F455159

General Info

Members Datasets Scaffolds Average Seq Length
498 228 996 327

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_100012473|Ga0070699_1000124734
Length 370
Sequence MRRRAPEVRSSPRGAPRDARVAGTPLRGPRAAECGPWIPACAGMSGVGRREFIALLAGAAAPLLLWPLAARAQQRFKIGLLDTGVGAAFAVPFTRKLVELGYVEGRNVVIERKSAEGNLERLKDLAEDLVRQQVDVIVTAGTPAGFAAKKATGTIPIVFGAISDPVGVGLVASLARPGGNATGNSLMAPDLSAKRLDILHTLAPGISRFAILWDSSNPGMAARVRETKIAADQSRVLLHTVGPRNLDELNAAFAELLSARPDALLVTAEAFTRRYLARIIDFANSNKIPAMFEDSDYVEAGGLMSYGPDYKAVFEKAAIFVDKILKGAKPADLPVEQPTKFELVINLKTAKALGLEIPPQLLALADRVIE

Samples

Sample ID Description Type Environment
1 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
151 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
152 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
153 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
154 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
155 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
156 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
157 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
159 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
160 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
161 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
162 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
163 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
164 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
165 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
166 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
167 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
168 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
169 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
170 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
171 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
172 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
173 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
174 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
175 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
176 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
177 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
178 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
179 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
180 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
181 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
182 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
183 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
184 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
185 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
186 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
187 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
188 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
189 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
190 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
191 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
192 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
193 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
194 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
195 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
196 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
207 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
208 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
209 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
210 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
211 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
212 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
213 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
214 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
215 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
216 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
217 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
218 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
219 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
220 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
221 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
222 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
223 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
224 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
225 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
226 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
227 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
228 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.64
Rhizosphere 90.16
Stem 0
Stem Tuber 0
Unclassified 17.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070699_100012473 3300005518 Bacteria 7334
2 JGI24743J22301_10022811 3300001991 Bacteria 1202
3 Ga0065712_10009335 3300005290 Unclassified 2969
4 Ga0065715_10096854 3300005293 Unclassified 3807
5 Ga0065715_10151766 3300005293 Bacteria 1721
6 Ga0065707_10012033 3300005295 Bacteria 2728
7 Ga0070658_10049738 3300005327 Bacteria 3397
8 Ga0070658_10123141 3300005327 Bacteria 2156
9 Ga0070676_10076004 3300005328 Unclassified 2026
10 Ga0070676_10103382 3300005328 Bacteria 1763
11 Ga0070683_100057580 3300005329 Unclassified 3610
12 Ga0070670_100010466 3300005331 Bacteria 7915
13 Ga0070670_100013018 3300005331 Bacteria 7126
14 Ga0070670_100126036 3300005331 Bacteria 2210
15 Ga0070666_10068355 3300005335 Bacteria 2414
16 Ga0070666_10166629 3300005335 Unclassified 1541
17 Ga0070680_100025415 3300005336 Bacteria 4733
18 Ga0070680_100134104 3300005336 Bacteria 2073
19 Ga0070682_100121133 3300005337 Bacteria 1757
20 Ga0068868_100000464 3300005338 Bacteria 27008
21 Ga0068868_100006688 3300005338 Bacteria 8180
22 Ga0068868_100071224 3300005338 Bacteria 2772
23 Ga0070660_100008947 3300005339 Bacteria 7024
24 Ga0070660_100140041 3300005339 Unclassified 1940
25 Ga0070691_10036027 3300005341 Bacteria 2331
26 Ga0070691_10051380 3300005341 Bacteria 1968
27 Ga0070687_100027721 3300005343 Bacteria 2740
28 Ga0070661_100001620 3300005344 Bacteria 15563
29 Ga0070661_100009464 3300005344 Bacteria 6746
30 Ga0070661_100265764 3300005344 Unclassified 1327
31 Ga0070692_10074964 3300005345 Bacteria 1811
32 Ga0070668_100041834 3300005347 Bacteria 3511
33 Ga0070675_100000914 3300005354 Bacteria 20982
34 Ga0070675_100137441 3300005354 Bacteria 2086
35 Ga0070671_100001694 3300005355 Bacteria 16720
36 Ga0070671_100197536 3300005355 Unclassified 1705
37 Ga0070674_100053474 3300005356 Bacteria 2788
38 Ga0070673_100019865 3300005364 Bacteria 4832
39 Ga0070673_100120079 3300005364 Unclassified 2191
40 Ga0070673_100242367 3300005364 Unclassified 1568
41 Ga0070688_100167009 3300005365 Bacteria 1515
42 Ga0070659_100031961 3300005366 Bacteria 4079
43 Ga0070659_100229762 3300005366 Bacteria 1533
44 Ga0070714_100086810 3300005435 Bacteria 2735
45 Ga0070713_100063851 3300005436 Bacteria 3089
46 Ga0070711_100086074 3300005439 Bacteria 2253
47 Ga0070711_100140985 3300005439 Bacteria 1807
48 Ga0070705_100084722 3300005440 Unclassified 1957
49 Ga0070705_100192802 3300005440 Bacteria 1390
50 Ga0070700_100076080 3300005441 Unclassified 2155
51 Ga0070700_100087888 3300005441 Bacteria 2021
52 Ga0070694_100104704 3300005444 Bacteria 2007
53 Ga0070694_100169643 3300005444 Unclassified 1606
54 Ga0070708_100009399 3300005445 Bacteria 7882
55 Ga0070708_100072909 3300005445 Bacteria 3094
56 Ga0070708_100073486 3300005445 Bacteria 3082
57 Ga0070708_100105326 3300005445 Bacteria 2587
58 Ga0070708_100229319 3300005445 Bacteria 1742
59 Ga0070708_100256392 3300005445 Bacteria 1644
60 Ga0070663_100012044 3300005455 Bacteria 5456
61 Ga0070663_100041607 3300005455 Bacteria 3224
62 Ga0070678_100002846 3300005456 Bacteria 9574
63 Ga0070678_100018249 3300005456 Bacteria 4546
64 Ga0070662_100004132 3300005457 Bacteria 9133
65 Ga0070662_100137325 3300005457 Bacteria 1891
66 Ga0070681_10026610 3300005458 Bacteria 5814
67 Ga0070681_10095031 3300005458 Unclassified 2929
68 Ga0068867_100024594 3300005459 Unclassified 4316
69 Ga0068867_100092471 3300005459 Bacteria 2297
70 Ga0068867_100275672 3300005459 Bacteria 1377
71 Ga0070685_10059578 3300005466 Bacteria 2229
72 Ga0070685_10088150 3300005466 Bacteria 1873
73 Ga0070706_100050650 3300005467 Bacteria 3832
74 Ga0070706_100062295 3300005467 Bacteria 3446
75 Ga0070706_100100766 3300005467 Bacteria 2684
76 Ga0070706_100112060 3300005467 Bacteria 2539
77 Ga0070706_100168133 3300005467 Unclassified 2047
78 Ga0070706_100361591 3300005467 Bacteria 1352
79 Ga0070707_100016174 3300005468 Bacteria 7001
80 Ga0070707_100377325 3300005468 Unclassified 1377
81 Ga0070707_100416002 3300005468 Bacteria 1305
82 Ga0070707_100459149 3300005468 Bacteria 1234
83 Ga0070698_100036911 3300005471 Bacteria 5042
84 Ga0070698_100061740 3300005471 Bacteria 3782
85 Ga0070698_100100662 3300005471 Bacteria 2862
86 Ga0070698_100122535 3300005471 Unclassified 2558
87 Ga0070698_100153560 3300005471 Unclassified 2248
88 Ga0070698_100261267 3300005471 Bacteria 1664
89 Ga0070698_100289465 3300005471 Unclassified 1569
90 Ga0070699_100004984 3300005518 Bacteria 11705
91 Ga0070699_100040741 3300005518 Bacteria 4020
92 Ga0070699_100056628 3300005518 Bacteria 3395
93 Ga0070699_100241832 3300005518 Bacteria 1611
94 Ga0070684_100002416 3300005535 Bacteria 13772
95 Ga0070684_100036391 3300005535 Unclassified 4218
96 Ga0070684_100197496 3300005535 Bacteria 1832
97 Ga0070697_100065536 3300005536 Bacteria 2968
98 Ga0070697_100145368 3300005536 Bacteria 1996
99 Ga0070697_100155935 3300005536 Bacteria 1927
100 Ga0070697_100327288 3300005536 Bacteria 1320
101 Ga0068853_100001972 3300005539 Bacteria 15129
102 Ga0068853_100152134 3300005539 Bacteria 2083
103 Ga0068853_100337003 3300005539 Bacteria 1401
104 Ga0070672_100004031 3300005543 Bacteria 9583
105 Ga0070672_100222752 3300005543 Bacteria 1582
106 Ga0070672_100266548 3300005543 Unclassified 1445
107 Ga0070686_100095772 3300005544 Bacteria 1995
108 Ga0070665_100080072 3300005548 Unclassified 3272
109 Ga0070665_100333934 3300005548 Bacteria 1520
110 Ga0070704_100115535 3300005549 Unclassified 2051
111 Ga0068855_100335717 3300005563 Unclassified 1667
112 Ga0070664_100002897 3300005564 Bacteria 13890
113 Ga0070664_100010803 3300005564 Bacteria 7403
114 Ga0070664_100062533 3300005564 Unclassified 3174
115 Ga0070664_100103957 3300005564 Bacteria 2473
116 Ga0068854_100033590 3300005578 Unclassified 3577
117 Ga0070702_100005470 3300005615 Bacteria 5920
118 Ga0070702_100167743 3300005615 Unclassified 1425
119 Ga0068852_100020825 3300005616 Bacteria 5219
120 Ga0068852_100036107 3300005616 Bacteria 4131
121 Ga0068852_100181195 3300005616 Bacteria 1981
122 Ga0068859_100032449 3300005617 Bacteria 5246
123 Ga0068859_100127794 3300005617 Bacteria 2612
124 Ga0068864_100005459 3300005618 Bacteria 10426
125 Ga0068864_100087514 3300005618 Bacteria 2743
126 Ga0068864_100121660 3300005618 Bacteria 2334
127 Ga0068866_10012408 3300005718 Unclassified 3711
128 Ga0068866_10053506 3300005718 Unclassified 2064
129 Ga0068861_100066615 3300005719 Bacteria 2777
130 Ga0068851_10005392 3300005834 Bacteria 5800
131 Ga0068870_10033216 3300005840 Bacteria 2631
132 Ga0068863_100011676 3300005841 Bacteria 8496
133 Ga0068863_100062596 3300005841 Bacteria 3518
134 Ga0068863_100108120 3300005841 Bacteria 2647
135 Ga0068863_100279415 3300005841 Bacteria 1617
136 Ga0068858_100066971 3300005842 Bacteria 3325
137 Ga0068860_100042471 3300005843 Bacteria 4341
138 Ga0068860_100309941 3300005843 Bacteria 1547
139 Ga0068862_100030378 3300005844 Bacteria 4554
140 Ga0068862_100120619 3300005844 Bacteria 2311
141 Ga0068862_100285880 3300005844 Bacteria 1513
142 Ga0068862_100374507 3300005844 Unclassified 1326
143 Ga0081455_10007012 3300005937 Bacteria 11974
144 Ga0070712_100168494 3300006175 Bacteria 1697
145 Ga0097621_100071215 3300006237 Unclassified 2872
146 Ga0097621_100174845 3300006237 Bacteria 1853
147 Ga0097621_100227175 3300006237 Unclassified 1629
148 Ga0068871_100023164 3300006358 Bacteria 4798
149 Ga0068871_100059036 3300006358 Bacteria 3125
150 Ga0068871_100166267 3300006358 Unclassified 1888
151 Ga0075428_100015050 3300006844 Bacteria 8595
152 Ga0075428_100056893 3300006844 Bacteria 4282
153 Ga0075428_100128020 3300006844 Bacteria 2762
154 Ga0075431_100071204 3300006847 Bacteria 3587
155 Ga0075433_10002863 3300006852 Bacteria 13221
156 Ga0075433_10004407 3300006852 Bacteria 10958
157 Ga0075433_10009494 3300006852 Bacteria 7774
158 Ga0075433_10059862 3300006852 Bacteria 3333
159 Ga0075433_10293492 3300006852 Bacteria 1440
160 Ga0075434_100020106 3300006871 Bacteria 6470
161 Ga0075434_100027051 3300006871 Bacteria 5629
162 Ga0075434_100027160 3300006871 Bacteria 5617
163 Ga0075434_100045409 3300006871 Bacteria 4358
164 Ga0075434_100623470 3300006871 Bacteria 1097
165 Ga0068865_100010590 3300006881 Bacteria 5746
166 Ga0075436_100002622 3300006914 Bacteria 12361
167 Ga0075436_100005391 3300006914 Bacteria 8804
168 Ga0097620_100032449 3300006931 Bacteria 5246
169 Ga0097620_100127794 3300006931 Bacteria 2612
170 Ga0075435_100017717 3300007076 Bacteria 5397
171 Ga0075435_100028790 3300007076 Bacteria 4358
172 Ga0075435_100188029 3300007076 Bacteria 1747
173 Ga0111539_10007722 3300009094 Bacteria 13737
174 Ga0111539_10043661 3300009094 Bacteria 5373
175 Ga0111539_10159762 3300009094 Bacteria 2636
176 Ga0111539_10165384 3300009094 Bacteria 2587
177 Ga0111539_10167763 3300009094 Bacteria 2565
178 Ga0105245_10055899 3300009098 Bacteria 3546
179 Ga0105245_10493886 3300009098 Bacteria 1239
180 Ga0105247_10189726 3300009101 Bacteria 1375
181 Ga0114129_10045318 3300009147 Bacteria 6183
182 Ga0114129_10064768 3300009147 Bacteria 5101
183 Ga0114129_10096765 3300009147 Bacteria 4086
184 Ga0114129_10300646 3300009147 Bacteria 2139
185 Ga0114129_10579573 3300009147 Bacteria 1456
186 Ga0114129_10647160 3300009147 Bacteria 1365
187 Ga0114129_10720138 3300009147 Bacteria 1280
188 Ga0105243_10025482 3300009148 Bacteria 4520
189 Ga0105243_10041858 3300009148 Bacteria 3583
190 Ga0105242_10126103 3300009176 Bacteria 2203
191 Ga0105242_10182732 3300009176 Bacteria 1851
192 Ga0105242_10290129 3300009176 Bacteria 1489
193 Ga0105248_10346900 3300009177 Unclassified 1671
194 Ga0105238_10002194 3300009551 Bacteria 19716
195 Ga0105249_10023992 3300009553 Bacteria 5478
196 Ga0105249_10256992 3300009553 Bacteria 1734
197 Ga0105239_10030539 3300010375 Bacteria 5924
198 Ga0105239_10195787 3300010375 Bacteria 2263
199 Ga0105246_10028819 3300011119 Bacteria 3650
200 Ga0105246_10190303 3300011119 Bacteria 1588
201 Ga0105246_10229066 3300011119 Unclassified 1462
202 Ga0157370_10207639 3300013104 Unclassified 1816
203 Ga0157369_10002885 3300013105 Bacteria 20538
204 Ga0157374_10001949 3300013296 Bacteria 17306
205 Ga0157374_10010686 3300013296 Bacteria 7908
206 Ga0157374_10036731 3300013296 Bacteria 4490
207 Ga0157378_10001981 3300013297 Bacteria 18324
208 Ga0157378_10125604 3300013297 Bacteria 2369
209 Ga0163162_10021332 3300013306 Bacteria 6378
210 Ga0163162_10046552 3300013306 Unclassified 4348
211 Ga0163162_10187452 3300013306 Unclassified 2196
212 Ga0163162_10294892 3300013306 Unclassified 1753
213 Ga0163162_10421322 3300013306 Bacteria 1467
214 Ga0163162_10490886 3300013306 Bacteria 1359
215 Ga0157375_10001986 3300013308 Bacteria 17663
216 Ga0157375_10009637 3300013308 Bacteria 8487
217 Ga0157375_10200031 3300013308 Bacteria 2154
218 Ga0163163_10006633 3300014325 Bacteria 10139
219 Ga0163163_10128040 3300014325 Bacteria 2578
220 Ga0163163_10417139 3300014325 Bacteria 1401
221 Ga0157380_10096630 3300014326 Unclassified 2449
222 Ga0157377_10058718 3300014745 Bacteria 2191
223 Ga0157377_10107230 3300014745 Unclassified 1674
224 Ga0157379_10044185 3300014968 Bacteria 3977
225 Ga0157376_10004716 3300014969 Bacteria 9503
226 Ga0157376_10032891 3300014969 Bacteria 4169
227 Ga0157376_10277150 3300014969 Bacteria 1578
228 Ga0207697_10005581 3300025315 Bacteria 5828
229 Ga0207697_10034626 3300025315 Bacteria 2067
230 Ga0207697_10050958 3300025315 Bacteria 1710
231 Ga0207697_10065376 3300025315 Unclassified 1518
232 Ga0207682_10001423 3300025893 Bacteria 11057
233 Ga0207710_10013383 3300025900 Bacteria 3454
234 Ga0207688_10002805 3300025901 Bacteria 9457
235 Ga0207688_10042191 3300025901 Bacteria 2540
236 Ga0207680_10212273 3300025903 Bacteria 1324
237 Ga0207645_10099581 3300025907 Bacteria 1874
238 Ga0207643_10009956 3300025908 Bacteria 5109
239 Ga0207643_10163517 3300025908 Unclassified 1340
240 Ga0207705_10088644 3300025909 Bacteria 2263
241 Ga0207684_10017739 3300025910 Bacteria 6106
242 Ga0207684_10042362 3300025910 Bacteria 3859
243 Ga0207684_10056371 3300025910 Bacteria 3333
244 Ga0207684_10090844 3300025910 Bacteria 2602
245 Ga0207684_10099524 3300025910 Bacteria 2483
246 Ga0207684_10245945 3300025910 Bacteria 1543
247 Ga0207684_10270156 3300025910 Bacteria 1467
248 Ga0207707_10007711 3300025912 Bacteria 9376
249 Ga0207695_10019152 3300025913 Bacteria 7887
250 Ga0207693_10108591 3300025915 Bacteria 2176
251 Ga0207693_10204581 3300025915 Bacteria 1552
252 Ga0207660_10099434 3300025917 Bacteria 2171
253 Ga0207649_10002056 3300025920 Bacteria 11442
254 Ga0207649_10041139 3300025920 Unclassified 2812
255 Ga0207649_10265629 3300025920 Bacteria 1242
256 Ga0207646_10009572 3300025922 Bacteria 9562
257 Ga0207646_10318453 3300025922 Bacteria 1405
258 Ga0207646_10338450 3300025922 Bacteria 1359
259 Ga0207650_10001095 3300025925 Bacteria 20014
260 Ga0207659_10000875 3300025926 Bacteria 17884
261 Ga0207659_10084020 3300025926 Bacteria 2362
262 Ga0207687_10404189 3300025927 Unclassified 1124
263 Ga0207700_10050662 3300025928 Bacteria 3095
264 Ga0207700_10239445 3300025928 Bacteria 1546
265 Ga0207644_10000147 3300025931 Bacteria 50433
266 Ga0207644_10196202 3300025931 Bacteria 1590
267 Ga0207690_10076439 3300025932 Bacteria 2325
268 Ga0207686_10140923 3300025934 Unclassified 1666
269 Ga0207709_10034675 3300025935 Bacteria 2977
270 Ga0207709_10063813 3300025935 Bacteria 2310
271 Ga0207709_10109109 3300025935 Bacteria 1847
272 Ga0207670_10041969 3300025936 Unclassified 3011
273 Ga0207704_10052007 3300025938 Bacteria 2481
274 Ga0207704_10069168 3300025938 Unclassified 2229
275 Ga0207704_10262845 3300025938 Bacteria 1302
276 Ga0207691_10000123 3300025940 Bacteria 70472
277 Ga0207691_10100190 3300025940 Bacteria 2586
278 Ga0207691_10153105 3300025940 Bacteria 2027
279 Ga0207711_10062348 3300025941 Bacteria 3216
280 Ga0207689_10080421 3300025942 Unclassified 2679
281 Ga0207689_10157668 3300025942 Unclassified 1871
282 Ga0207689_10215776 3300025942 Unclassified 1585
283 Ga0207661_10026442 3300025944 Bacteria 4422
284 Ga0207661_10067754 3300025944 Bacteria 2904
285 Ga0207679_10029941 3300025945 Bacteria 3795
286 Ga0207679_10081531 3300025945 Bacteria 2474
287 Ga0207679_10297156 3300025945 Bacteria 1390
288 Ga0207651_10023882 3300025960 Unclassified 3770
289 Ga0207712_10094156 3300025961 Bacteria 2212
290 Ga0207712_10107638 3300025961 Bacteria 2085
291 Ga0207668_10134857 3300025972 Bacteria 1890
292 Ga0207668_10304786 3300025972 Bacteria 1316
293 Ga0207640_10025301 3300025981 Unclassified 3591
294 Ga0207677_10001604 3300026023 Bacteria 11997
295 Ga0207677_10052394 3300026023 Bacteria 2772
296 Ga0207703_10108037 3300026035 Bacteria 2369
297 Ga0207703_10203766 3300026035 Unclassified 1759
298 Ga0207639_10271170 3300026041 Unclassified 1488
299 Ga0207639_10311295 3300026041 Unclassified 1395
300 Ga0207678_10022573 3300026067 Bacteria 5511
301 Ga0207678_10028328 3300026067 Bacteria 4890
302 Ga0207708_10007651 3300026075 Bacteria 7994
303 Ga0207708_10059417 3300026075 Bacteria 2918
304 Ga0207702_10497361 3300026078 Bacteria 1188
305 Ga0207641_10057106 3300026088 Bacteria 3319
306 Ga0207641_10090785 3300026088 Bacteria 2672
307 Ga0207648_10004910 3300026089 Bacteria 13618
308 Ga0207648_10036274 3300026089 Unclassified 4343
309 Ga0207648_10285292 3300026089 Bacteria 1477
310 Ga0207648_10336561 3300026089 Unclassified 1358
311 Ga0207676_10121813 3300026095 Bacteria 2201
312 Ga0207674_10190532 3300026116 Unclassified 2000
313 Ga0207675_100068390 3300026118 Bacteria 3319
314 Ga0207683_10004455 3300026121 Bacteria 12093
315 Ga0207683_10080662 3300026121 Bacteria 2887
316 Ga0207698_10000750 3300026142 Bacteria 18830
317 Ga0207698_10111371 3300026142 Bacteria 2295
318 Ga0207698_10410870 3300026142 Bacteria 1296
319 Ga0209974_10005901 3300027876 Unclassified 4293
320 Ga0209974_10051193 3300027876 Unclassified 1388
321 Ga0207428_10079547 3300027907 Bacteria 2563
322 Ga0207428_10145004 3300027907 Bacteria 1810
323 Ga0268266_10206755 3300028379 Bacteria 1799
324 Ga0268265_10093854 3300028380 Bacteria 2405
325 Ga0268265_10284179 3300028380 Bacteria 1482
326 Ga0268264_10183826 3300028381 Bacteria 1900
327 Ga0268264_10246670 3300028381 Bacteria 1657
328 Ga0268264_10291701 3300028381 Unclassified 1532
329 Ga0265340_10086705 3300031247 Bacteria 1468
330 Ga0373943_0068546 3300035170 Bacteria 1791
331 Ga0373962_0034826 3300035242 Unclassified 1396
332 Ga0373931_0038306 3300035691 Unclassified 2507
333 Ga0373935_0066408 3300035692 Bacteria 2317
334 Ga0373927_0005078 3300035695 Bacteria 9106
335 Ga0373927_0011105 3300035695 Bacteria 5998
336 Ga0373947_0009605 3300035725 Bacteria 5552
337 Ga0373947_0010903 3300035725 Bacteria 5218
338 Ga0373947_0066747 3300035725 Bacteria 2196
339 Ga0373947_0142345 3300035725 Unclassified 1539
340 Ga0373925_0029228 3300037068 Bacteria 4043
341 Ga0373925_0072150 3300037068 Bacteria 2612
342 Ga0373925_0131236 3300037068 Bacteria 1953
343 Ga0395900_0026563 3300037418 Bacteria 5928
344 Ga0395900_0246179 3300037418 Unclassified 1791
345 Ga0395901_0044788 3300038443 Bacteria 4589
346 Ga0395901_0416420 3300038443 Unclassified 1378
347 Ga0395901_0417977 3300038443 Unclassified 1375
348 Ga0451853_3005422 3300041512 Bacteria 1161
349 Ga0439435_0011706 3300042436 Bacteria 2109
350 Ga0439460_0006340 3300042461 Bacteria 2931
351 Ga0453683_0019016 3300044673 Bacteria 4405
352 Ga0453683_0205637 3300044673 Bacteria 1250
353 Ga0453684_0544009 3300044712 Bacteria 1280
354 Ga0453684_0848143 3300044712 Unclassified 982
355 Ga0451576_0374365 3300045051 Bacteria 1492
356 Ga0495641_0048249 3300046461 Bacteria 1953
357 Ga0495580_0022976 3300046472 Bacteria 4586
358 Ga0495580_0099002 3300046472 Bacteria 2028
359 Ga0495639_0017666 3300046475 Bacteria 3099
360 Ga0495662_0068871 3300046476 Bacteria 1714
361 Ga0495585_0062187 3300046492 Bacteria 2051
362 Ga0495606_0001396 3300046507 Bacteria 32606
363 Ga0495630_0205035 3300046517 Unclassified 1505
364 Ga0495598_0002046 3300046537 Bacteria 4107
365 Ga0495669_0016054 3300046684 Bacteria 3206
366 Ga0495624_0008421 3300046690 Bacteria 7190
367 Ga0495624_0041352 3300046690 Bacteria 2949
368 Ga0495670_0066805 3300046691 Bacteria 1815
369 Ga0495676_0020199 3300047321 Bacteria 5850
370 Ga0495684_0003025 3300047471 Bacteria 13231
371 Ga0495593_0102649 3300047673 Bacteria 1466
372 Ga0496100_0090671 3300048903 Bacteria 2085
373 Ga0496100_0149206 3300048903 Bacteria 1665
374 Ga0496101_0046196 3300048904 Bacteria 3122
375 Ga0496101_0094846 3300048904 Bacteria 2225
376 Ga0496101_0298248 3300048904 Unclassified 1262
377 Ga0496102_0018006 3300048905 Bacteria 6200
378 Ga0496102_0019575 3300048905 Bacteria 5962
379 Ga0496103_0033571 3300048906 Bacteria 3135
380 Ga0496104_0009159 3300048907 Bacteria 8804
381 Ga0496104_0017169 3300048907 Bacteria 6583
382 Ga0496104_0092211 3300048907 Bacteria 2896
383 Ga0496104_0119037 3300048907 Unclassified 2536
384 Ga0496104_0155905 3300048907 Bacteria 2191
385 Ga0496105_0006955 3300048908 Bacteria 8715
386 Ga0496105_0015982 3300048908 Bacteria 5986
387 Ga0496105_0030943 3300048908 Bacteria 4387
388 Ga0496106_0004487 3300048909 Bacteria 10355
389 Ga0496106_0008307 3300048909 Bacteria 7682
390 Ga0496107_0010967 3300048910 Bacteria 6305
391 Ga0496107_0168194 3300048910 Bacteria 1626
392 Ga0496108_0002119 3300048911 Bacteria 15901
393 Ga0496108_0005575 3300048911 Bacteria 10182
394 Ga0496108_0066321 3300048911 Bacteria 3043
395 Ga0496108_0098865 3300048911 Bacteria 2487
396 Ga0496109_0006677 3300048912 Bacteria 9712
397 Ga0496109_0007668 3300048912 Bacteria 9150
398 Ga0496109_0021108 3300048912 Bacteria 5758
399 Ga0496109_0025261 3300048912 Bacteria 5291
400 Ga0496110_0006575 3300048913 Bacteria 9231
401 Ga0496110_0019123 3300048913 Bacteria 5757
402 Ga0496110_0036576 3300048913 Bacteria 4263
403 Ga0496110_0205733 3300048913 Unclassified 1789
404 Ga0496110_0321676 3300048913 Bacteria 1409
405 Ga0496111_0158837 3300048914 Bacteria 1678
406 Ga0496112_0041597 3300048915 Unclassified 4497
407 Ga0496112_0110169 3300048915 Bacteria 2723
408 Ga0496112_0116727 3300048915 Bacteria 2639
409 Ga0496112_0153558 3300048915 Bacteria 2269
410 Ga0496112_0452644 3300048915 Bacteria 1221
411 Ga0496113_0009570 3300048916 Bacteria 6359
412 Ga0496113_0082100 3300048916 Bacteria 2471
413 Ga0496113_0138544 3300048916 Bacteria 1913
414 Ga0496114_0125807 3300048917 Bacteria 2209
415 Ga0496114_0127396 3300048917 Bacteria 2196
416 Ga0496115_0001125 3300048918 Bacteria 19279
417 Ga0496115_0002974 3300048918 Bacteria 12180
418 Ga0496115_0048517 3300048918 Bacteria 3397
419 Ga0496115_0142483 3300048918 Unclassified 1978
420 Ga0501036_0026612 3300049572 Bacteria 4885
421 Ga0501037_0291963 3300049573 Bacteria 1134
422 Ga0501038_0051759 3300049574 Bacteria 3542
423 Ga0501038_0337199 3300049574 Bacteria 1176
424 Ga0501039_0007898 3300049575 Bacteria 8107
425 Ga0501040_0005464 3300049576 Bacteria 8221
426 Ga0501040_0007434 3300049576 Bacteria 7093
427 Ga0501040_0232326 3300049576 Bacteria 1313
428 Ga0501041_0017265 3300049577 Bacteria 4294
429 Ga0501041_0258631 3300049577 Bacteria 1094
430 Ga0501042_0004671 3300049578 Bacteria 8738
431 Ga0501042_0016271 3300049578 Bacteria 5104
432 Ga0501043_0218220 3300049579 Bacteria 1476
433 Ga0501046_0008330 3300049580 Bacteria 9045
434 Ga0501048_0021912 3300049582 Bacteria 4676
435 Ga0501048_0154840 3300049582 Bacteria 1621
436 Ga0501068_0098954 3300049584 Bacteria 1806
437 Ga0501071_0033382 3300049587 Bacteria 3656
438 Ga0501071_0202135 3300049587 Bacteria 1493
439 Ga0501072_0001508 3300049588 Bacteria 17439
440 Ga0501072_0254815 3300049588 Unclassified 1397
441 Ga0501074_0173093 3300049590 Bacteria 1541
442 Ga0501075_0025959 3300049591 Bacteria 4307
443 Ga0501075_0201663 3300049591 Unclassified 1517
444 Ga0501075_0208711 3300049591 Bacteria 1490
445 Ga0501075_0214112 3300049591 Bacteria 1469
446 Ga0501076_0001932 3300049592 Bacteria 14147
447 Ga0501076_0022490 3300049592 Bacteria 4844
448 Ga0501076_0123930 3300049592 Unclassified 2093
449 Ga0501077_0030834 3300049593 Bacteria 3412
450 Ga0501077_0032427 3300049593 Bacteria 3325
451 Ga0501079_0013619 3300049741 Bacteria 6202
452 Ga0501080_0034571 3300049742 Bacteria 4720
453 Ga0501080_0224615 3300049742 Bacteria 1718
454 Ga0501081_0003945 3300049743 Bacteria 9505
455 Ga0501083_0040335 3300049744 Bacteria 3169
456 Ga0501045_0006496 3300049824 Bacteria 8103
457 Ga0501045_0269430 3300049824 Bacteria 1268
458 nmdc:mga05p37_14995_c1 3300050507 Bacteria 9303
459 nmdc:mga05p37_16831_c1 3300050507 Bacteria 8814
460 nmdc:mga05p37_256789_c1 3300050507 Bacteria 2094
461 nmdc:mga05p37_266949_c1 3300050507 Bacteria 2046
462 nmdc:mga05p37_564880_c1 3300050507 Bacteria 1292
463 nmdc:mga05p37_6993_c1 3300050507 Bacteria 13297
464 nmdc:mga05p37_93420_c1 3300050507 Bacteria 3707
465 nmdc:mga0qj67_61093_c1 3300050509 Bacteria 2991
466 nmdc:mga08y16_249810_c1 3300050511 Bacteria 1833
467 nmdc:mga08y16_53230_c1 3300050511 Bacteria 4233
468 nmdc:mga0n895_15377_c1 3300050512 Bacteria 6974
469 nmdc:mga0n895_17696_c1 3300050512 Bacteria 6576
470 nmdc:mga0n895_2236_c1 3300050512 Bacteria 14980
471 nmdc:mga0n895_265426_c1 3300050512 Unclassified 1742
472 nmdc:mga0n895_335390_c1 3300050512 Bacteria 1532
473 nmdc:mga0n895_64971_c1 3300050512 Bacteria 3611
474 nmdc:mga0n895_89969_c1 3300050512 Bacteria 3070
475 nmdc:mga0rr50_175265_c1 3300050513 Bacteria 1750
476 nmdc:mga0rr50_20286_c1 3300050513 Bacteria 4509
477 nmdc:mga0rr50_29567_c1 3300050513 Unclassified 3867
478 nmdc:mga0rr50_79623_c1 3300050513 Unclassified 2524
479 nmdc:mga0rr50_8265_c1 3300050513 Bacteria 6470
480 nmdc:mga08x19_116697_c2 3300050514 Unclassified 1019
481 nmdc:mga08x19_22774_c1 3300050514 Bacteria 3881
482 nmdc:mga08x19_909_c1 3300050514 Bacteria 18709
483 nmdc:mga0a205_140654_c1 3300050515 Bacteria 2314
484 nmdc:mga0a205_147359_c1 3300050515 Bacteria 2254
485 nmdc:mga0a205_19887_c1 3300050515 Bacteria 6334
486 nmdc:mga0a205_3164_c3 3300050515 Bacteria 7463
487 nmdc:mga0a205_3444_c1 3300050515 Bacteria 14124
488 nmdc:mga0a205_439239_c1 3300050515 Bacteria 1166
489 nmdc:mga0a205_50831_c1 3300050515 Bacteria 4002
490 Ga0495601_0263447 3300053077 Unclassified 1125
491 Ga0501084_0146020 3300054114 Bacteria 1992
492 Ga0501084_0305236 3300054114 Bacteria 1344
493 Ga0501082_0009558 3300060353 Bacteria 8345
494 Ga0501082_0023150 3300060353 Bacteria 5357
495 Ga0530510_0000056 3300061734 Bacteria 54243
496 Ga0530510_0016154 3300061734 Bacteria 5279
497 Ga0530510_0249221 3300061734 Unclassified 1323
498 Ga0530510_0274473 3300061734 Bacteria 1258
499 Ga0070699_100012473
500 JGI24743J22301_10022811
501 Ga0065712_10009335
502 Ga0065715_10096854
503 Ga0065715_10151766
504 Ga0065707_10012033
505 Ga0070658_10049738
506 Ga0070658_10123141
507 Ga0070676_10076004
508 Ga0070676_10103382
509 Ga0070683_100057580
510 Ga0070670_100010466
511 Ga0070670_100013018
512 Ga0070670_100126036
513 Ga0070666_10068355
514 Ga0070666_10166629
515 Ga0070680_100025415
516 Ga0070680_100134104
517 Ga0070682_100121133
518 Ga0068868_100000464
519 Ga0068868_100006688
520 Ga0068868_100071224
521 Ga0070660_100008947
522 Ga0070660_100140041
523 Ga0070691_10036027
524 Ga0070691_10051380
525 Ga0070687_100027721
526 Ga0070661_100001620
527 Ga0070661_100009464
528 Ga0070661_100265764
529 Ga0070692_10074964
530 Ga0070668_100041834
531 Ga0070675_100000914
532 Ga0070675_100137441
533 Ga0070671_100001694
534 Ga0070671_100197536
535 Ga0070674_100053474
536 Ga0070673_100019865
537 Ga0070673_100120079
538 Ga0070673_100242367
539 Ga0070688_100167009
540 Ga0070659_100031961
541 Ga0070659_100229762
542 Ga0070714_100086810
543 Ga0070713_100063851
544 Ga0070711_100086074
545 Ga0070711_100140985
546 Ga0070705_100084722
547 Ga0070705_100192802
548 Ga0070700_100076080
549 Ga0070700_100087888
550 Ga0070694_100104704
551 Ga0070694_100169643
552 Ga0070708_100009399
553 Ga0070708_100072909
554 Ga0070708_100073486
555 Ga0070708_100105326
556 Ga0070708_100229319
557 Ga0070708_100256392
558 Ga0070663_100012044
559 Ga0070663_100041607
560 Ga0070678_100002846
561 Ga0070678_100018249
562 Ga0070662_100004132
563 Ga0070662_100137325
564 Ga0070681_10026610
565 Ga0070681_10095031
566 Ga0068867_100024594
567 Ga0068867_100092471
568 Ga0068867_100275672
569 Ga0070685_10059578
570 Ga0070685_10088150
571 Ga0070706_100050650
572 Ga0070706_100062295
573 Ga0070706_100100766
574 Ga0070706_100112060
575 Ga0070706_100168133
576 Ga0070706_100361591
577 Ga0070707_100016174
578 Ga0070707_100377325
579 Ga0070707_100416002
580 Ga0070707_100459149
581 Ga0070698_100036911
582 Ga0070698_100061740
583 Ga0070698_100100662
584 Ga0070698_100122535
585 Ga0070698_100153560
586 Ga0070698_100261267
587 Ga0070698_100289465
588 Ga0070699_100004984
589 Ga0070699_100040741
590 Ga0070699_100056628
591 Ga0070699_100241832
592 Ga0070684_100002416
593 Ga0070684_100036391
594 Ga0070684_100197496
595 Ga0070697_100065536
596 Ga0070697_100145368
597 Ga0070697_100155935
598 Ga0070697_100327288
599 Ga0068853_100001972
600 Ga0068853_100152134
601 Ga0068853_100337003
602 Ga0070672_100004031
603 Ga0070672_100222752
604 Ga0070672_100266548
605 Ga0070686_100095772
606 Ga0070665_100080072
607 Ga0070665_100333934
608 Ga0070704_100115535
609 Ga0068855_100335717
610 Ga0070664_100002897
611 Ga0070664_100010803
612 Ga0070664_100062533
613 Ga0070664_100103957
614 Ga0068854_100033590
615 Ga0070702_100005470
616 Ga0070702_100167743
617 Ga0068852_100020825
618 Ga0068852_100036107
619 Ga0068852_100181195
620 Ga0068859_100032449
621 Ga0068859_100127794
622 Ga0068864_100005459
623 Ga0068864_100087514
624 Ga0068864_100121660
625 Ga0068866_10012408
626 Ga0068866_10053506
627 Ga0068861_100066615
628 Ga0068851_10005392
629 Ga0068870_10033216
630 Ga0068863_100011676
631 Ga0068863_100062596
632 Ga0068863_100108120
633 Ga0068863_100279415
634 Ga0068858_100066971
635 Ga0068860_100042471
636 Ga0068860_100309941
637 Ga0068862_100030378
638 Ga0068862_100120619
639 Ga0068862_100285880
640 Ga0068862_100374507
641 Ga0081455_10007012
642 Ga0070712_100168494
643 Ga0097621_100071215
644 Ga0097621_100174845
645 Ga0097621_100227175
646 Ga0068871_100023164
647 Ga0068871_100059036
648 Ga0068871_100166267
649 Ga0075428_100015050
650 Ga0075428_100056893
651 Ga0075428_100128020
652 Ga0075431_100071204
653 Ga0075433_10002863
654 Ga0075433_10004407
655 Ga0075433_10009494
656 Ga0075433_10059862
657 Ga0075433_10293492
658 Ga0075434_100020106
659 Ga0075434_100027051
660 Ga0075434_100027160
661 Ga0075434_100045409
662 Ga0075434_100623470
663 Ga0068865_100010590
664 Ga0075436_100002622
665 Ga0075436_100005391
666 Ga0097620_100032449
667 Ga0097620_100127794
668 Ga0075435_100017717
669 Ga0075435_100028790
670 Ga0075435_100188029
671 Ga0111539_10007722
672 Ga0111539_10043661
673 Ga0111539_10159762
674 Ga0111539_10165384
675 Ga0111539_10167763
676 Ga0105245_10055899
677 Ga0105245_10493886
678 Ga0105247_10189726
679 Ga0114129_10045318
680 Ga0114129_10064768
681 Ga0114129_10096765
682 Ga0114129_10300646
683 Ga0114129_10579573
684 Ga0114129_10647160
685 Ga0114129_10720138
686 Ga0105243_10025482
687 Ga0105243_10041858
688 Ga0105242_10126103
689 Ga0105242_10182732
690 Ga0105242_10290129
691 Ga0105248_10346900
692 Ga0105238_10002194
693 Ga0105249_10023992
694 Ga0105249_10256992
695 Ga0105239_10030539
696 Ga0105239_10195787
697 Ga0105246_10028819
698 Ga0105246_10190303
699 Ga0105246_10229066
700 Ga0157370_10207639
701 Ga0157369_10002885
702 Ga0157374_10001949
703 Ga0157374_10010686
704 Ga0157374_10036731
705 Ga0157378_10001981
706 Ga0157378_10125604
707 Ga0163162_10021332
708 Ga0163162_10046552
709 Ga0163162_10187452
710 Ga0163162_10294892
711 Ga0163162_10421322
712 Ga0163162_10490886
713 Ga0157375_10001986
714 Ga0157375_10009637
715 Ga0157375_10200031
716 Ga0163163_10006633
717 Ga0163163_10128040
718 Ga0163163_10417139
719 Ga0157380_10096630
720 Ga0157377_10058718
721 Ga0157377_10107230
722 Ga0157379_10044185
723 Ga0157376_10004716
724 Ga0157376_10032891
725 Ga0157376_10277150
726 Ga0207697_10005581
727 Ga0207697_10034626
728 Ga0207697_10050958
729 Ga0207697_10065376
730 Ga0207682_10001423
731 Ga0207710_10013383
732 Ga0207688_10002805
733 Ga0207688_10042191
734 Ga0207680_10212273
735 Ga0207645_10099581
736 Ga0207643_10009956
737 Ga0207643_10163517
738 Ga0207705_10088644
739 Ga0207684_10017739
740 Ga0207684_10042362
741 Ga0207684_10056371
742 Ga0207684_10090844
743 Ga0207684_10099524
744 Ga0207684_10245945
745 Ga0207684_10270156
746 Ga0207707_10007711
747 Ga0207695_10019152
748 Ga0207693_10108591
749 Ga0207693_10204581
750 Ga0207660_10099434
751 Ga0207649_10002056
752 Ga0207649_10041139
753 Ga0207649_10265629
754 Ga0207646_10009572
755 Ga0207646_10318453
756 Ga0207646_10338450
757 Ga0207650_10001095
758 Ga0207659_10000875
759 Ga0207659_10084020
760 Ga0207687_10404189
761 Ga0207700_10050662
762 Ga0207700_10239445
763 Ga0207644_10000147
764 Ga0207644_10196202
765 Ga0207690_10076439
766 Ga0207686_10140923
767 Ga0207709_10034675
768 Ga0207709_10063813
769 Ga0207709_10109109
770 Ga0207670_10041969
771 Ga0207704_10052007
772 Ga0207704_10069168
773 Ga0207704_10262845
774 Ga0207691_10000123
775 Ga0207691_10100190
776 Ga0207691_10153105
777 Ga0207711_10062348
778 Ga0207689_10080421
779 Ga0207689_10157668
780 Ga0207689_10215776
781 Ga0207661_10026442
782 Ga0207661_10067754
783 Ga0207679_10029941
784 Ga0207679_10081531
785 Ga0207679_10297156
786 Ga0207651_10023882
787 Ga0207712_10094156
788 Ga0207712_10107638
789 Ga0207668_10134857
790 Ga0207668_10304786
791 Ga0207640_10025301
792 Ga0207677_10001604
793 Ga0207677_10052394
794 Ga0207703_10108037
795 Ga0207703_10203766
796 Ga0207639_10271170
797 Ga0207639_10311295
798 Ga0207678_10022573
799 Ga0207678_10028328
800 Ga0207708_10007651
801 Ga0207708_10059417
802 Ga0207702_10497361
803 Ga0207641_10057106
804 Ga0207641_10090785
805 Ga0207648_10004910
806 Ga0207648_10036274
807 Ga0207648_10285292
808 Ga0207648_10336561
809 Ga0207676_10121813
810 Ga0207674_10190532
811 Ga0207675_100068390
812 Ga0207683_10004455
813 Ga0207683_10080662
814 Ga0207698_10000750
815 Ga0207698_10111371
816 Ga0207698_10410870
817 Ga0209974_10005901
818 Ga0209974_10051193
819 Ga0207428_10079547
820 Ga0207428_10145004
821 Ga0268266_10206755
822 Ga0268265_10093854
823 Ga0268265_10284179
824 Ga0268264_10183826
825 Ga0268264_10246670
826 Ga0268264_10291701
827 Ga0265340_10086705
828 Ga0373943_0068546
829 Ga0373962_0034826
830 Ga0373931_0038306
831 Ga0373935_0066408
832 Ga0373927_0005078
833 Ga0373927_0011105
834 Ga0373947_0009605
835 Ga0373947_0010903
836 Ga0373947_0066747
837 Ga0373947_0142345
838 Ga0373925_0029228
839 Ga0373925_0072150
840 Ga0373925_0131236
841 Ga0395900_0026563
842 Ga0395900_0246179
843 Ga0395901_0044788
844 Ga0395901_0416420
845 Ga0395901_0417977
846 Ga0451853_3005422
847 Ga0439435_0011706
848 Ga0439460_0006340
849 Ga0453683_0019016
850 Ga0453683_0205637
851 Ga0453684_0544009
852 Ga0453684_0848143
853 Ga0451576_0374365
854 Ga0495641_0048249
855 Ga0495580_0022976
856 Ga0495580_0099002
857 Ga0495639_0017666
858 Ga0495662_0068871
859 Ga0495585_0062187
860 Ga0495606_0001396
861 Ga0495630_0205035
862 Ga0495598_0002046
863 Ga0495669_0016054
864 Ga0495624_0008421
865 Ga0495624_0041352
866 Ga0495670_0066805
867 Ga0495676_0020199
868 Ga0495684_0003025
869 Ga0495593_0102649
870 Ga0496100_0090671
871 Ga0496100_0149206
872 Ga0496101_0046196
873 Ga0496101_0094846
874 Ga0496101_0298248
875 Ga0496102_0018006
876 Ga0496102_0019575
877 Ga0496103_0033571
878 Ga0496104_0009159
879 Ga0496104_0017169
880 Ga0496104_0092211
881 Ga0496104_0119037
882 Ga0496104_0155905
883 Ga0496105_0006955
884 Ga0496105_0015982
885 Ga0496105_0030943
886 Ga0496106_0004487
887 Ga0496106_0008307
888 Ga0496107_0010967
889 Ga0496107_0168194
890 Ga0496108_0002119
891 Ga0496108_0005575
892 Ga0496108_0066321
893 Ga0496108_0098865
894 Ga0496109_0006677
895 Ga0496109_0007668
896 Ga0496109_0021108
897 Ga0496109_0025261
898 Ga0496110_0006575
899 Ga0496110_0019123
900 Ga0496110_0036576
901 Ga0496110_0205733
902 Ga0496110_0321676
903 Ga0496111_0158837
904 Ga0496112_0041597
905 Ga0496112_0110169
906 Ga0496112_0116727
907 Ga0496112_0153558
908 Ga0496112_0452644
909 Ga0496113_0009570
910 Ga0496113_0082100
911 Ga0496113_0138544
912 Ga0496114_0125807
913 Ga0496114_0127396
914 Ga0496115_0001125
915 Ga0496115_0002974
916 Ga0496115_0048517
917 Ga0496115_0142483
918 Ga0501036_0026612
919 Ga0501037_0291963
920 Ga0501038_0051759
921 Ga0501038_0337199
922 Ga0501039_0007898
923 Ga0501040_0005464
924 Ga0501040_0007434
925 Ga0501040_0232326
926 Ga0501041_0017265
927 Ga0501041_0258631
928 Ga0501042_0004671
929 Ga0501042_0016271
930 Ga0501043_0218220
931 Ga0501046_0008330
932 Ga0501048_0021912
933 Ga0501048_0154840
934 Ga0501068_0098954
935 Ga0501071_0033382
936 Ga0501071_0202135
937 Ga0501072_0001508
938 Ga0501072_0254815
939 Ga0501074_0173093
940 Ga0501075_0025959
941 Ga0501075_0201663
942 Ga0501075_0208711
943 Ga0501075_0214112
944 Ga0501076_0001932
945 Ga0501076_0022490
946 Ga0501076_0123930
947 Ga0501077_0030834
948 Ga0501077_0032427
949 Ga0501079_0013619
950 Ga0501080_0034571
951 Ga0501080_0224615
952 Ga0501081_0003945
953 Ga0501083_0040335
954 Ga0501045_0006496
955 Ga0501045_0269430
956 nmdc:mga05p37_14995_c1
957 nmdc:mga05p37_16831_c1
958 nmdc:mga05p37_256789_c1
959 nmdc:mga05p37_266949_c1
960 nmdc:mga05p37_564880_c1
961 nmdc:mga05p37_6993_c1
962 nmdc:mga05p37_93420_c1
963 nmdc:mga0qj67_61093_c1
964 nmdc:mga08y16_249810_c1
965 nmdc:mga08y16_53230_c1
966 nmdc:mga0n895_15377_c1
967 nmdc:mga0n895_17696_c1
968 nmdc:mga0n895_2236_c1
969 nmdc:mga0n895_265426_c1
970 nmdc:mga0n895_335390_c1
971 nmdc:mga0n895_64971_c1
972 nmdc:mga0n895_89969_c1
973 nmdc:mga0rr50_175265_c1
974 nmdc:mga0rr50_20286_c1
975 nmdc:mga0rr50_29567_c1
976 nmdc:mga0rr50_79623_c1
977 nmdc:mga0rr50_8265_c1
978 nmdc:mga08x19_116697_c2
979 nmdc:mga08x19_22774_c1
980 nmdc:mga08x19_909_c1
981 nmdc:mga0a205_140654_c1
982 nmdc:mga0a205_147359_c1
983 nmdc:mga0a205_19887_c1
984 nmdc:mga0a205_3164_c3
985 nmdc:mga0a205_3444_c1
986 nmdc:mga0a205_439239_c1
987 nmdc:mga0a205_50831_c1
988 Ga0495601_0263447
989 Ga0501084_0146020
990 Ga0501084_0305236
991 Ga0501082_0009558
992 Ga0501082_0023150
993 Ga0530510_0000056
994 Ga0530510_0016154
995 Ga0530510_0249221
996 Ga0530510_0274473

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04392

ABC_sub_bind

ABC transporter substrate binding protein

91

369

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lft-assembly1.cif.gz_A the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.9313 28 325
3lkv-assembly1.cif.gz_A-2 crystal structure of conserved domain protein from vibrio cholerae o1 biovar eltor str. n16961 0.9282 28 324
3lft-assembly1.cif.gz_A the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.9252 28 325
3lft-assembly2.cif.gz_B the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.9197 31 325
3lkv-assembly1.cif.gz_A-2 crystal structure of conserved domain protein from vibrio cholerae o1 biovar eltor str. n16961 0.9192 28 324
ID Description Score Start End Superfamily
3lftA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.901 148 325 3.40.50.2300
3lftA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8835 148 325 3.40.50.2300
3lkvA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8611 148 324 3.40.50.2300
3lftB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8555 31 141 3.40.50.2300
af_P02924_26_131_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8502 164 250 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A537NV14-F1-model_v4 ABC transporter substrate-binding protein 0.9609 62 326
AF-A0A537NV14-F1-model_v4 ABC transporter substrate-binding protein 0.9539 62 326
AF-A0A536Z1U0-F1-model_v4 ABC transporter substrate-binding protein 0.9513 149 326
AF-A0A023XKA0-F1-model_v4 deleted 0.9511 165 326
AF-A0A0F5MQA4-F1-model_v4 ABC transporter substrate binding protein 0.9469 132 324

Map