_785940_c1_38_655 | 177 |
| 221 | 3300005293 | Ga0065715_10089819 | Ga0065715_100898195 | 178 |
| 222 | 3300005331 | Ga0070670_100001205 | Ga0070670_1000012057 | 178 |
| 223 | 3300005335 | Ga0070666_10210886 | Ga0070666_102108861 | 178 |
| 224 | 3300005340 | Ga0070689_100073043 | Ga0070689_1000730431 | 178 |
| 225 | 3300005354 | Ga0070675_100170986 | Ga0070675_1001709863 | 178 |
| 226 | 3300005355 | Ga0070671_100008298 | Ga0070671_1000082989 | 178 |
| 227 | 3300005365 | Ga0070688_100158442 | Ga0070688_1001584423 | 178 |
| 228 | 3300005366 | Ga0070659_100173016 | Ga0070659_1001730162 | 178 |
| 229 | 3300005549 | Ga0070704_100077876 | Ga0070704_1000778763 | 178 |
| 230 | 3300005617 | Ga0068859_100131903 | Ga0068859_1001319034 | 178 |
| 231 | 3300005618 | Ga0068864_100345073 | Ga0068864_1003450731 | 178 |
| 232 | 3300006237 | Ga0097621_100134105 | Ga0097621_1001341052 | 178 |
| 233 | 3300006358 | Ga0068871_100477828 | Ga0068871_1004778283 | 178 |
| 234 | 3300006844 | Ga0075428_100143367 | Ga0075428_1001433672 | 178 |
| 235 | 3300006931 | Ga0097620_100131901 | Ga0097620_1001319014 | 178 |
| 236 | 3300009011 | Ga0105251_10238313 | Ga0105251_102383131 | 178 |
| 237 | 3300009147 | Ga0114129_10514373 | Ga0114129_105143732 | 178 |
| 238 | 3300009176 | Ga0105242_10003928 | Ga0105242_100039283 | 178 |
| 239 | 3300009177 | Ga0105248_10695275 | Ga0105248_106952752 | 178 |
| 240 | 3300011119 | Ga0105246_10187732 | Ga0105246_101877322 | 178 |
| 241 | 3300013308 | Ga0157375_10236150 | Ga0157375_102361502 | 178 |
| 242 | 3300025910 | Ga0207684_10119015 | Ga0207684_101190152 | 178 |
| 243 | 3300025922 | Ga0207646_10042513 | Ga0207646_100425133 | 178 |
| 244 | 3300025925 | Ga0207650_10000675 | Ga0207650_1000067513 | 178 |
| 245 | 3300025934 | Ga0207686_10000003 | Ga0207686_10000003225 | 178 |
| 246 | 3300025935 | Ga0207709_10000017 | Ga0207709_10000017284 | 178 |
| 247 | 3300025936 | Ga0207670_10059209 | Ga0207670_100592093 | 178 |
| 248 | 3300025942 | Ga0207689_10477356 | Ga0207689_104773561 | 178 |
| 249 | 3300025960 | Ga0207651_10217531 | Ga0207651_102175312 | 178 |
| 250 | 3300026088 | Ga0207641_10049788 | Ga0207641_100497883 | 178 |
| 251 | 3300026118 | Ga0207675_100580907 | Ga0207675_1005809072 | 178 |
| 252 | 3300032004 | Ga0307414_10194859 | Ga0307414_101948591 | 178 |
| 253 | 3300045051 | Ga0451576_0026804 | Ga0451576_0026804_894_1535 | 178 |
| 254 | 3300050508 | nmdc:mga09592_44391_c1 | nmdc:mga09592_44391_c1_1358_1921 | 178 |
| 255 | 3300005290 | Ga0065712_10097629 | Ga0065712_100976292 | 179 |
| 256 | 3300005290 | Ga0065712_10261260 | Ga0065712_102612602 | 179 |
| 257 | 3300005293 | Ga0065715_10096528 | Ga0065715_100965282 | 179 |
| 258 | 3300005293 | Ga0065715_10288674 | Ga0065715_102886741 | 179 |
| 259 | 3300005329 | Ga0070683_100129090 | Ga0070683_1001290902 | 179 |
| 260 | 3300005330 | Ga0070690_100181611 | Ga0070690_1001816111 | 179 |
| 261 | 3300005336 | Ga0070680_100025267 | Ga0070680_1000252674 | 179 |
| 262 | 3300005337 | Ga0070682_100117422 | Ga0070682_1001174222 | 179 |
| 263 | 3300005338 | Ga0068868_100086036 | Ga0068868_1000860362 | 179 |
| 264 | 3300005339 | Ga0070660_100378574 | Ga0070660_1003785742 | 179 |
| 265 | 3300005344 | Ga0070661_100024590 | Ga0070661_1000245902 | 179 |
| 266 | 3300005355 | Ga0070671_100409967 | Ga0070671_1004099671 | 179 |
| 267 | 3300005364 | Ga0070673_100000212 | Ga0070673_10000021213 | 179 |
| 268 | 3300005366 | Ga0070659_100000997 | Ga0070659_1000009974 | 179 |
| 269 | 3300005367 | Ga0070667_100159222 | Ga0070667_1001592222 | 179 |
| 270 | 3300005444 | Ga0070694_100220977 | Ga0070694_1002209772 | 179 |
| 271 | 3300005455 | Ga0070663_100142005 | Ga0070663_1001420052 | 179 |
| 272 | 3300005457 | Ga0070662_100096935 | Ga0070662_1000969352 | 179 |
| 273 | 3300005458 | Ga0070681_10090269 | Ga0070681_100902692 | 179 |
| 274 | 3300005518 | Ga0070699_100154971 | Ga0070699_1001549713 | 179 |
| 275 | 3300005530 | Ga0070679_100020243 | Ga0070679_1000202432 | 179 |
| 276 | 3300005539 | Ga0068853_100010682 | Ga0068853_1000106825 | 179 |
| 277 | 3300005539 | Ga0068853_100101570 | Ga0068853_1001015702 | 179 |
| 278 | 3300005548 | Ga0070665_100237784 | Ga0070665_1002377841 | 179 |
| 279 | 3300005564 | Ga0070664_100002145 | Ga0070664_10000214514 | 179 |
| 280 | 3300005614 | Ga0068856_100995567 | Ga0068856_1009955672 | 179 |
| 281 | 3300005616 | Ga0068852_100312414 | Ga0068852_1003124141 | 179 |
| 282 | 3300005617 | Ga0068859_100164248 | Ga0068859_1001642482 | 179 |
| 283 | 3300005618 | Ga0068864_100050313 | Ga0068864_1000503133 | 179 |
| 284 | 3300005618 | Ga0068864_100233899 | Ga0068864_1002338992 | 179 |
| 285 | 3300005719 | Ga0068861_100006204 | Ga0068861_1000062048 | 179 |
| 286 | 3300005840 | Ga0068870_10089753 | Ga0068870_100897532 | 179 |
| 287 | 3300005841 | Ga0068863_100270716 | Ga0068863_1002707161 | 179 |
| 288 | 3300006237 | Ga0097621_100081546 | Ga0097621_1000815462 | 179 |
| 289 | 3300006852 | Ga0075433_10027319 | Ga0075433_100273192 | 179 |
| 290 | 3300006871 | Ga0075434_100418798 | Ga0075434_1004187982 | 179 |
| 291 | 3300006881 | Ga0068865_101024061 | Ga0068865_1010240611 | 179 |
| 292 | 3300006931 | Ga0097620_100164243 | Ga0097620_1001642432 | 179 |
| 293 | 3300009177 | Ga0105248_10013612 | Ga0105248_100136122 | 179 |
| 294 | 3300009545 | Ga0105237_10050235 | Ga0105237_100502353 | 179 |
| 295 | 3300010375 | Ga0105239_10426036 | Ga0105239_104260362 | 179 |
| 296 | 3300013100 | Ga0157373_10025815 | Ga0157373_100258154 | 179 |
| 297 | 3300013297 | Ga0157378_10008455 | Ga0157378_100084555 | 179 |
| 298 | 3300013297 | Ga0157378_11265022 | Ga0157378_112650221 | 179 |
| 299 | 3300013306 | Ga0163162_10026360 | Ga0163162_100263602 | 179 |
| 300 | 3300013307 | Ga0157372_10010938 | Ga0157372_100109386 | 179 |
| 301 | 3300013308 | Ga0157375_10054284 | Ga0157375_100542844 | 179 |
| 302 | 3300014325 | Ga0163163_10003828 | Ga0163163_100038286 | 179 |
| 303 | 3300014325 | Ga0163163_10229485 | Ga0163163_102294852 | 179 |
| 304 | 3300014326 | Ga0157380_10001887 | Ga0157380_100018878 | 179 |
| 305 | 3300025912 | Ga0207707_10026167 | Ga0207707_100261675 | 179 |
| 306 | 3300025917 | Ga0207660_10019420 | Ga0207660_100194203 | 179 |
| 307 | 3300025919 | Ga0207657_10335503 | Ga0207657_103355032 | 179 |
| 308 | 3300025920 | Ga0207649_10186955 | Ga0207649_101869552 | 179 |
| 309 | 3300025921 | Ga0207652_10193390 | Ga0207652_101933902 | 179 |
| 310 | 3300025932 | Ga0207690_10045877 | Ga0207690_100458773 | 179 |
| 311 | 3300025936 | Ga0207670_10497503 | Ga0207670_104975032 | 179 |
| 312 | 3300025942 | Ga0207689_10013933 | Ga0207689_100139336 | 179 |
| 313 | 3300025944 | Ga0207661_10206394 | Ga0207661_102063942 | 179 |
| 314 | 3300025945 | Ga0207679_10085908 | Ga0207679_100859083 | 179 |
| 315 | 3300025949 | Ga0207667_11093036 | Ga0207667_110930361 | 179 |
| 316 | 3300025960 | Ga0207651_10000458 | Ga0207651_100004586 | 179 |
| 317 | 3300025960 | Ga0207651_10842905 | Ga0207651_108429051 | 179 |
| 318 | 3300026023 | Ga0207677_10196867 | Ga0207677_101968672 | 179 |
| 319 | 3300026041 | Ga0207639_10024805 | Ga0207639_100248052 | 179 |
| 320 | 3300026041 | Ga0207639_10126280 | Ga0207639_101262802 | 179 |
| 321 | 3300026078 | Ga0207702_10143299 | Ga0207702_101432992 | 179 |
| 322 | 3300026088 | Ga0207641_10284056 | Ga0207641_102840562 | 179 |
| 323 | 3300026089 | Ga0207648_10222715 | Ga0207648_102227152 | 179 |
| 324 | 3300026095 | Ga0207676_10011521 | Ga0207676_100115217 | 179 |
| 325 | 3300026095 | Ga0207676_10269075 | Ga0207676_102690752 | 179 |
| 326 | 3300026116 | Ga0207674_10002177 | Ga0207674_100021776 | 179 |
| 327 | 3300039450 | Ga0436363_0593977 | Ga0436363_0593977_439_1044 | 179 |
| 328 | 3300044673 | Ga0453683_0279070 | Ga0453683_0279070_439_1005 | 179 |
| 329 | 3300048905 | Ga0496102_0494783 | Ga0496102_0494783_121_687 | 179 |
| 330 | 3300048906 | Ga0496103_0385706 | Ga0496103_0385706_75_641 | 179 |
| 331 | 3300048907 | Ga0496104_0126305 | Ga0496104_0126305_1347_1913 | 179 |
| 332 | 3300048909 | Ga0496106_0114781 | Ga0496106_0114781_639_1205 | 179 |
| 333 | 3300048912 | Ga0496109_0471231 | Ga0496109_0471231_547_1113 | 179 |
| 334 | 3300048914 | Ga0496111_0783394 | Ga0496111_0783394_78_644 | 179 |
| 335 | 3300050512 | nmdc:mga0n895_655403_c1 | nmdc:mga0n895_655403_c1_421_987 | 179 |
| 336 | 3300050515 | nmdc:mga0a205_79798_c1 | nmdc:mga0a205_79798_c1_2528_3094 | 179 |
| 337 | 3300005339 | Ga0070660_100111992 | Ga0070660_1001119922 | 180 |
| 338 | 3300005344 | Ga0070661_100046710 | Ga0070661_1000467103 | 180 |
| 339 | 3300005344 | Ga0070661_100435726 | Ga0070661_1004357262 | 180 |
| 340 | 3300005467 | Ga0070706_100014813 | Ga0070706_1000148136 | 180 |
| 341 | 3300005468 | Ga0070707_100073837 | Ga0070707_1000738373 | 180 |
| 342 | 3300005471 | Ga0070698_100751163 | Ga0070698_1007511631 | 180 |
| 343 | 3300005536 | Ga0070697_100255843 | Ga0070697_1002558432 | 180 |
| 344 | 3300005563 | Ga0068855_100459814 | Ga0068855_1004598142 | 180 |
| 345 | 3300009147 | Ga0114129_10300936 | Ga0114129_103009363 | 180 |
| 346 | 3300009177 | Ga0105248_10854147 | Ga0105248_108541472 | 180 |
| 347 | 3300013104 | Ga0157370_10304894 | Ga0157370_103048942 | 180 |
| 348 | 3300013105 | Ga0157369_10346478 | Ga0157369_103464782 | 180 |
| 349 | 3300013105 | Ga0157369_10357543 | Ga0157369_103575431 | 180 |
| 350 | 3300013307 | Ga0157372_10070958 | Ga0157372_100709584 | 180 |
| 351 | 3300017792 | Ga0163161_10599949 | Ga0163161_105999491 | 180 |
| 352 | 3300025899 | Ga0207642_10131299 | Ga0207642_101312992 | 180 |
| 353 | 3300025910 | Ga0207684_10001129 | Ga0207684_1000112911 | 180 |
| 354 | 3300025919 | Ga0207657_10056266 | Ga0207657_100562663 | 180 |
| 355 | 3300025919 | Ga0207657_10120581 | Ga0207657_101205812 | 180 |
| 356 | 3300025920 | Ga0207649_10490050 | Ga0207649_104900502 | 180 |
| 357 | 3300025921 | Ga0207652_10155141 | Ga0207652_101551412 | 180 |
| 358 | 3300025931 | Ga0207644_10003580 | Ga0207644_100035802 | 180 |
| 359 | 3300025933 | Ga0207706_10088891 | Ga0207706_100888913 | 180 |
| 360 | 3300025945 | Ga0207679_10122103 | Ga0207679_101221032 | 180 |
| 361 | 3300025949 | Ga0207667_10370712 | Ga0207667_103707122 | 180 |
| 362 | 3300027665 | Ga0209983_1044634 | Ga0209983_10446342 | 180 |
| 363 | 3300031731 | Ga0307405_10011070 | Ga0307405_100110702 | 180 |
| 364 | 3300031824 | Ga0307413_10114587 | Ga0307413_101145872 | 180 |
| 365 | 3300031903 | Ga0307407_10069112 | Ga0307407_100691122 | 180 |
| 366 | 3300031911 | Ga0307412_10111368 | Ga0307412_101113682 | 180 |
| 367 | 3300032004 | Ga0307414_10038324 | Ga0307414_100383244 | 180 |
| 368 | 3300032126 | Ga0307415_100242011 | Ga0307415_1002420111 | 180 |
| 369 | 3300046539 | Ga0495621_0085482 | Ga0495621_0085482_429_1085 | 180 |
| 370 | 3300005467 | Ga0070706_100130596 | Ga0070706_1001305962 | 181 |
| 371 | 3300005445 | Ga0070708_100000191 | Ga0070708_10000019116 | 182 |
| 372 | 3300005445 | Ga0070708_100000712 | Ga0070708_1000007123 | 182 |
| 373 | 3300005467 | Ga0070706_100178958 | Ga0070706_1001789582 | 182 |
| 374 | 3300005468 | Ga0070707_100120193 | Ga0070707_1001201933 | 182 |
| 375 | 3300005471 | Ga0070698_100015126 | Ga0070698_1000151264 | 182 |
| 376 | 3300005471 | Ga0070698_100588645 | Ga0070698_1005886451 | 182 |
| 377 | 3300005518 | Ga0070699_100032163 | Ga0070699_1000321632 | 182 |
| 378 | 3300005545 | Ga0070695_100291205 | Ga0070695_1002912051 | 182 |
| 379 | 3300005546 | Ga0070696_100072022 | Ga0070696_1000720222 | 182 |
| 380 | 3300005546 | Ga0070696_100092786 | Ga0070696_1000927862 | 182 |
| 381 | 3300009148 | Ga0105243_10470793 | Ga0105243_104707932 | 182 |
| 382 | 3300009174 | Ga0105241_10590782 | Ga0105241_105907821 | 182 |
| 383 | 3300010159 | Ga0099796_10246599 | Ga0099796_102465991 | 182 |
| 384 | 3300025910 | Ga0207684_10470421 | Ga0207684_104704212 | 182 |
| 385 | 3300025911 | Ga0207654_10505856 | Ga0207654_105058561 | 182 |
| 386 | 3300025922 | Ga0207646_10274039 | Ga0207646_102740392 | 182 |
| 387 | 3300025935 | Ga0207709_10259618 | Ga0207709_102596182 | 182 |
| 388 | 3300035410 | Ga0373924_0143950 | Ga0373924_0143950_30_725 | 182 |
| 389 | 3300002074 | JGI24748J21848_1000001 | JGI24748J21848_1000001341 | 183 |
| 390 | 3300002239 | JGI24034J26672_10000001 | JGI24034J26672_1000000176 | 183 |
| 391 | 3300005290 | Ga0065712_10007428 | Ga0065712_100074282 | 183 |
| 392 | 3300005295 | Ga0065707_10092664 | Ga0065707_100926642 | 183 |
| 393 | 3300005330 | Ga0070690_100110116 | Ga0070690_1001101162 | 183 |
| 394 | 3300005334 | Ga0068869_100152273 | Ga0068869_1001522733 | 183 |
| 395 | 3300005340 | Ga0070689_100125021 | Ga0070689_1001250212 | 183 |
| 396 | 3300005343 | Ga0070687_100032970 | Ga0070687_1000329703 | 183 |
| 397 | 3300005343 | Ga0070687_100136644 | Ga0070687_1001366442 | 183 |
| 398 | 3300005345 | Ga0070692_10212327 | Ga0070692_102123272 | 183 |
| 399 | 3300005353 | Ga0070669_100072967 | Ga0070669_1000729671 | 183 |
| 400 | 3300005355 | Ga0070671_100041069 | Ga0070671_1000410696 | 183 |
| 401 | 3300005355 | Ga0070671_100311708 | Ga0070671_1003117081 | 183 |
| 402 | 3300005364 | Ga0070673_100791978 | Ga0070673_1007919782 | 183 |
| 403 | 3300005367 | Ga0070667_100828340 | Ga0070667_1008283401 | 183 |
| 404 | 3300005438 | Ga0070701_10013106 | Ga0070701_100131061 | 183 |
| 405 | 3300005438 | Ga0070701_10024328 | Ga0070701_100243284 | 183 |
| 406 | 3300005456 | Ga0070678_100669402 | Ga0070678_1006694021 | 183 |
| 407 | 3300005459 | Ga0068867_100157560 | Ga0068867_1001575603 | 183 |
| 408 | 3300005459 | Ga0068867_100200518 | Ga0068867_1002005182 | 183 |
| 409 | 3300005466 | Ga0070685_10176710 | Ga0070685_101767103 | 183 |
| 410 | 3300005468 | Ga0070707_100085947 | Ga0070707_1000859473 | 183 |
| 411 | 3300005536 | Ga0070697_100066533 | Ga0070697_1000665332 | 183 |
| 412 | 3300005543 | Ga0070672_100178755 | Ga0070672_1001787552 | 183 |
| 413 | 3300005544 | Ga0070686_100097347 | Ga0070686_1000973472 | 183 |
| 414 | 3300005545 | Ga0070695_100951287 | Ga0070695_1009512871 | 183 |
| 415 | 3300005547 | Ga0070693_100098482 | Ga0070693_1000984822 | 183 |
| 416 | 3300005616 | Ga0068852_100790209 | Ga0068852_1007902092 | 183 |
| 417 | 3300005617 | Ga0068859_100086895 | Ga0068859_1000868952 | 183 |
| 418 | 3300005719 | Ga0068861_100448513 | Ga0068861_1004485132 | 183 |
| 419 | 3300005840 | Ga0068870_10274290 | Ga0068870_102742901 | 183 |
| 420 | 3300005841 | Ga0068863_100204215 | Ga0068863_1002042152 | 183 |
| 421 | 3300005842 | Ga0068858_100000051 | Ga0068858_10000005129 | 183 |
| 422 | 3300005842 | Ga0068858_100108593 | Ga0068858_1001085933 | 183 |
| 423 | 3300005842 | Ga0068858_100147301 | Ga0068858_1001473012 | 183 |
| 424 | 3300005842 | Ga0068858_100620755 | Ga0068858_1006207552 | 183 |
| 425 | 3300005843 | Ga0068860_101317523 | Ga0068860_1013175231 | 183 |
| 426 | 3300005844 | Ga0068862_100122516 | Ga0068862_1001225162 | 183 |
| 427 | 3300006237 | Ga0097621_100102507 | Ga0097621_1001025073 | 183 |
| 428 | 3300006881 | Ga0068865_100038472 | Ga0068865_1000384724 | 183 |
| 429 | 3300006931 | Ga0097620_100086894 | Ga0097620_1000868942 | 183 |
| 430 | 3300009094 | Ga0111539_10065088 | Ga0111539_100650884 | 183 |
| 431 | 3300009098 | Ga0105245_10045151 | Ga0105245_100451513 | 183 |
| 432 | 3300009101 | Ga0105247_10000004 | Ga0105247_10000004121 | 183 |
| 433 | 3300009147 | Ga0114129_10021399 | Ga0114129_100213996 | 183 |
| 434 | 3300009148 | Ga0105243_10000446 | Ga0105243_100004463 | 183 |
| 435 | 3300009148 | Ga0105243_10549971 | Ga0105243_105499712 | 183 |
| 436 | 3300009174 | Ga0105241_10549829 | Ga0105241_105498292 | 183 |
| 437 | 3300009176 | Ga0105242_10001013 | Ga0105242_1000101313 | 183 |
| 438 | 3300009176 | Ga0105242_10023838 | Ga0105242_100238386 | 183 |
| 439 | 3300009176 | Ga0105242_10081745 | Ga0105242_100817452 | 183 |
| 440 | 3300009177 | Ga0105248_10814322 | Ga0105248_108143222 | 183 |
| 441 | 3300009177 | Ga0105248_11105142 | Ga0105248_111051422 | 183 |
| 442 | 3300010375 | Ga0105239_10298715 | Ga0105239_102987152 | 183 |
| 443 | 3300011119 | Ga0105246_10057378 | Ga0105246_100573783 | 183 |
| 444 | 3300013297 | Ga0157378_10000004 | Ga0157378_10000004103 | 183 |
| 445 | 3300013297 | Ga0157378_10015793 | Ga0157378_100157934 | 183 |
| 446 | 3300013297 | Ga0157378_10116895 | Ga0157378_101168952 | 183 |
| 447 | 3300013297 | Ga0157378_10214352 | Ga0157378_102143522 | 183 |
| 448 | 3300013297 | Ga0157378_10623294 | Ga0157378_106232941 | 183 |
| 449 | 3300013306 | Ga0163162_10207060 | Ga0163162_102070602 | 183 |
| 450 | 3300013308 | Ga0157375_10000479 | Ga0157375_1000047914 | 183 |
| 451 | 3300013308 | Ga0157375_10499273 | Ga0157375_104992732 | 183 |
| 452 | 3300014325 | Ga0163163_10638982 | Ga0163163_106389822 | 183 |
| 453 | 3300014325 | Ga0163163_10803800 | Ga0163163_108038001 | 183 |
| 454 | 3300014326 | Ga0157380_10041947 | Ga0157380_100419472 | 183 |
| 455 | 3300014745 | Ga0157377_10174066 | Ga0157377_101740661 | 183 |
| 456 | 3300017792 | Ga0163161_10410496 | Ga0163161_104104961 | 183 |
| 457 | 3300025223 | Ga0207672_1000002 | Ga0207672_10000025 | 183 |
| 458 | 3300025899 | Ga0207642_10070031 | Ga0207642_100700312 | 183 |
| 459 | 3300025900 | Ga0207710_10000002 | Ga0207710_10000002893 | 183 |
| 460 | 3300025903 | Ga0207680_10034812 | Ga0207680_100348122 | 183 |
| 461 | 3300025907 | Ga0207645_10340095 | Ga0207645_103400951 | 183 |
| 462 | 3300025908 | Ga0207643_10103372 | Ga0207643_101033721 | 183 |
| 463 | 3300025918 | Ga0207662_10016043 | Ga0207662_100160434 | 183 |
| 464 | 3300025918 | Ga0207662_10252639 | Ga0207662_102526392 | 183 |
| 465 | 3300025923 | Ga0207681_10553045 | Ga0207681_105530452 | 183 |
| 466 | 3300025927 | Ga0207687_10281420 | Ga0207687_102814202 | 183 |
| 467 | 3300025931 | Ga0207644_10000179 | Ga0207644_1000017932 | 183 |
| 468 | 3300025933 | Ga0207706_10491213 | Ga0207706_104912132 | 183 |
| 469 | 3300025934 | Ga0207686_10000127 | Ga0207686_1000012720 | 183 |
| 470 | 3300025934 | Ga0207686_10000965 | Ga0207686_1000096513 | 183 |
| 471 | 3300025934 | Ga0207686_10075763 | Ga0207686_100757632 | 183 |
| 472 | 3300025935 | Ga0207709_10003560 | Ga0207709_100035609 | 183 |
| 473 | 3300025938 | Ga0207704_10160850 | Ga0207704_101608502 | 183 |
| 474 | 3300025940 | Ga0207691_10000845 | Ga0207691_1000084516 | 183 |
| 475 | 3300025941 | Ga0207711_10524895 | Ga0207711_105248952 | 183 |
| 476 | 3300025941 | Ga0207711_10586191 | Ga0207711_105861912 | 183 |
| 477 | 3300025942 | Ga0207689_10001578 | Ga0207689_100015787 | 183 |
| 478 | 3300025960 | Ga0207651_10083005 | Ga0207651_100830053 | 183 |
| 479 | 3300025986 | Ga0207658_10801764 | Ga0207658_108017641 | 183 |
| 480 | 3300026023 | Ga0207677_10384693 | Ga0207677_103846931 | 183 |
| 481 | 3300026035 | Ga0207703_10000114 | Ga0207703_1000011443 | 183 |
| 482 | 3300026035 | Ga0207703_10529451 | Ga0207703_105294512 | 183 |
| 483 | 3300026035 | Ga0207703_11451440 | Ga0207703_114514401 | 183 |
| 484 | 3300026075 | Ga0207708_10068329 | Ga0207708_100683293 | 183 |
| 485 | 3300026088 | Ga0207641_11055260 | Ga0207641_110552601 | 183 |
| 486 | 3300026089 | Ga0207648_10166571 | Ga0207648_101665712 | 183 |
| 487 | 3300026095 | Ga0207676_10179495 | Ga0207676_101794953 | 183 |
| 488 | 3300026118 | Ga0207675_100005128 | Ga0207675_1000051287 | 183 |
| 489 | 3300026121 | Ga0207683_10436456 | Ga0207683_104364562 | 183 |
| 490 | 3300027907 | Ga0207428_10038699 | Ga0207428_100386992 | 183 |
| 491 | 3300028380 | Ga0268265_10377246 | Ga0268265_103772462 | 183 |
| 492 | 3300038996 | Ga0242420_000770 | Ga0242420_000770_283_834 | 183 |
| 493 | 3300045051 | Ga0451576_0264042 | Ga0451576_0264042_106_705 | 183 |
| 494 | 3300047318 | Ga0495636_0014016 | Ga0495636_0014016_1725_2336 | 183 |
| 495 | 3300047471 | Ga0495684_0094079 | Ga0495684_0094079_588_1193 | 183 |
| 496 | 3300048909 | Ga0496106_0001061 | Ga0496106_0001061_13708_14319 | 183 |
| 497 | 3300050507 | nmdc:mga05p37_1251401_c1 | nmdc:mga05p37_1251401_c1_42_593 | 183 |
| 498 | 3300050507 | nmdc:mga05p37_131870_c1 | nmdc:mga05p37_131870_c1_2376_3014 | 183 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2ywr-assembly1.cif.gz_A | crystal structure of gar transformylase from aquifex aeolicus | 0.9599 | 2 | 168 |
| 1c2t-assembly1.cif.gz_A | new insights into inhibitor design from the crystal structure and nmr studies of e. coli gar transformylase in complex with beta-gar and 10-formyl-5,8,10-trideazafolic acid. | 0.9559 | 2 | 174 |
| 3auf-assembly1.cif.gz_A-2 | crystal structure of glycinamide ribonucleotide transformylase 1 from symbiobacterium toebii | 0.9532 | 3 | 174 |
| 3av3-assembly1.cif.gz_A | crystal structure of glycinamide ribonucleotide transformylase 1 from geobacillus kaustophilus | 0.9483 | 2 | 172 |
| 3kcq-assembly2.cif.gz_B | crystal structure of phosphoribosylglycinamide formyltransferase from anaplasma phagocytophilum | 0.9432 | 3 | 168 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FZI7_1_188_3.40.50.170 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain | 0.9619 | 3 | 172 | 3.40.50.170 |
| 2ywrA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain | 0.9585 | 2 | 168 | 3.40.50.170 |
| 3aufA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain | 0.9532 | 3 | 174 | 3.40.50.170 |
| 3av3A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain | 0.9528 | 2 | 169 | 3.40.50.170 |
| 3kcqB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain | 0.9432 | 3 | 168 | 3.40.50.170 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3C0KBB1-F1-model_v4 | phosphoribosylglycinamide formyltransferase 1 (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) | 0.9798 | 87 | 175 |
GO:0004644
GO:0005829 GO:0006189 |
| AF-Q1IM87-F1-model_v4 | Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) (GART) | 0.976 | 2 | 173 |
GO:0004644
GO:0005737 GO:0006189 |
| AF-A0A2V8G8Z8-F1-model_v4 | Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) (GART) | 0.9733 | 15 | 173 |
GO:0004644
GO:0005829 GO:0006189 |
| AF-A0A2M8F696-F1-model_v4 | Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) (GART) | 0.9698 | 2 | 173 |
GO:0004644
GO:0005829 GO:0006189 |
| AF-E6W594-F1-model_v4 | Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) (GART) | 0.9691 | 2 | 173 |
GO:0004644
GO:0005737 GO:0006189 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar