F455218

General Info

Members Datasets Scaffolds Average Seq Length
498 244 498 197

Family's Representative Sequence

Representative Sequence 3300035410|Ga0373924_0143950|Ga0373924_0143950_30_725
Length 231
Sequence MKKRVAILISGRGSNMTALIEAAKAKDYPAEIALVVSNRPDAAGLDRARSCGIPTAVIDHTTFGGDRETFEQALDRQLREQRIDLVCLAGFMRLLTPWFVNRWSGRMLNIHPSLLPSYPGLDTHARALADGVRVHGCTVHFVTADVDHGPIVMQGAVAVHDADDEQSLAARVLAIEHRLLPAAVRAFCERRLVIAGRRVRVKDEVAPAAAFVVPSPVAPADARGDDSSHSA

Samples

Sample ID Description Type Environment
1 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
111 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
167 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
168 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
169 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
170 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
171 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
172 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
173 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
174 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
175 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
176 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
177 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
178 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
179 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
180 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
181 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
183 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
184 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
185 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
186 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
187 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
188 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
189 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
190 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
191 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
192 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
193 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
194 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
195 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
196 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
197 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
198 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
199 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
200 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
201 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
202 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
203 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
204 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
205 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
206 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
207 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
208 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
209 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
210 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
211 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
212 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
213 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
214 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
215 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
216 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
217 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
218 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
219 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
220 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
221 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
222 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
223 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
224 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
225 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
226 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
227 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
228 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
229 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
230 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
231 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
232 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
233 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
234 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
235 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
236 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
237 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
238 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
239 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
240 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
241 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
242 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
243 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
244 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.21
Rhizosphere 95.98
Stem 0
Stem Tuber 0
Unclassified 0.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24748J21848_1000001 3300002074 Bacteria 444271
2 JGI24034J26672_10000001 3300002239 Bacteria 1118280
3 JGI25406J46586_10004972 3300003203 Bacteria 6176
4 rootL2_10270263 3300003322 Bacteria 1575
5 Ga0065704_10226521 3300005289 Bacteria 1057
6 Ga0065712_10007428 3300005290 Bacteria 2776
7 Ga0065712_10097629 3300005290 Bacteria 2145
8 Ga0065712_10230829 3300005290 Unclassified 990
9 Ga0065712_10261260 3300005290 Unclassified 936
10 Ga0065715_10006849 3300005293 Bacteria 3230
11 Ga0065715_10089819 3300005293 Bacteria 8424
12 Ga0065715_10096528 3300005293 Unclassified 3863
13 Ga0065715_10234882 3300005293 Bacteria 1220
14 Ga0065715_10288674 3300005293 Bacteria 1068
15 Ga0065715_10452523 3300005293 Unclassified 824
16 Ga0065707_10092664 3300005295 Bacteria 3706
17 Ga0070676_10117649 3300005328 Bacteria 1664
18 Ga0070676_10189056 3300005328 Bacteria 1343
19 Ga0070683_100129090 3300005329 Bacteria 2391
20 Ga0070690_100071973 3300005330 Bacteria 2247
21 Ga0070690_100110116 3300005330 Bacteria 1836
22 Ga0070690_100181611 3300005330 Bacteria 1454
23 Ga0070690_100550259 3300005330 Bacteria 870
24 Ga0070670_100001205 3300005331 Bacteria 20532
25 Ga0070670_100098707 3300005331 Unclassified 2513
26 Ga0068869_100063965 3300005334 Bacteria 2705
27 Ga0068869_100152273 3300005334 Bacteria 1794
28 Ga0070666_10210886 3300005335 Bacteria 1368
29 Ga0070680_100025267 3300005336 Bacteria 4746
30 Ga0070682_100117422 3300005337 Unclassified 1781
31 Ga0068868_100086036 3300005338 Unclassified 2527
32 Ga0068868_100486995 3300005338 Bacteria 1078
33 Ga0070660_100015860 3300005339 Bacteria 5454
34 Ga0070660_100111992 3300005339 Bacteria 2172
35 Ga0070660_100378574 3300005339 Bacteria 1168
36 Ga0070689_100073043 3300005340 Bacteria 2682
37 Ga0070689_100125021 3300005340 Bacteria 2057
38 Ga0070689_100367016 3300005340 Unclassified 1211
39 Ga0070687_100032970 3300005343 Bacteria 2552
40 Ga0070687_100136644 3300005343 Unclassified 1422
41 Ga0070661_100024590 3300005344 Bacteria 4321
42 Ga0070661_100046710 3300005344 Bacteria 3168
43 Ga0070661_100171093 3300005344 Bacteria 1650
44 Ga0070661_100435726 3300005344 Bacteria 1041
45 Ga0070692_10212327 3300005345 Unclassified 1139
46 Ga0070669_100072967 3300005353 Bacteria 2542
47 Ga0070669_100100644 3300005353 Bacteria 2179
48 Ga0070669_100316382 3300005353 Bacteria 1259
49 Ga0070669_100473890 3300005353 Bacteria 1035
50 Ga0070675_100170986 3300005354 Unclassified 1874
51 Ga0070675_100264740 3300005354 Bacteria 1507
52 Ga0070671_100008298 3300005355 Bacteria 8312
53 Ga0070671_100035876 3300005355 Bacteria 4110
54 Ga0070671_100041069 3300005355 Bacteria 3843
55 Ga0070671_100311708 3300005355 Unclassified 1340
56 Ga0070671_100409967 3300005355 Bacteria 1160
57 Ga0070673_100000212 3300005364 Bacteria 28926
58 Ga0070673_100791978 3300005364 Unclassified 875
59 Ga0070688_100158442 3300005365 Bacteria 1554
60 Ga0070659_100000997 3300005366 Bacteria 20800
61 Ga0070659_100001017 3300005366 Bacteria 20562
62 Ga0070659_100173016 3300005366 Bacteria 1770
63 Ga0070667_100159222 3300005367 Unclassified 1987
64 Ga0070667_100828340 3300005367 Unclassified 860
65 Ga0070703_10000049 3300005406 Bacteria 58073
66 Ga0070710_10185525 3300005437 Bacteria 1305
67 Ga0070701_10013106 3300005438 Bacteria 3761
68 Ga0070701_10024328 3300005438 Bacteria 2929
69 Ga0070701_10031103 3300005438 Bacteria 2647
70 Ga0070700_100001704 3300005441 Bacteria 11035
71 Ga0070694_100220977 3300005444 Bacteria 1421
72 Ga0070708_100000191 3300005445 Bacteria 44404
73 Ga0070708_100000712 3300005445 Bacteria 25260
74 Ga0070708_100115867 3300005445 Bacteria 2467
75 Ga0070708_100401702 3300005445 Archaea 1292
76 Ga0070663_100021070 3300005455 Bacteria 4328
77 Ga0070663_100142005 3300005455 Bacteria 1834
78 Ga0070678_100669402 3300005456 Unclassified 932
79 Ga0070662_100004111 3300005457 Bacteria 9145
80 Ga0070662_100096935 3300005457 Bacteria 2225
81 Ga0070681_10002824 3300005458 Bacteria 16037
82 Ga0070681_10090269 3300005458 Bacteria 3014
83 Ga0070681_10279524 3300005458 Bacteria 1580
84 Ga0068867_100157560 3300005459 Bacteria 1788
85 Ga0068867_100200518 3300005459 Bacteria 1597
86 Ga0070685_10176710 3300005466 Bacteria 1371
87 Ga0070706_100014813 3300005467 Bacteria 7207
88 Ga0070706_100015375 3300005467 Bacteria 7068
89 Ga0070706_100130596 3300005467 Unclassified 2344
90 Ga0070706_100178958 3300005467 Bacteria 1980
91 Ga0070707_100073837 3300005468 Bacteria 3289
92 Ga0070707_100085947 3300005468 Bacteria 3041
93 Ga0070707_100120193 3300005468 Bacteria 2550
94 Ga0070707_100157293 3300005468 Archaea 2214
95 Ga0070698_100015126 3300005471 Bacteria 8159
96 Ga0070698_100588645 3300005471 Archaea 1053
97 Ga0070698_100751163 3300005471 Bacteria 918
98 Ga0070699_100032163 3300005518 Bacteria 4530
99 Ga0070699_100154971 3300005518 Bacteria 2027
100 Ga0070679_100002739 3300005530 Bacteria 16044
101 Ga0070679_100020243 3300005530 Bacteria 6484
102 Ga0070697_100047176 3300005536 Bacteria 3494
103 Ga0070697_100066533 3300005536 Bacteria 2946
104 Ga0070697_100177249 3300005536 Bacteria 1806
105 Ga0070697_100254496 3300005536 Bacteria 1502
106 Ga0070697_100255843 3300005536 Bacteria 1498
107 Ga0068853_100005087 3300005539 Bacteria 10262
108 Ga0068853_100010682 3300005539 Bacteria 7433
109 Ga0068853_100101570 3300005539 Bacteria 2543
110 Ga0070672_100175728 3300005543 Bacteria 1783
111 Ga0070672_100178755 3300005543 Bacteria 1767
112 Ga0070686_100097347 3300005544 Bacteria 1980
113 Ga0070695_100291205 3300005545 Bacteria 1203
114 Ga0070695_100476441 3300005545 Bacteria 961
115 Ga0070695_100951287 3300005545 Unclassified 696
116 Ga0070696_100046765 3300005546 Unclassified 3002
117 Ga0070696_100072022 3300005546 Bacteria 2433
118 Ga0070696_100092786 3300005546 Bacteria 2152
119 Ga0070693_100098482 3300005547 Bacteria 1777
120 Ga0070693_100435347 3300005547 Bacteria 917
121 Ga0070665_100237784 3300005548 Bacteria 1822
122 Ga0070704_100077876 3300005549 Bacteria 2430
123 Ga0070704_100391633 3300005549 Bacteria 1183
124 Ga0068855_100457794 3300005563 Bacteria 1391
125 Ga0068855_100459814 3300005563 Bacteria 1388
126 Ga0070664_100002145 3300005564 Bacteria 15812
127 Ga0070664_100021164 3300005564 Bacteria 5357
128 Ga0068857_100241658 3300005577 Bacteria 1653
129 Ga0068854_100065028 3300005578 Bacteria 2651
130 Ga0068856_100005065 3300005614 Bacteria 13041
131 Ga0068856_100995567 3300005614 Bacteria 857
132 Ga0070702_100250650 3300005615 Bacteria 1200
133 Ga0070702_100273481 3300005615 Bacteria 1156
134 Ga0068852_100025692 3300005616 Bacteria 4776
135 Ga0068852_100312414 3300005616 Bacteria 1524
136 Ga0068852_100790209 3300005616 Unclassified 963
137 Ga0068859_100008267 3300005617 Bacteria 10551
138 Ga0068859_100028738 3300005617 Bacteria 5574
139 Ga0068859_100086895 3300005617 Bacteria 3174
140 Ga0068859_100131903 3300005617 Bacteria 2570
141 Ga0068859_100164248 3300005617 Unclassified 2299
142 Ga0068864_100050313 3300005618 Bacteria 3586
143 Ga0068864_100135768 3300005618 Bacteria 2215
144 Ga0068864_100233899 3300005618 Bacteria 1700
145 Ga0068864_100345073 3300005618 Bacteria 1404
146 Ga0068864_100494665 3300005618 Bacteria 1176
147 Ga0068861_100006204 3300005719 Bacteria 8134
148 Ga0068861_100448513 3300005719 Unclassified 1155
149 Ga0068870_10089753 3300005840 Unclassified 1716
150 Ga0068870_10208448 3300005840 Bacteria 1189
151 Ga0068870_10274290 3300005840 Unclassified 1055
152 Ga0068863_100204215 3300005841 Bacteria 1901
153 Ga0068863_100270716 3300005841 Bacteria 1644
154 Ga0068863_100473260 3300005841 Bacteria 1231
155 Ga0068858_100000051 3300005842 Bacteria 120692
156 Ga0068858_100108593 3300005842 Bacteria 2590
157 Ga0068858_100147301 3300005842 Bacteria 2212
158 Ga0068858_100620755 3300005842 Bacteria 1049
159 Ga0068858_100813773 3300005842 Bacteria 912
160 Ga0068860_100061286 3300005843 Unclassified 3574
161 Ga0068860_100423456 3300005843 Bacteria 1320
162 Ga0068860_101317523 3300005843 Unclassified 743
163 Ga0068862_100008314 3300005844 Bacteria 8587
164 Ga0068862_100053059 3300005844 Bacteria 3470
165 Ga0068862_100088469 3300005844 Bacteria 2695
166 Ga0068862_100122516 3300005844 Bacteria 2293
167 Ga0068862_100416813 3300005844 Bacteria 1259
168 Ga0081455_10414226 3300005937 Bacteria 931
169 Ga0081539_10001244 3300005985 Bacteria 45293
170 Ga0070716_100000003 3300006173 Bacteria 312721
171 Ga0070716_100295903 3300006173 Bacteria 1124
172 Ga0097621_100081546 3300006237 Unclassified 2692
173 Ga0097621_100102507 3300006237 Bacteria 2409
174 Ga0097621_100134105 3300006237 Bacteria 2110
175 Ga0068871_100477828 3300006358 Bacteria 1120
176 Ga0075428_100143367 3300006844 Bacteria 2597
177 Ga0075428_100308704 3300006844 Bacteria 1700
178 Ga0075433_10027319 3300006852 Bacteria 4838
179 Ga0075434_100418798 3300006871 Bacteria 1360
180 Ga0075434_100424810 3300006871 Bacteria 1350
181 Ga0075429_100008602 3300006880 Bacteria 8878
182 Ga0075429_100046987 3300006880 Bacteria 3756
183 Ga0068865_100038472 3300006881 Bacteria 3238
184 Ga0068865_100107062 3300006881 Unclassified 2056
185 Ga0068865_100861070 3300006881 Bacteria 786
186 Ga0068865_101024061 3300006881 Unclassified 724
187 Ga0097620_100008267 3300006931 Bacteria 10551
188 Ga0097620_100028740 3300006931 Bacteria 5574
189 Ga0097620_100086894 3300006931 Bacteria 3174
190 Ga0097620_100131901 3300006931 Bacteria 2570
191 Ga0097620_100164243 3300006931 Unclassified 2299
192 Ga0075435_100624793 3300007076 Bacteria 934
193 Ga0105251_10238313 3300009011 Unclassified 819
194 Ga0111539_10065088 3300009094 Bacteria 4310
195 Ga0111539_10144414 3300009094 Bacteria 2786
196 Ga0111539_10384707 3300009094 Bacteria 1634
197 Ga0105245_10045151 3300009098 Bacteria 3934
198 Ga0105247_10000004 3300009101 Bacteria 455497
199 Ga0114129_10021399 3300009147 Bacteria 9181
200 Ga0114129_10035058 3300009147 Bacteria 7089
201 Ga0114129_10300936 3300009147 Bacteria 2138
202 Ga0114129_10514373 3300009147 Bacteria 1562
203 Ga0114129_11446692 3300009147 Unclassified 846
204 Ga0105243_10000446 3300009148 Bacteria 43049
205 Ga0105243_10470793 3300009148 Bacteria 1183
206 Ga0105243_10549971 3300009148 Bacteria 1103
207 Ga0105241_10549829 3300009174 Bacteria 1036
208 Ga0105241_10590782 3300009174 Bacteria 1002
209 Ga0105241_10612916 3300009174 Bacteria 984
210 Ga0105241_11041697 3300009174 Bacteria 767
211 Ga0105242_10001013 3300009176 Bacteria 22070
212 Ga0105242_10003928 3300009176 Bacteria 11551
213 Ga0105242_10023838 3300009176 Bacteria 4827
214 Ga0105242_10081745 3300009176 Bacteria 2702
215 Ga0105242_10918653 3300009176 Unclassified 877
216 Ga0105248_10013612 3300009177 Bacteria 8955
217 Ga0105248_10421429 3300009177 Bacteria 1503
218 Ga0105248_10695275 3300009177 Bacteria 1147
219 Ga0105248_10814322 3300009177 Bacteria 1054
220 Ga0105248_10854147 3300009177 Bacteria 1027
221 Ga0105248_11105142 3300009177 Unclassified 896
222 Ga0105237_10050235 3300009545 Bacteria 4190
223 Ga0105249_10017805 3300009553 Bacteria 6313
224 Ga0105249_10106766 3300009553 Bacteria 2642
225 Ga0105249_10799596 3300009553 Bacteria 1007
226 Ga0105249_11169482 3300009553 Unclassified 840
227 Ga0099796_10246599 3300010159 Bacteria 740
228 Ga0105239_10298715 3300010375 Unclassified 1813
229 Ga0105239_10426036 3300010375 Bacteria 1504
230 Ga0105246_10057378 3300011119 Bacteria 2694
231 Ga0105246_10187732 3300011119 Unclassified 1597
232 Ga0157373_10009902 3300013100 Bacteria 7026
233 Ga0157373_10025815 3300013100 Unclassified 4247
234 Ga0157371_10002099 3300013102 Bacteria 19457
235 Ga0157370_10304894 3300013104 Bacteria 1470
236 Ga0157369_10346478 3300013105 Bacteria 1543
237 Ga0157369_10357543 3300013105 Bacteria 1516
238 Ga0157374_10096903 3300013296 Bacteria 2821
239 Ga0157378_10000004 3300013297 Bacteria 201051
240 Ga0157378_10008455 3300013297 Bacteria 8965
241 Ga0157378_10015793 3300013297 Bacteria 6612
242 Ga0157378_10019632 3300013297 Bacteria 5941
243 Ga0157378_10116895 3300013297 Bacteria 2453
244 Ga0157378_10214352 3300013297 Unclassified 1827
245 Ga0157378_10546937 3300013297 Bacteria 1163
246 Ga0157378_10623294 3300013297 Bacteria 1092
247 Ga0157378_11265022 3300013297 Unclassified 778
248 Ga0163162_10026360 3300013306 Bacteria 5744
249 Ga0163162_10047575 3300013306 Bacteria 4299
250 Ga0163162_10118009 3300013306 Bacteria 2755
251 Ga0163162_10207060 3300013306 Bacteria 2091
252 Ga0163162_10985617 3300013306 Unclassified 952
253 Ga0157372_10002796 3300013307 Bacteria 18867
254 Ga0157372_10010938 3300013307 Bacteria 9657
255 Ga0157372_10070958 3300013307 Bacteria 3921
256 Ga0157375_10000479 3300013308 Bacteria 36426
257 Ga0157375_10054284 3300013308 Bacteria 3946
258 Ga0157375_10066315 3300013308 Unclassified 3603
259 Ga0157375_10145214 3300013308 Bacteria 2503
260 Ga0157375_10236150 3300013308 Unclassified 1987
261 Ga0157375_10499273 3300013308 Bacteria 1381
262 Ga0157375_10759080 3300013308 Bacteria 1121
263 Ga0157375_10843862 3300013308 Bacteria 1063
264 Ga0163163_10003828 3300014325 Bacteria 12813
265 Ga0163163_10063185 3300014325 Unclassified 3670
266 Ga0163163_10229485 3300014325 Bacteria 1905
267 Ga0163163_10638982 3300014325 Unclassified 1128
268 Ga0163163_10693279 3300014325 Unclassified 1082
269 Ga0163163_10720689 3300014325 Unclassified 1061
270 Ga0163163_10803800 3300014325 Bacteria 1004
271 Ga0157380_10001887 3300014326 Bacteria 13902
272 Ga0157380_10002797 3300014326 Bacteria 11862
273 Ga0157380_10041947 3300014326 Bacteria 3574
274 Ga0157377_10174066 3300014745 Unclassified 1348
275 Ga0157377_10738961 3300014745 Bacteria 719
276 Ga0163161_10410496 3300017792 Unclassified 1087
277 Ga0163161_10599949 3300017792 Bacteria 908
278 Ga0213876_10000112 3300021384 Bacteria 89665
279 Ga0207672_1000002 3300025223 Bacteria 31879
280 Ga0207653_10000163 3300025885 Bacteria 47337
281 Ga0207692_10315608 3300025898 Bacteria 955
282 Ga0207642_10070031 3300025899 Bacteria 1665
283 Ga0207642_10131299 3300025899 Bacteria 1308
284 Ga0207710_10000002 3300025900 Bacteria 1251998
285 Ga0207680_10034812 3300025903 Bacteria 2884
286 Ga0207645_10014191 3300025907 Bacteria 5336
287 Ga0207645_10340095 3300025907 Bacteria 1003
288 Ga0207643_10103372 3300025908 Bacteria 1672
289 Ga0207684_10001129 3300025910 Bacteria 29818
290 Ga0207684_10067409 3300025910 Bacteria 3042
291 Ga0207684_10119015 3300025910 Bacteria 2264
292 Ga0207684_10470421 3300025910 Archaea 1079
293 Ga0207684_10520722 3300025910 Unclassified 1019
294 Ga0207654_10505856 3300025911 Bacteria 853
295 Ga0207707_10000008 3300025912 Bacteria 330313
296 Ga0207707_10026167 3300025912 Bacteria 5101
297 Ga0207707_10512896 3300025912 Bacteria 1022
298 Ga0207660_10019420 3300025917 Bacteria 4544
299 Ga0207662_10016043 3300025918 Unclassified 4222
300 Ga0207662_10064160 3300025918 Bacteria 2209
301 Ga0207662_10252639 3300025918 Unclassified 1158
302 Ga0207657_10001461 3300025919 Bacteria 25304
303 Ga0207657_10056266 3300025919 Bacteria 3394
304 Ga0207657_10120581 3300025919 Bacteria 2158
305 Ga0207657_10335503 3300025919 Bacteria 1194
306 Ga0207649_10186955 3300025920 Bacteria 1454
307 Ga0207649_10490050 3300025920 Bacteria 933
308 Ga0207652_10000085 3300025921 Bacteria 101176
309 Ga0207652_10155141 3300025921 Bacteria 2051
310 Ga0207652_10193390 3300025921 Bacteria 1830
311 Ga0207646_10042513 3300025922 Unclassified 4082
312 Ga0207646_10250256 3300025922 Archaea 1601
313 Ga0207646_10274039 3300025922 Unclassified 1525
314 Ga0207646_10524731 3300025922 Unclassified 1066
315 Ga0207681_10115201 3300025923 Bacteria 1962
316 Ga0207681_10170327 3300025923 Bacteria 1650
317 Ga0207681_10553045 3300025923 Bacteria 947
318 Ga0207650_10000675 3300025925 Bacteria 26793
319 Ga0207659_10142165 3300025926 Bacteria 1864
320 Ga0207659_10387846 3300025926 Bacteria 1166
321 Ga0207687_10281420 3300025927 Bacteria 1333
322 Ga0207644_10000179 3300025931 Bacteria 45397
323 Ga0207644_10003580 3300025931 Bacteria 10053
324 Ga0207644_10043980 3300025931 Bacteria 3171
325 Ga0207690_10002569 3300025932 Bacteria 10965
326 Ga0207690_10045877 3300025932 Bacteria 2890
327 Ga0207706_10000040 3300025933 Bacteria 132285
328 Ga0207706_10047991 3300025933 Bacteria 3776
329 Ga0207706_10088891 3300025933 Bacteria 2716
330 Ga0207706_10491213 3300025933 Unclassified 1060
331 Ga0207686_10000003 3300025934 Bacteria 376934
332 Ga0207686_10000127 3300025934 Bacteria 61880
333 Ga0207686_10000965 3300025934 Bacteria 17144
334 Ga0207686_10075763 3300025934 Bacteria 2179
335 Ga0207709_10000017 3300025935 Bacteria 470753
336 Ga0207709_10003560 3300025935 Bacteria 9208
337 Ga0207709_10259618 3300025935 Bacteria 1273
338 Ga0207670_10059209 3300025936 Bacteria 2605
339 Ga0207670_10497503 3300025936 Unclassified 989
340 Ga0207704_10072800 3300025938 Unclassified 2186
341 Ga0207704_10160850 3300025938 Bacteria 1597
342 Ga0207665_10000003 3300025939 Bacteria 220666
343 Ga0207691_10000845 3300025940 Bacteria 30493
344 Ga0207691_10071431 3300025940 Bacteria 3132
345 Ga0207691_10200522 3300025940 Bacteria 1737
346 Ga0207711_10524895 3300025941 Bacteria 1104
347 Ga0207711_10586191 3300025941 Bacteria 1040
348 Ga0207689_10001578 3300025942 Bacteria 21602
349 Ga0207689_10013933 3300025942 Bacteria 6848
350 Ga0207689_10075365 3300025942 Bacteria 2773
351 Ga0207689_10477356 3300025942 Unclassified 1044
352 Ga0207661_10206394 3300025944 Bacteria 1730
353 Ga0207679_10014249 3300025945 Bacteria 5223
354 Ga0207679_10085908 3300025945 Bacteria 2418
355 Ga0207679_10122103 3300025945 Bacteria 2076
356 Ga0207667_10016457 3300025949 Bacteria 8356
357 Ga0207667_10370712 3300025949 Bacteria 1459
358 Ga0207667_11093036 3300025949 Unclassified 781
359 Ga0207651_10000458 3300025960 Bacteria 17210
360 Ga0207651_10083005 3300025960 Bacteria 2316
361 Ga0207651_10217531 3300025960 Bacteria 1542
362 Ga0207651_10842905 3300025960 Unclassified 814
363 Ga0207712_10407046 3300025961 Bacteria 1145
364 Ga0207640_10038600 3300025981 Bacteria 3015
365 Ga0207640_10095816 3300025981 Bacteria 2067
366 Ga0207658_10801764 3300025986 Bacteria 855
367 Ga0207677_10196867 3300026023 Bacteria 1598
368 Ga0207677_10384693 3300026023 Unclassified 1185
369 Ga0207703_10000114 3300026035 Bacteria 96051
370 Ga0207703_10529451 3300026035 Unclassified 1109
371 Ga0207703_11451440 3300026035 Unclassified 660
372 Ga0207639_10022909 3300026041 Bacteria 4504
373 Ga0207639_10024805 3300026041 Bacteria 4345
374 Ga0207639_10126280 3300026041 Bacteria 2110
375 Ga0207678_10193285 3300026067 Bacteria 1740
376 Ga0207708_10003764 3300026075 Bacteria 11175
377 Ga0207708_10068329 3300026075 Bacteria 2720
378 Ga0207702_10143299 3300026078 Bacteria 2165
379 Ga0207641_10049788 3300026088 Bacteria 3542
380 Ga0207641_10284056 3300026088 Bacteria 1558
381 Ga0207641_11055260 3300026088 Unclassified 810
382 Ga0207648_10166571 3300026089 Unclassified 1947
383 Ga0207648_10222715 3300026089 Bacteria 1677
384 Ga0207648_10421987 3300026089 Bacteria 1211
385 Ga0207676_10011521 3300026095 Bacteria 6324
386 Ga0207676_10045523 3300026095 Bacteria 3391
387 Ga0207676_10179495 3300026095 Bacteria 1853
388 Ga0207676_10269075 3300026095 Unclassified 1542
389 Ga0207676_10379037 3300026095 Unclassified 1316
390 Ga0207674_10002177 3300026116 Bacteria 24786
391 Ga0207674_10203461 3300026116 Bacteria 1929
392 Ga0207675_100005128 3300026118 Bacteria 12611
393 Ga0207675_100580907 3300026118 Bacteria 1122
394 Ga0207683_10436456 3300026121 Bacteria 1207
395 Ga0209983_1044634 3300027665 Bacteria 963
396 Ga0207428_10001780 3300027907 Bacteria 22062
397 Ga0207428_10038699 3300027907 Bacteria 3875
398 Ga0268265_10025222 3300028380 Bacteria 4217
399 Ga0268265_10325009 3300028380 Bacteria 1395
400 Ga0268265_10377246 3300028380 Bacteria 1303
401 Ga0268265_10382835 3300028380 Unclassified 1295
402 Ga0268264_10664672 3300028381 Bacteria 1032
403 Ga0307405_10011070 3300031731 Bacteria 4709
404 Ga0307413_10114587 3300031824 Bacteria 1812
405 Ga0307407_10069112 3300031903 Bacteria 2095
406 Ga0307412_10111368 3300031911 Bacteria 1955
407 Ga0307414_10038324 3300032004 Bacteria 3218
408 Ga0307414_10194859 3300032004 Bacteria 1643
409 Ga0307415_100242011 3300032126 Bacteria 1460
410 Ga0373952_0025361 3300035092 Bacteria 1280
411 Ga0373923_0027593 3300035111 Bacteria 2266
412 Ga0373936_0143241 3300035113 Bacteria 1033
413 Ga0373954_0008910 3300035118 Bacteria 4415
414 Ga0373955_0001640 3300035172 Bacteria 9578
415 Ga0373924_0143950 3300035410 Bacteria 1041
416 Ga0373927_0041502 3300035695 Bacteria 2984
417 Ga0373933_0002364 3300035724 Bacteria 10666
418 Ga0373947_0570968 3300035725 Bacteria 770
419 Ga0373937_0002367 3300036401 Bacteria 15699
420 Ga0373925_0436168 3300037068 Bacteria 1071
421 Ga0395898_0161219 3300037466 Bacteria 2145
422 Ga0395905_0004964 3300037471 Bacteria 13707
423 Ga0242420_000770 3300038996 Bacteria 3882
424 Ga0436365_1425589 3300039437 Bacteria 204653
425 Ga0436363_0593977 3300039450 Unclassified 1238
426 Ga0453683_0279070 3300044673 Bacteria 1067
427 Ga0466957_0091648 3300044842 Bacteria 1905
428 Ga0451576_0026804 3300045051 Bacteria 6194
429 Ga0451576_0264042 3300045051 Bacteria 1800
430 Ga0495592_0134551 3300046454 Bacteria 1725
431 Ga0495629_0006722 3300046459 Bacteria 8503
432 Ga0495651_0000265 3300046462 Bacteria 40572
433 Ga0495653_0000794 3300046463 Bacteria 24254
434 Ga0495664_0030987 3300046477 Bacteria 3134
435 Ga0495594_0371333 3300046499 Bacteria 814
436 Ga0495618_0001577 3300046514 Bacteria 15250
437 Ga0495628_0024335 3300046516 Bacteria 4957
438 Ga0495630_0261906 3300046517 Bacteria 1321
439 Ga0495652_0010236 3300046529 Bacteria 8503
440 Ga0495587_0003591 3300046536 Bacteria 10327
441 Ga0495598_0014643 3300046537 Bacteria 1965
442 Ga0495621_0085482 3300046539 Bacteria 1182
443 Ga0495667_0002082 3300046559 Bacteria 13299
444 Ga0495634_0019596 3300046642 Bacteria 4805
445 Ga0495635_0075401 3300046663 Bacteria 2310
446 Ga0495659_0191392 3300046664 Unclassified 836
447 Ga0495657_0082049 3300046675 Bacteria 2084
448 Ga0495599_0157125 3300046678 Bacteria 1406
449 Ga0495623_0150082 3300046679 Bacteria 1378
450 Ga0495646_0005043 3300046680 Bacteria 8328
451 Ga0495613_0400363 3300046689 Bacteria 936
452 Ga0495624_0028165 3300046690 Bacteria 3673
453 Ga0495600_0015406 3300046809 Bacteria 4833
454 Ga0495581_0055077 3300047315 Bacteria 2296
455 Ga0495604_0000118 3300047317 Bacteria 66698
456 Ga0495636_0014016 3300047318 Bacteria 3186
457 Ga0495674_0035843 3300047319 Bacteria 4472
458 Ga0495676_0024770 3300047321 Bacteria 5187
459 Ga0495680_0001567 3300047322 Bacteria 24484
460 Ga0495675_0017097 3300047444 Bacteria 4592
461 Ga0495684_0094079 3300047471 Bacteria 2270
462 Ga0495593_0042124 3300047673 Bacteria 2452
463 Ga0495602_0171041 3300048088 Bacteria 1686
464 Ga0496101_0783079 3300048904 Bacteria 752
465 Ga0496102_0417597 3300048905 Bacteria 1260
466 Ga0496102_0494783 3300048905 Bacteria 1144
467 Ga0496103_0385706 3300048906 Bacteria 900
468 Ga0496104_0126305 3300048907 Bacteria 2456
469 Ga0496104_0154561 3300048907 Bacteria 2202
470 Ga0496106_0001061 3300048909 Bacteria 20265
471 Ga0496106_0013867 3300048909 Bacteria 5955
472 Ga0496106_0114781 3300048909 Bacteria 2100
473 Ga0496107_0521092 3300048910 Bacteria 881
474 Ga0496109_0387194 3300048912 Bacteria 1321
475 Ga0496109_0471231 3300048912 Unclassified 1186
476 Ga0496109_0689132 3300048912 Bacteria 959
477 Ga0496111_0783394 3300048914 Bacteria 691
478 Ga0496114_0015654 3300048917 Bacteria 6102
479 Ga0496115_0244161 3300048918 Bacteria 1480
480 Ga0501048_0949693 3300049582 Bacteria 618
481 nmdc:mga05p37_1251401_c1 3300050507 Unclassified 761
482 nmdc:mga05p37_131870_c1 3300050507 Bacteria 3066
483 nmdc:mga05p37_370776_c1 3300050507 Bacteria 1680
484 nmdc:mga05p37_494463_c1 3300050507 Bacteria 1405
485 nmdc:mga09592_44391_c1 3300050508 Bacteria 3741
486 nmdc:mga09592_57792_c1 3300050508 Bacteria 3279
487 nmdc:mga0n895_303321_c1 3300050512 Bacteria 1619
488 nmdc:mga0n895_511244_c1 3300050512 Bacteria 1209
489 nmdc:mga0n895_655403_c1 3300050512 Bacteria 1048
490 nmdc:mga0a205_321973_c1 3300050515 Bacteria 1417
491 nmdc:mga0a205_785940_c1 3300050515 Bacteria 800
492 nmdc:mga0a205_79798_c1 3300050515 Unclassified 3162
493 Ga0495601_0088382 3300053077 Bacteria 1992
494 Ga0495601_0139145 3300053077 Bacteria 1583
495 Ga0495612_0003390 3300053078 Bacteria 6603
496 Ga0495595_0000324 3300053084 Bacteria 18614
497 Ga0495619_0135725 3300053085 Bacteria 1692
498 Ga0530510_0087213 3300061734 Bacteria 2274

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005467 Ga0070706_100015375 Ga0070706_1000153751 165
2 3300005468 Ga0070707_100157293 Ga0070707_1001572932 165
3 3300025910 Ga0207684_10067409 Ga0207684_100674093 165
4 3300025922 Ga0207646_10250256 Ga0207646_102502562 165
5 3300005437 Ga0070710_10185525 Ga0070710_101855252 170
6 3300005577 Ga0068857_100241658 Ga0068857_1002416582 170
7 3300013306 Ga0163162_10985617 Ga0163162_109856172 170
8 3300025898 Ga0207692_10315608 Ga0207692_103156082 170
9 3300026116 Ga0207674_10203461 Ga0207674_102034612 170
10 3300028380 Ga0268265_10382835 Ga0268265_103828352 170
11 3300035111 Ga0373923_0027593 Ga0373923_0027593_1655_2242 170
12 3300035113 Ga0373936_0143241 Ga0373936_0143241_153_740 170
13 3300035118 Ga0373954_0008910 Ga0373954_0008910_1863_2450 170
14 3300035172 Ga0373955_0001640 Ga0373955_0001640_6651_7238 170
15 3300035695 Ga0373927_0041502 Ga0373927_0041502_111_698 170
16 3300035724 Ga0373933_0002364 Ga0373933_0002364_1381_1968 170
17 3300035725 Ga0373947_0570968 Ga0373947_0570968_131_718 170
18 3300036401 Ga0373937_0002367 Ga0373937_0002367_4187_4774 170
19 3300037068 Ga0373925_0436168 Ga0373925_0436168_10_597 170
20 3300046454 Ga0495592_0134551 Ga0495592_0134551_1098_1685 170
21 3300046459 Ga0495629_0006722 Ga0495629_0006722_4708_5295 170
22 3300046462 Ga0495651_0000265 Ga0495651_0000265_28342_28929 170
23 3300046463 Ga0495653_0000794 Ga0495653_0000794_9874_10461 170
24 3300046477 Ga0495664_0030987 Ga0495664_0030987_283_870 170
25 3300046499 Ga0495594_0371333 Ga0495594_0371333_132_719 170
26 3300046514 Ga0495618_0001577 Ga0495618_0001577_14403_14990 170
27 3300046516 Ga0495628_0024335 Ga0495628_0024335_2460_3047 170
28 3300046517 Ga0495630_0261906 Ga0495630_0261906_47_634 170
29 3300046529 Ga0495652_0010236 Ga0495652_0010236_1736_2323 170
30 3300046536 Ga0495587_0003591 Ga0495587_0003591_4527_5114 170
31 3300046559 Ga0495667_0002082 Ga0495667_0002082_4112_4699 170
32 3300046642 Ga0495634_0019596 Ga0495634_0019596_459_1046 170
33 3300046663 Ga0495635_0075401 Ga0495635_0075401_785_1372 170
34 3300046675 Ga0495657_0082049 Ga0495657_0082049_1484_2071 170
35 3300046678 Ga0495599_0157125 Ga0495599_0157125_422_1009 170
36 3300046679 Ga0495623_0150082 Ga0495623_0150082_422_1009 170
37 3300046680 Ga0495646_0005043 Ga0495646_0005043_4328_4915 170
38 3300046689 Ga0495613_0400363 Ga0495613_0400363_94_681 170
39 3300046690 Ga0495624_0028165 Ga0495624_0028165_137_724 170
40 3300046809 Ga0495600_0015406 Ga0495600_0015406_4163_4750 170
41 3300047315 Ga0495581_0055077 Ga0495581_0055077_1173_1760 170
42 3300047317 Ga0495604_0000118 Ga0495604_0000118_23461_24048 170
43 3300047319 Ga0495674_0035843 Ga0495674_0035843_3627_4214 170
44 3300047321 Ga0495676_0024770 Ga0495676_0024770_3209_3796 170
45 3300047322 Ga0495680_0001567 Ga0495680_0001567_95_682 170
46 3300047444 Ga0495675_0017097 Ga0495675_0017097_124_711 170
47 3300047673 Ga0495593_0042124 Ga0495593_0042124_298_885 170
48 3300048088 Ga0495602_0171041 Ga0495602_0171041_680_1267 170
49 3300048912 Ga0496109_0689132 Ga0496109_0689132_71_661 170
50 3300053077 Ga0495601_0088382 Ga0495601_0088382_970_1557 170
51 3300053078 Ga0495612_0003390 Ga0495612_0003390_5910_6497 170
52 3300053084 Ga0495595_0000324 Ga0495595_0000324_222_809 170
53 3300053085 Ga0495619_0135725 Ga0495619_0135725_436_1023 170
54 3300061734 Ga0530510_0087213 Ga0530510_0087213_1198_1764 170
55 3300005330 Ga0070690_100550259 Ga0070690_1005502592 172
56 3300006881 Ga0068865_100107062 Ga0068865_1001070623 172
57 3300025938 Ga0207704_10072800 Ga0207704_100728003 172
58 3300005290 Ga0065712_10230829 Ga0065712_102308292 173
59 3300005293 Ga0065715_10006849 Ga0065715_100068493 173
60 3300005618 Ga0068864_100494665 Ga0068864_1004946651 173
61 3300013296 Ga0157374_10096903 Ga0157374_100969033 173
62 3300044842 Ga0466957_0091648 Ga0466957_0091648_875_1504 173
63 3300048904 Ga0496101_0783079 Ga0496101_0783079_147_734 173
64 3300048907 Ga0496104_0154561 Ga0496104_0154561_1004_1591 173
65 3300048912 Ga0496109_0387194 Ga0496109_0387194_82_669 173
66 3300048917 Ga0496114_0015654 Ga0496114_0015654_499_1086 173
67 3300048918 Ga0496115_0244161 Ga0496115_0244161_807_1442 173
68 3300053077 Ga0495601_0139145 Ga0495601_0139145_280_867 173
69 3300003203 JGI25406J46586_10004972 JGI25406J46586_100049728 174
70 3300003322 rootL2_10270263 rootL2_102702632 174
71 3300005330 Ga0070690_100071973 Ga0070690_1000719732 174
72 3300005340 Ga0070689_100367016 Ga0070689_1003670161 174
73 3300005353 Ga0070669_100100644 Ga0070669_1001006442 174
74 3300005353 Ga0070669_100473890 Ga0070669_1004738902 174
75 3300005438 Ga0070701_10031103 Ga0070701_100311033 174
76 3300005615 Ga0070702_100250650 Ga0070702_1002506502 174
77 3300005615 Ga0070702_100273481 Ga0070702_1002734812 174
78 3300005617 Ga0068859_100028738 Ga0068859_1000287382 174
79 3300005840 Ga0068870_10208448 Ga0068870_102084482 174
80 3300005842 Ga0068858_100813773 Ga0068858_1008137732 174
81 3300005843 Ga0068860_100423456 Ga0068860_1004234562 174
82 3300005844 Ga0068862_100008314 Ga0068862_1000083144 174
83 3300005844 Ga0068862_100053059 Ga0068862_1000530592 174
84 3300005844 Ga0068862_100088469 Ga0068862_1000884693 174
85 3300005937 Ga0081455_10414226 Ga0081455_104142262 174
86 3300006173 Ga0070716_100000003 Ga0070716_10000000336 174
87 3300006173 Ga0070716_100295903 Ga0070716_1002959031 174
88 3300006844 Ga0075428_100308704 Ga0075428_1003087042 174
89 3300006880 Ga0075429_100008602 Ga0075429_1000086029 174
90 3300006880 Ga0075429_100046987 Ga0075429_1000469874 174
91 3300006881 Ga0068865_100861070 Ga0068865_1008610701 174
92 3300006931 Ga0097620_100028740 Ga0097620_1000287402 174
93 3300009094 Ga0111539_10144414 Ga0111539_101444142 174
94 3300009147 Ga0114129_11446692 Ga0114129_114466921 174
95 3300009174 Ga0105241_11041697 Ga0105241_110416972 174
96 3300009176 Ga0105242_10918653 Ga0105242_109186532 174
97 3300009553 Ga0105249_10017805 Ga0105249_100178052 174
98 3300009553 Ga0105249_10106766 Ga0105249_101067662 174
99 3300013297 Ga0157378_10019632 Ga0157378_100196322 174
100 3300013297 Ga0157378_10546937 Ga0157378_105469372 174
101 3300013308 Ga0157375_10759080 Ga0157375_107590802 174
102 3300013308 Ga0157375_10843862 Ga0157375_108438622 174
103 3300014325 Ga0163163_10693279 Ga0163163_106932791 174
104 3300014326 Ga0157380_10002797 Ga0157380_1000279710 174
105 3300025918 Ga0207662_10064160 Ga0207662_100641602 174
106 3300025923 Ga0207681_10115201 Ga0207681_101152011 174
107 3300025926 Ga0207659_10387846 Ga0207659_103878461 174
108 3300025933 Ga0207706_10047991 Ga0207706_100479912 174
109 3300025939 Ga0207665_10000003 Ga0207665_1000000382 174
110 3300025961 Ga0207712_10407046 Ga0207712_104070461 174
111 3300026089 Ga0207648_10421987 Ga0207648_104219872 174
112 3300026095 Ga0207676_10379037 Ga0207676_103790372 174
113 3300027907 Ga0207428_10001780 Ga0207428_100017809 174
114 3300028380 Ga0268265_10025222 Ga0268265_100252223 174
115 3300037466 Ga0395898_0161219 Ga0395898_0161219_627_1196 174
116 3300046537 Ga0495598_0014643 Ga0495598_0014643_117_713 174
117 3300046664 Ga0495659_0191392 Ga0495659_0191392_19_615 174
118 3300049582 Ga0501048_0949693 Ga0501048_0949693_26_604 174
119 3300050507 nmdc:mga05p37_494463_c1 nmdc:mga05p37_494463_c1_213_791 174
120 3300050508 nmdc:mga09592_57792_c1 nmdc:mga09592_57792_c1_1740_2336 174
121 3300005445 Ga0070708_100401702 Ga0070708_1004017021 175
122 3300005293 Ga0065715_10234882 Ga0065715_102348821 176
123 3300005328 Ga0070676_10117649 Ga0070676_101176492 176
124 3300005339 Ga0070660_100015860 Ga0070660_1000158603 176
125 3300005344 Ga0070661_100171093 Ga0070661_1001710932 176
126 3300005353 Ga0070669_100316382 Ga0070669_1003163822 176
127 3300005354 Ga0070675_100264740 Ga0070675_1002647401 176
128 3300005355 Ga0070671_100035876 Ga0070671_1000358762 176
129 3300005366 Ga0070659_100001017 Ga0070659_1000010174 176
130 3300005455 Ga0070663_100021070 Ga0070663_1000210702 176
131 3300005457 Ga0070662_100004111 Ga0070662_1000041115 176
132 3300005458 Ga0070681_10279524 Ga0070681_102795242 176
133 3300005539 Ga0068853_100005087 Ga0068853_1000050875 176
134 3300005543 Ga0070672_100175728 Ga0070672_1001757282 176
135 3300005563 Ga0068855_100457794 Ga0068855_1004577942 176
136 3300005564 Ga0070664_100021164 Ga0070664_1000211642 176
137 3300005578 Ga0068854_100065028 Ga0068854_1000650282 176
138 3300005614 Ga0068856_100005065 Ga0068856_1000050658 176
139 3300005616 Ga0068852_100025692 Ga0068852_1000256924 176
140 3300005841 Ga0068863_100473260 Ga0068863_1004732602 176
141 3300006871 Ga0075434_100424810 Ga0075434_1004248102 176
142 3300009174 Ga0105241_10612916 Ga0105241_106129161 176
143 3300013100 Ga0157373_10009902 Ga0157373_100099023 176
144 3300013102 Ga0157371_10002099 Ga0157371_1000209911 176
145 3300013307 Ga0157372_10002796 Ga0157372_1000279610 176
146 3300014325 Ga0163163_10720689 Ga0163163_107206892 176
147 3300014745 Ga0157377_10738961 Ga0157377_107389611 176
148 3300025907 Ga0207645_10014191 Ga0207645_100141914 176
149 3300025912 Ga0207707_10512896 Ga0207707_105128961 176
150 3300025919 Ga0207657_10001461 Ga0207657_1000146114 176
151 3300025923 Ga0207681_10170327 Ga0207681_101703272 176
152 3300025926 Ga0207659_10142165 Ga0207659_101421652 176
153 3300025931 Ga0207644_10043980 Ga0207644_100439801 176
154 3300025932 Ga0207690_10002569 Ga0207690_100025699 176
155 3300025933 Ga0207706_10000040 Ga0207706_1000004096 176
156 3300025940 Ga0207691_10071431 Ga0207691_100714312 176
157 3300025945 Ga0207679_10014249 Ga0207679_100142495 176
158 3300025949 Ga0207667_10016457 Ga0207667_100164577 176
159 3300025981 Ga0207640_10038600 Ga0207640_100386002 176
160 3300026041 Ga0207639_10022909 Ga0207639_100229093 176
161 3300026067 Ga0207678_10193285 Ga0207678_101932852 176
162 3300035092 Ga0373952_0025361 Ga0373952_0025361_651_1262 176
163 3300048905 Ga0496102_0417597 Ga0496102_0417597_245_856 176
164 3300048909 Ga0496106_0013867 Ga0496106_0013867_22_585 176
165 3300048910 Ga0496107_0521092 Ga0496107_0521092_203_805 176
166 3300050512 nmdc:mga0n895_511244_c1 nmdc:mga0n895_511244_c1_384_995 176
167 3300005289 Ga0065704_10226521 Ga0065704_102265212 177
168 3300005293 Ga0065715_10452523 Ga0065715_104525231 177
169 3300005328 Ga0070676_10189056 Ga0070676_101890562 177
170 3300005331 Ga0070670_100098707 Ga0070670_1000987073 177
171 3300005334 Ga0068869_100063965 Ga0068869_1000639652 177
172 3300005338 Ga0068868_100486995 Ga0068868_1004869952 177
173 3300005406 Ga0070703_10000049 Ga0070703_1000004915 177
174 3300005441 Ga0070700_100001704 Ga0070700_1000017045 177
175 3300005445 Ga0070708_100115867 Ga0070708_1001158672 177
176 3300005458 Ga0070681_10002824 Ga0070681_1000282410 177
177 3300005530 Ga0070679_100002739 Ga0070679_10000273910 177
178 3300005536 Ga0070697_100047176 Ga0070697_1000471762 177
179 3300005536 Ga0070697_100177249 Ga0070697_1001772492 177
180 3300005536 Ga0070697_100254496 Ga0070697_1002544962 177
181 3300005545 Ga0070695_100476441 Ga0070695_1004764412 177
182 3300005546 Ga0070696_100046765 Ga0070696_1000467652 177
183 3300005547 Ga0070693_100435347 Ga0070693_1004353471 177
184 3300005549 Ga0070704_100391633 Ga0070704_1003916332 177
185 3300005617 Ga0068859_100008267 Ga0068859_1000082672 177
186 3300005618 Ga0068864_100135768 Ga0068864_1001357683 177
187 3300005843 Ga0068860_100061286 Ga0068860_1000612864 177
188 3300005844 Ga0068862_100416813 Ga0068862_1004168132 177
189 3300005985 Ga0081539_10001244 Ga0081539_1000124412 177
190 3300006931 Ga0097620_100008267 Ga0097620_1000082672 177
191 3300007076 Ga0075435_100624793 Ga0075435_1006247932 177
192 3300009094 Ga0111539_10384707 Ga0111539_103847072 177
193 3300009147 Ga0114129_10035058 Ga0114129_100350584 177
194 3300009177 Ga0105248_10421429 Ga0105248_104214292 177
195 3300009553 Ga0105249_10799596 Ga0105249_107995962 177
196 3300009553 Ga0105249_11169482 Ga0105249_111694821 177
197 3300013306 Ga0163162_10047575 Ga0163162_100475755 177
198 3300013306 Ga0163162_10118009 Ga0163162_101180093 177
199 3300013308 Ga0157375_10066315 Ga0157375_100663154 177
200 3300013308 Ga0157375_10145214 Ga0157375_101452142 177
201 3300014325 Ga0163163_10063185 Ga0163163_100631854 177
202 3300021384 Ga0213876_10000112 Ga0213876_1000011224 177
203 3300025885 Ga0207653_10000163 Ga0207653_1000016333 177
204 3300025910 Ga0207684_10520722 Ga0207684_105207221 177
205 3300025912 Ga0207707_10000008 Ga0207707_100000089 177
206 3300025921 Ga0207652_10000085 Ga0207652_1000008579 177
207 3300025922 Ga0207646_10524731 Ga0207646_105247312 177
208 3300025940 Ga0207691_10200522 Ga0207691_102005221 177
209 3300025942 Ga0207689_10075365 Ga0207689_100753652 177
210 3300025981 Ga0207640_10095816 Ga0207640_100958162 177
211 3300026075 Ga0207708_10003764 Ga0207708_100037643 177
212 3300026095 Ga0207676_10045523 Ga0207676_100455234 177
213 3300028380 Ga0268265_10325009 Ga0268265_103250092 177
214 3300028381 Ga0268264_10664672 Ga0268264_106646722 177
215 3300037471 Ga0395905_0004964 Ga0395905_0004964_5095_5694 177
216 3300039437 Ga0436365_1425589 Ga0436365_1425589_79780_80403 177
217 3300050507 nmdc:mga05p37_370776_c1 nmdc:mga05p37_370776_c1_986_1603 177
218 3300050512 nmdc:mga0n895_303321_c1 nmdc:mga0n895_303321_c1_14_622 177
219 3300050515 nmdc:mga0a205_321973_c1 nmdc:mga0a205_321973_c1_97_657 177
220 3300050515 nmdc:mga0a205_785940_c1 nmdc:mga0a205_785940_c1_38_655 177
221 3300005293 Ga0065715_10089819 Ga0065715_100898195 178
222 3300005331 Ga0070670_100001205 Ga0070670_1000012057 178
223 3300005335 Ga0070666_10210886 Ga0070666_102108861 178
224 3300005340 Ga0070689_100073043 Ga0070689_1000730431 178
225 3300005354 Ga0070675_100170986 Ga0070675_1001709863 178
226 3300005355 Ga0070671_100008298 Ga0070671_1000082989 178
227 3300005365 Ga0070688_100158442 Ga0070688_1001584423 178
228 3300005366 Ga0070659_100173016 Ga0070659_1001730162 178
229 3300005549 Ga0070704_100077876 Ga0070704_1000778763 178
230 3300005617 Ga0068859_100131903 Ga0068859_1001319034 178
231 3300005618 Ga0068864_100345073 Ga0068864_1003450731 178
232 3300006237 Ga0097621_100134105 Ga0097621_1001341052 178
233 3300006358 Ga0068871_100477828 Ga0068871_1004778283 178
234 3300006844 Ga0075428_100143367 Ga0075428_1001433672 178
235 3300006931 Ga0097620_100131901 Ga0097620_1001319014 178
236 3300009011 Ga0105251_10238313 Ga0105251_102383131 178
237 3300009147 Ga0114129_10514373 Ga0114129_105143732 178
238 3300009176 Ga0105242_10003928 Ga0105242_100039283 178
239 3300009177 Ga0105248_10695275 Ga0105248_106952752 178
240 3300011119 Ga0105246_10187732 Ga0105246_101877322 178
241 3300013308 Ga0157375_10236150 Ga0157375_102361502 178
242 3300025910 Ga0207684_10119015 Ga0207684_101190152 178
243 3300025922 Ga0207646_10042513 Ga0207646_100425133 178
244 3300025925 Ga0207650_10000675 Ga0207650_1000067513 178
245 3300025934 Ga0207686_10000003 Ga0207686_10000003225 178
246 3300025935 Ga0207709_10000017 Ga0207709_10000017284 178
247 3300025936 Ga0207670_10059209 Ga0207670_100592093 178
248 3300025942 Ga0207689_10477356 Ga0207689_104773561 178
249 3300025960 Ga0207651_10217531 Ga0207651_102175312 178
250 3300026088 Ga0207641_10049788 Ga0207641_100497883 178
251 3300026118 Ga0207675_100580907 Ga0207675_1005809072 178
252 3300032004 Ga0307414_10194859 Ga0307414_101948591 178
253 3300045051 Ga0451576_0026804 Ga0451576_0026804_894_1535 178
254 3300050508 nmdc:mga09592_44391_c1 nmdc:mga09592_44391_c1_1358_1921 178
255 3300005290 Ga0065712_10097629 Ga0065712_100976292 179
256 3300005290 Ga0065712_10261260 Ga0065712_102612602 179
257 3300005293 Ga0065715_10096528 Ga0065715_100965282 179
258 3300005293 Ga0065715_10288674 Ga0065715_102886741 179
259 3300005329 Ga0070683_100129090 Ga0070683_1001290902 179
260 3300005330 Ga0070690_100181611 Ga0070690_1001816111 179
261 3300005336 Ga0070680_100025267 Ga0070680_1000252674 179
262 3300005337 Ga0070682_100117422 Ga0070682_1001174222 179
263 3300005338 Ga0068868_100086036 Ga0068868_1000860362 179
264 3300005339 Ga0070660_100378574 Ga0070660_1003785742 179
265 3300005344 Ga0070661_100024590 Ga0070661_1000245902 179
266 3300005355 Ga0070671_100409967 Ga0070671_1004099671 179
267 3300005364 Ga0070673_100000212 Ga0070673_10000021213 179
268 3300005366 Ga0070659_100000997 Ga0070659_1000009974 179
269 3300005367 Ga0070667_100159222 Ga0070667_1001592222 179
270 3300005444 Ga0070694_100220977 Ga0070694_1002209772 179
271 3300005455 Ga0070663_100142005 Ga0070663_1001420052 179
272 3300005457 Ga0070662_100096935 Ga0070662_1000969352 179
273 3300005458 Ga0070681_10090269 Ga0070681_100902692 179
274 3300005518 Ga0070699_100154971 Ga0070699_1001549713 179
275 3300005530 Ga0070679_100020243 Ga0070679_1000202432 179
276 3300005539 Ga0068853_100010682 Ga0068853_1000106825 179
277 3300005539 Ga0068853_100101570 Ga0068853_1001015702 179
278 3300005548 Ga0070665_100237784 Ga0070665_1002377841 179
279 3300005564 Ga0070664_100002145 Ga0070664_10000214514 179
280 3300005614 Ga0068856_100995567 Ga0068856_1009955672 179
281 3300005616 Ga0068852_100312414 Ga0068852_1003124141 179
282 3300005617 Ga0068859_100164248 Ga0068859_1001642482 179
283 3300005618 Ga0068864_100050313 Ga0068864_1000503133 179
284 3300005618 Ga0068864_100233899 Ga0068864_1002338992 179
285 3300005719 Ga0068861_100006204 Ga0068861_1000062048 179
286 3300005840 Ga0068870_10089753 Ga0068870_100897532 179
287 3300005841 Ga0068863_100270716 Ga0068863_1002707161 179
288 3300006237 Ga0097621_100081546 Ga0097621_1000815462 179
289 3300006852 Ga0075433_10027319 Ga0075433_100273192 179
290 3300006871 Ga0075434_100418798 Ga0075434_1004187982 179
291 3300006881 Ga0068865_101024061 Ga0068865_1010240611 179
292 3300006931 Ga0097620_100164243 Ga0097620_1001642432 179
293 3300009177 Ga0105248_10013612 Ga0105248_100136122 179
294 3300009545 Ga0105237_10050235 Ga0105237_100502353 179
295 3300010375 Ga0105239_10426036 Ga0105239_104260362 179
296 3300013100 Ga0157373_10025815 Ga0157373_100258154 179
297 3300013297 Ga0157378_10008455 Ga0157378_100084555 179
298 3300013297 Ga0157378_11265022 Ga0157378_112650221 179
299 3300013306 Ga0163162_10026360 Ga0163162_100263602 179
300 3300013307 Ga0157372_10010938 Ga0157372_100109386 179
301 3300013308 Ga0157375_10054284 Ga0157375_100542844 179
302 3300014325 Ga0163163_10003828 Ga0163163_100038286 179
303 3300014325 Ga0163163_10229485 Ga0163163_102294852 179
304 3300014326 Ga0157380_10001887 Ga0157380_100018878 179
305 3300025912 Ga0207707_10026167 Ga0207707_100261675 179
306 3300025917 Ga0207660_10019420 Ga0207660_100194203 179
307 3300025919 Ga0207657_10335503 Ga0207657_103355032 179
308 3300025920 Ga0207649_10186955 Ga0207649_101869552 179
309 3300025921 Ga0207652_10193390 Ga0207652_101933902 179
310 3300025932 Ga0207690_10045877 Ga0207690_100458773 179
311 3300025936 Ga0207670_10497503 Ga0207670_104975032 179
312 3300025942 Ga0207689_10013933 Ga0207689_100139336 179
313 3300025944 Ga0207661_10206394 Ga0207661_102063942 179
314 3300025945 Ga0207679_10085908 Ga0207679_100859083 179
315 3300025949 Ga0207667_11093036 Ga0207667_110930361 179
316 3300025960 Ga0207651_10000458 Ga0207651_100004586 179
317 3300025960 Ga0207651_10842905 Ga0207651_108429051 179
318 3300026023 Ga0207677_10196867 Ga0207677_101968672 179
319 3300026041 Ga0207639_10024805 Ga0207639_100248052 179
320 3300026041 Ga0207639_10126280 Ga0207639_101262802 179
321 3300026078 Ga0207702_10143299 Ga0207702_101432992 179
322 3300026088 Ga0207641_10284056 Ga0207641_102840562 179
323 3300026089 Ga0207648_10222715 Ga0207648_102227152 179
324 3300026095 Ga0207676_10011521 Ga0207676_100115217 179
325 3300026095 Ga0207676_10269075 Ga0207676_102690752 179
326 3300026116 Ga0207674_10002177 Ga0207674_100021776 179
327 3300039450 Ga0436363_0593977 Ga0436363_0593977_439_1044 179
328 3300044673 Ga0453683_0279070 Ga0453683_0279070_439_1005 179
329 3300048905 Ga0496102_0494783 Ga0496102_0494783_121_687 179
330 3300048906 Ga0496103_0385706 Ga0496103_0385706_75_641 179
331 3300048907 Ga0496104_0126305 Ga0496104_0126305_1347_1913 179
332 3300048909 Ga0496106_0114781 Ga0496106_0114781_639_1205 179
333 3300048912 Ga0496109_0471231 Ga0496109_0471231_547_1113 179
334 3300048914 Ga0496111_0783394 Ga0496111_0783394_78_644 179
335 3300050512 nmdc:mga0n895_655403_c1 nmdc:mga0n895_655403_c1_421_987 179
336 3300050515 nmdc:mga0a205_79798_c1 nmdc:mga0a205_79798_c1_2528_3094 179
337 3300005339 Ga0070660_100111992 Ga0070660_1001119922 180
338 3300005344 Ga0070661_100046710 Ga0070661_1000467103 180
339 3300005344 Ga0070661_100435726 Ga0070661_1004357262 180
340 3300005467 Ga0070706_100014813 Ga0070706_1000148136 180
341 3300005468 Ga0070707_100073837 Ga0070707_1000738373 180
342 3300005471 Ga0070698_100751163 Ga0070698_1007511631 180
343 3300005536 Ga0070697_100255843 Ga0070697_1002558432 180
344 3300005563 Ga0068855_100459814 Ga0068855_1004598142 180
345 3300009147 Ga0114129_10300936 Ga0114129_103009363 180
346 3300009177 Ga0105248_10854147 Ga0105248_108541472 180
347 3300013104 Ga0157370_10304894 Ga0157370_103048942 180
348 3300013105 Ga0157369_10346478 Ga0157369_103464782 180
349 3300013105 Ga0157369_10357543 Ga0157369_103575431 180
350 3300013307 Ga0157372_10070958 Ga0157372_100709584 180
351 3300017792 Ga0163161_10599949 Ga0163161_105999491 180
352 3300025899 Ga0207642_10131299 Ga0207642_101312992 180
353 3300025910 Ga0207684_10001129 Ga0207684_1000112911 180
354 3300025919 Ga0207657_10056266 Ga0207657_100562663 180
355 3300025919 Ga0207657_10120581 Ga0207657_101205812 180
356 3300025920 Ga0207649_10490050 Ga0207649_104900502 180
357 3300025921 Ga0207652_10155141 Ga0207652_101551412 180
358 3300025931 Ga0207644_10003580 Ga0207644_100035802 180
359 3300025933 Ga0207706_10088891 Ga0207706_100888913 180
360 3300025945 Ga0207679_10122103 Ga0207679_101221032 180
361 3300025949 Ga0207667_10370712 Ga0207667_103707122 180
362 3300027665 Ga0209983_1044634 Ga0209983_10446342 180
363 3300031731 Ga0307405_10011070 Ga0307405_100110702 180
364 3300031824 Ga0307413_10114587 Ga0307413_101145872 180
365 3300031903 Ga0307407_10069112 Ga0307407_100691122 180
366 3300031911 Ga0307412_10111368 Ga0307412_101113682 180
367 3300032004 Ga0307414_10038324 Ga0307414_100383244 180
368 3300032126 Ga0307415_100242011 Ga0307415_1002420111 180
369 3300046539 Ga0495621_0085482 Ga0495621_0085482_429_1085 180
370 3300005467 Ga0070706_100130596 Ga0070706_1001305962 181
371 3300005445 Ga0070708_100000191 Ga0070708_10000019116 182
372 3300005445 Ga0070708_100000712 Ga0070708_1000007123 182
373 3300005467 Ga0070706_100178958 Ga0070706_1001789582 182
374 3300005468 Ga0070707_100120193 Ga0070707_1001201933 182
375 3300005471 Ga0070698_100015126 Ga0070698_1000151264 182
376 3300005471 Ga0070698_100588645 Ga0070698_1005886451 182
377 3300005518 Ga0070699_100032163 Ga0070699_1000321632 182
378 3300005545 Ga0070695_100291205 Ga0070695_1002912051 182
379 3300005546 Ga0070696_100072022 Ga0070696_1000720222 182
380 3300005546 Ga0070696_100092786 Ga0070696_1000927862 182
381 3300009148 Ga0105243_10470793 Ga0105243_104707932 182
382 3300009174 Ga0105241_10590782 Ga0105241_105907821 182
383 3300010159 Ga0099796_10246599 Ga0099796_102465991 182
384 3300025910 Ga0207684_10470421 Ga0207684_104704212 182
385 3300025911 Ga0207654_10505856 Ga0207654_105058561 182
386 3300025922 Ga0207646_10274039 Ga0207646_102740392 182
387 3300025935 Ga0207709_10259618 Ga0207709_102596182 182
388 3300035410 Ga0373924_0143950 Ga0373924_0143950_30_725 182
389 3300002074 JGI24748J21848_1000001 JGI24748J21848_1000001341 183
390 3300002239 JGI24034J26672_10000001 JGI24034J26672_1000000176 183
391 3300005290 Ga0065712_10007428 Ga0065712_100074282 183
392 3300005295 Ga0065707_10092664 Ga0065707_100926642 183
393 3300005330 Ga0070690_100110116 Ga0070690_1001101162 183
394 3300005334 Ga0068869_100152273 Ga0068869_1001522733 183
395 3300005340 Ga0070689_100125021 Ga0070689_1001250212 183
396 3300005343 Ga0070687_100032970 Ga0070687_1000329703 183
397 3300005343 Ga0070687_100136644 Ga0070687_1001366442 183
398 3300005345 Ga0070692_10212327 Ga0070692_102123272 183
399 3300005353 Ga0070669_100072967 Ga0070669_1000729671 183
400 3300005355 Ga0070671_100041069 Ga0070671_1000410696 183
401 3300005355 Ga0070671_100311708 Ga0070671_1003117081 183
402 3300005364 Ga0070673_100791978 Ga0070673_1007919782 183
403 3300005367 Ga0070667_100828340 Ga0070667_1008283401 183
404 3300005438 Ga0070701_10013106 Ga0070701_100131061 183
405 3300005438 Ga0070701_10024328 Ga0070701_100243284 183
406 3300005456 Ga0070678_100669402 Ga0070678_1006694021 183
407 3300005459 Ga0068867_100157560 Ga0068867_1001575603 183
408 3300005459 Ga0068867_100200518 Ga0068867_1002005182 183
409 3300005466 Ga0070685_10176710 Ga0070685_101767103 183
410 3300005468 Ga0070707_100085947 Ga0070707_1000859473 183
411 3300005536 Ga0070697_100066533 Ga0070697_1000665332 183
412 3300005543 Ga0070672_100178755 Ga0070672_1001787552 183
413 3300005544 Ga0070686_100097347 Ga0070686_1000973472 183
414 3300005545 Ga0070695_100951287 Ga0070695_1009512871 183
415 3300005547 Ga0070693_100098482 Ga0070693_1000984822 183
416 3300005616 Ga0068852_100790209 Ga0068852_1007902092 183
417 3300005617 Ga0068859_100086895 Ga0068859_1000868952 183
418 3300005719 Ga0068861_100448513 Ga0068861_1004485132 183
419 3300005840 Ga0068870_10274290 Ga0068870_102742901 183
420 3300005841 Ga0068863_100204215 Ga0068863_1002042152 183
421 3300005842 Ga0068858_100000051 Ga0068858_10000005129 183
422 3300005842 Ga0068858_100108593 Ga0068858_1001085933 183
423 3300005842 Ga0068858_100147301 Ga0068858_1001473012 183
424 3300005842 Ga0068858_100620755 Ga0068858_1006207552 183
425 3300005843 Ga0068860_101317523 Ga0068860_1013175231 183
426 3300005844 Ga0068862_100122516 Ga0068862_1001225162 183
427 3300006237 Ga0097621_100102507 Ga0097621_1001025073 183
428 3300006881 Ga0068865_100038472 Ga0068865_1000384724 183
429 3300006931 Ga0097620_100086894 Ga0097620_1000868942 183
430 3300009094 Ga0111539_10065088 Ga0111539_100650884 183
431 3300009098 Ga0105245_10045151 Ga0105245_100451513 183
432 3300009101 Ga0105247_10000004 Ga0105247_10000004121 183
433 3300009147 Ga0114129_10021399 Ga0114129_100213996 183
434 3300009148 Ga0105243_10000446 Ga0105243_100004463 183
435 3300009148 Ga0105243_10549971 Ga0105243_105499712 183
436 3300009174 Ga0105241_10549829 Ga0105241_105498292 183
437 3300009176 Ga0105242_10001013 Ga0105242_1000101313 183
438 3300009176 Ga0105242_10023838 Ga0105242_100238386 183
439 3300009176 Ga0105242_10081745 Ga0105242_100817452 183
440 3300009177 Ga0105248_10814322 Ga0105248_108143222 183
441 3300009177 Ga0105248_11105142 Ga0105248_111051422 183
442 3300010375 Ga0105239_10298715 Ga0105239_102987152 183
443 3300011119 Ga0105246_10057378 Ga0105246_100573783 183
444 3300013297 Ga0157378_10000004 Ga0157378_10000004103 183
445 3300013297 Ga0157378_10015793 Ga0157378_100157934 183
446 3300013297 Ga0157378_10116895 Ga0157378_101168952 183
447 3300013297 Ga0157378_10214352 Ga0157378_102143522 183
448 3300013297 Ga0157378_10623294 Ga0157378_106232941 183
449 3300013306 Ga0163162_10207060 Ga0163162_102070602 183
450 3300013308 Ga0157375_10000479 Ga0157375_1000047914 183
451 3300013308 Ga0157375_10499273 Ga0157375_104992732 183
452 3300014325 Ga0163163_10638982 Ga0163163_106389822 183
453 3300014325 Ga0163163_10803800 Ga0163163_108038001 183
454 3300014326 Ga0157380_10041947 Ga0157380_100419472 183
455 3300014745 Ga0157377_10174066 Ga0157377_101740661 183
456 3300017792 Ga0163161_10410496 Ga0163161_104104961 183
457 3300025223 Ga0207672_1000002 Ga0207672_10000025 183
458 3300025899 Ga0207642_10070031 Ga0207642_100700312 183
459 3300025900 Ga0207710_10000002 Ga0207710_10000002893 183
460 3300025903 Ga0207680_10034812 Ga0207680_100348122 183
461 3300025907 Ga0207645_10340095 Ga0207645_103400951 183
462 3300025908 Ga0207643_10103372 Ga0207643_101033721 183
463 3300025918 Ga0207662_10016043 Ga0207662_100160434 183
464 3300025918 Ga0207662_10252639 Ga0207662_102526392 183
465 3300025923 Ga0207681_10553045 Ga0207681_105530452 183
466 3300025927 Ga0207687_10281420 Ga0207687_102814202 183
467 3300025931 Ga0207644_10000179 Ga0207644_1000017932 183
468 3300025933 Ga0207706_10491213 Ga0207706_104912132 183
469 3300025934 Ga0207686_10000127 Ga0207686_1000012720 183
470 3300025934 Ga0207686_10000965 Ga0207686_1000096513 183
471 3300025934 Ga0207686_10075763 Ga0207686_100757632 183
472 3300025935 Ga0207709_10003560 Ga0207709_100035609 183
473 3300025938 Ga0207704_10160850 Ga0207704_101608502 183
474 3300025940 Ga0207691_10000845 Ga0207691_1000084516 183
475 3300025941 Ga0207711_10524895 Ga0207711_105248952 183
476 3300025941 Ga0207711_10586191 Ga0207711_105861912 183
477 3300025942 Ga0207689_10001578 Ga0207689_100015787 183
478 3300025960 Ga0207651_10083005 Ga0207651_100830053 183
479 3300025986 Ga0207658_10801764 Ga0207658_108017641 183
480 3300026023 Ga0207677_10384693 Ga0207677_103846931 183
481 3300026035 Ga0207703_10000114 Ga0207703_1000011443 183
482 3300026035 Ga0207703_10529451 Ga0207703_105294512 183
483 3300026035 Ga0207703_11451440 Ga0207703_114514401 183
484 3300026075 Ga0207708_10068329 Ga0207708_100683293 183
485 3300026088 Ga0207641_11055260 Ga0207641_110552601 183
486 3300026089 Ga0207648_10166571 Ga0207648_101665712 183
487 3300026095 Ga0207676_10179495 Ga0207676_101794953 183
488 3300026118 Ga0207675_100005128 Ga0207675_1000051287 183
489 3300026121 Ga0207683_10436456 Ga0207683_104364562 183
490 3300027907 Ga0207428_10038699 Ga0207428_100386992 183
491 3300028380 Ga0268265_10377246 Ga0268265_103772462 183
492 3300038996 Ga0242420_000770 Ga0242420_000770_283_834 183
493 3300045051 Ga0451576_0264042 Ga0451576_0264042_106_705 183
494 3300047318 Ga0495636_0014016 Ga0495636_0014016_1725_2336 183
495 3300047471 Ga0495684_0094079 Ga0495684_0094079_588_1193 183
496 3300048909 Ga0496106_0001061 Ga0496106_0001061_13708_14319 183
497 3300050507 nmdc:mga05p37_1251401_c1 nmdc:mga05p37_1251401_c1_42_593 183
498 3300050507 nmdc:mga05p37_131870_c1 nmdc:mga05p37_131870_c1_2376_3014 183

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00551

Formyl_trans_N

Formyl transferase

3

184

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ywr-assembly1.cif.gz_A crystal structure of gar transformylase from aquifex aeolicus 0.9599 2 168
1c2t-assembly1.cif.gz_A new insights into inhibitor design from the crystal structure and nmr studies of e. coli gar transformylase in complex with beta-gar and 10-formyl-5,8,10-trideazafolic acid. 0.9559 2 174
3auf-assembly1.cif.gz_A-2 crystal structure of glycinamide ribonucleotide transformylase 1 from symbiobacterium toebii 0.9532 3 174
3av3-assembly1.cif.gz_A crystal structure of glycinamide ribonucleotide transformylase 1 from geobacillus kaustophilus 0.9483 2 172
3kcq-assembly2.cif.gz_B crystal structure of phosphoribosylglycinamide formyltransferase from anaplasma phagocytophilum 0.9432 3 168
ID Description Score Start End Superfamily
af_Q2FZI7_1_188_3.40.50.170 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9619 3 172 3.40.50.170
2ywrA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9585 2 168 3.40.50.170
3aufA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9532 3 174 3.40.50.170
3av3A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9528 2 169 3.40.50.170
3kcqB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9432 3 168 3.40.50.170
ID Description Score Start End GO Terms
AF-A0A3C0KBB1-F1-model_v4 phosphoribosylglycinamide formyltransferase 1 (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) 0.9798 87 175 GO:0004644
GO:0005829
GO:0006189
AF-Q1IM87-F1-model_v4 Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) (GART) 0.976 2 173 GO:0004644
GO:0005737
GO:0006189
AF-A0A2V8G8Z8-F1-model_v4 Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) (GART) 0.9733 15 173 GO:0004644
GO:0005829
GO:0006189
AF-A0A2M8F696-F1-model_v4 Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) (GART) 0.9698 2 173 GO:0004644
GO:0005829
GO:0006189
AF-E6W594-F1-model_v4 Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) (GART) 0.9691 2 173 GO:0004644
GO:0005737
GO:0006189

Feature Viewer

pLDDT pTM Quality
91.79 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map