F455154

General Info

Members Datasets Scaffolds Average Seq Length
498 228 996 151

Family's Representative Sequence

Representative Sequence 3300005444|Ga0070694_100215108|Ga0070694_1002151081
Length 170
Sequence MSQQPEVPEALPSLATVERPAAPLSTQRRRAWASLRSALRSVRNWQELGKFCAVGAVGYLINLAVYDALLHEDVHYLVAATCSFLVAVTSNYTWNRLWTFREHRGHVGIQGMRFFLVSLAALGANLVVLHLLIAYGNLGKLPAQAAAIVLVTPLNFVGNKLWSFRRARAE

Samples

Sample ID Description Type Environment
1 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
60 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
88 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
89 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
90 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
91 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
92 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
93 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
94 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
95 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
96 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
97 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
98 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
99 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
100 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
101 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
102 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
103 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
104 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
105 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
106 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
107 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
108 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
109 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
110 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
111 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
112 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
113 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
114 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
115 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
116 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
117 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
118 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
119 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
120 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
121 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
122 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
124 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
125 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
126 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
127 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
128 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
129 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
130 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
131 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
132 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
133 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
134 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
135 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
136 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
137 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
138 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
139 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
140 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
141 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
142 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
143 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
144 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
145 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
146 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
147 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
148 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
149 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
150 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
151 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
152 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
153 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
154 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
155 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
156 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
157 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
158 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
159 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
160 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
161 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
162 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
163 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
164 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
165 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
166 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
167 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
168 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
169 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
170 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
171 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
172 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
173 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
174 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
175 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
176 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
177 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
178 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
179 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
180 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
181 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
182 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
183 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
184 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
185 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
186 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
187 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
188 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
189 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
190 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
191 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
192 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
193 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
194 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
195 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
196 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
197 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
198 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
199 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
200 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
201 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
202 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
203 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
204 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
205 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
206 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
207 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
208 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
209 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
210 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
211 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
212 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
213 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
214 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
215 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
216 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
217 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
218 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
219 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
220 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
221 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
222 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
223 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
224 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
225 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
226 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
227 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
228 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.6
Metatranscriptomes 0.4
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.2
Nodule 0
Rhizoplane 10.24
Rhizosphere 88.96
Stem 0
Stem Tuber 0
Unclassified 13.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070694_100215108 3300005444 Bacteria 1439
2 Ga0070658_10073052 3300005327 Bacteria 2812
3 Ga0070658_10545749 3300005327 Bacteria 1003
4 Ga0070683_100032332 3300005329 Bacteria 4764
5 Ga0070680_100052873 3300005336 Bacteria 3314
6 Ga0070680_100271506 3300005336 Unclassified 1436
7 Ga0070682_100408700 3300005337 Bacteria 1028
8 Ga0068868_101009031 3300005338 Bacteria 762
9 Ga0070660_100060390 3300005339 Bacteria 2942
10 Ga0070691_10222066 3300005341 Bacteria 1002
11 Ga0070661_100226796 3300005344 Bacteria 1434
12 Ga0070692_10126984 3300005345 Bacteria 1429
13 Ga0070659_100106204 3300005366 Bacteria 2263
14 Ga0070709_10063574 3300005434 Bacteria 2358
15 Ga0070714_100047617 3300005435 Bacteria 3643
16 Ga0070714_100058552 3300005435 Bacteria 3301
17 Ga0070713_100095446 3300005436 Bacteria 2565
18 Ga0070713_100386380 3300005436 Bacteria 1305
19 Ga0070713_100898513 3300005436 Bacteria 852
20 Ga0070710_10023799 3300005437 Bacteria 3223
21 Ga0070710_10168443 3300005437 Unclassified 1363
22 Ga0070710_10979374 3300005437 Bacteria 615
23 Ga0070711_100058118 3300005439 Unclassified 2680
24 Ga0070711_100073167 3300005439 Bacteria 2420
25 Ga0070681_10295321 3300005458 Bacteria 1530
26 Ga0070707_100028397 3300005468 Bacteria 5325
27 Ga0070707_100600715 3300005468 Unclassified 1063
28 Ga0070707_100865522 3300005468 Bacteria 868
29 Ga0070698_100112715 3300005471 Bacteria 2684
30 Ga0070679_100124671 3300005530 Bacteria 2559
31 Ga0070679_100125813 3300005530 Bacteria 2545
32 Ga0070684_100098276 3300005535 Bacteria 2611
33 Ga0068853_100454452 3300005539 Bacteria 1205
34 Ga0070672_100952261 3300005543 Bacteria 760
35 Ga0070695_100000001 3300005545 Bacteria 150757
36 Ga0070696_100155828 3300005546 Bacteria 1680
37 Ga0070704_100549191 3300005549 Bacteria 1009
38 Ga0070704_100615189 3300005549 Unclassified 956
39 Ga0068855_100080252 3300005563 Bacteria 3783
40 Ga0070664_100625403 3300005564 Bacteria 1000
41 Ga0068857_100805753 3300005577 Bacteria 897
42 Ga0068856_100049321 3300005614 Bacteria 4150
43 Ga0068856_100398858 3300005614 Unclassified 1395
44 Ga0070702_100053155 3300005615 Bacteria 2326
45 Ga0068852_100154431 3300005616 Bacteria 2137
46 Ga0068863_100587280 3300005841 Bacteria 1102
47 Ga0081455_10026432 3300005937 Bacteria 5337
48 Ga0070717_10001826 3300006028 Bacteria 14870
49 Ga0070717_10037895 3300006028 Bacteria 3916
50 Ga0070717_10042596 3300006028 Bacteria 3703
51 Ga0070717_10207536 3300006028 Bacteria 1718
52 Ga0070717_10501416 3300006028 Bacteria 1097
53 Ga0070716_100007978 3300006173 Bacteria 5241
54 Ga0070716_100157979 3300006173 Unclassified 1466
55 Ga0070712_100178452 3300006175 Unclassified 1653
56 Ga0097621_100078669 3300006237 Bacteria 2740
57 Ga0075434_100099867 3300006871 Bacteria 2907
58 Ga0075436_100387877 3300006914 Bacteria 1011
59 Ga0075435_100094702 3300007076 Bacteria 2469
60 Ga0105240_10015096 3300009093 Bacteria 10514
61 Ga0105240_10212956 3300009093 Bacteria 2256
62 Ga0111539_10243667 3300009094 Bacteria 2093
63 Ga0105245_10215510 3300009098 Bacteria 1850
64 Ga0105245_10318606 3300009098 Bacteria 1531
65 Ga0105247_10261138 3300009101 Unclassified 1187
66 Ga0105247_10579629 3300009101 Bacteria 829
67 Ga0105241_10865073 3300009174 Bacteria 837
68 Ga0105241_11026268 3300009174 Bacteria 773
69 Ga0105237_10073320 3300009545 Bacteria 3416
70 Ga0105237_10349798 3300009545 Bacteria 1482
71 Ga0105238_10128113 3300009551 Bacteria 2516
72 Ga0105249_10347910 3300009553 Bacteria 1501
73 Ga0105239_10452799 3300010375 Bacteria 1456
74 Ga0105239_10931866 3300010375 Bacteria 997
75 Ga0105246_10188075 3300011119 Bacteria 1596
76 Ga0157371_10290677 3300013102 Bacteria 1182
77 Ga0157369_10014610 3300013105 Bacteria 8857
78 Ga0157369_10027414 3300013105 Bacteria 6315
79 Ga0157374_10133427 3300013296 Bacteria 2405
80 Ga0157374_10678706 3300013296 Unclassified 1043
81 Ga0157374_10717968 3300013296 Bacteria 1013
82 Ga0163162_11897713 3300013306 Unclassified 682
83 Ga0157372_10130620 3300013307 Bacteria 2890
84 Ga0157372_10174810 3300013307 Bacteria 2485
85 Ga0163163_10703424 3300014325 Bacteria 1074
86 Ga0157376_10045172 3300014969 Bacteria 3625
87 Ga0163161_11712896 3300017792 Unclassified 557
88 Ga0206354_11695195 3300020081 Bacteria 689
89 Ga0224712_10132740 3300022467 Bacteria 1089
90 Ga0207692_10036914 3300025898 Bacteria 2386
91 Ga0207692_10146441 3300025898 Bacteria 1348
92 Ga0207699_10062566 3300025906 Bacteria 2244
93 Ga0207705_10095680 3300025909 Bacteria 2179
94 Ga0207695_10110028 3300025913 Bacteria 2736
95 Ga0207695_10957285 3300025913 Bacteria 736
96 Ga0207693_10001411 3300025915 Bacteria 21313
97 Ga0207693_10198951 3300025915 Unclassified 1576
98 Ga0207663_10562935 3300025916 Bacteria 892
99 Ga0207663_10766013 3300025916 Bacteria 767
100 Ga0207663_10776180 3300025916 Bacteria 762
101 Ga0207660_10177931 3300025917 Bacteria 1650
102 Ga0207657_10003323 3300025919 Bacteria 17212
103 Ga0207652_10251551 3300025921 Bacteria 1594
104 Ga0207652_11316586 3300025921 Bacteria 625
105 Ga0207646_10012880 3300025922 Bacteria 8016
106 Ga0207694_10094269 3300025924 Bacteria 2365
107 Ga0207687_10161712 3300025927 Bacteria 1719
108 Ga0207687_10893936 3300025927 Bacteria 760
109 Ga0207700_10131559 3300025928 Bacteria 2043
110 Ga0207700_10836544 3300025928 Unclassified 823
111 Ga0207700_10862137 3300025928 Unclassified 810
112 Ga0207664_10095927 3300025929 Bacteria 2441
113 Ga0207664_10140226 3300025929 Bacteria 2044
114 Ga0207664_10153654 3300025929 Bacteria 1957
115 Ga0207664_10264394 3300025929 Unclassified 1505
116 Ga0207664_10283382 3300025929 Bacteria 1454
117 Ga0207644_10653660 3300025931 Bacteria 875
118 Ga0207690_10396488 3300025932 Unclassified 1100
119 Ga0207704_10218021 3300025938 Bacteria 1409
120 Ga0207665_10000476 3300025939 Bacteria 27229
121 Ga0207661_10170303 3300025944 Bacteria 1895
122 Ga0207661_10253237 3300025944 Bacteria 1566
123 Ga0207679_10337741 3300025945 Bacteria 1309
124 Ga0207702_10038577 3300026078 Bacteria 4000
125 Ga0207641_10576973 3300026088 Bacteria 1099
126 Ga0207676_10470863 3300026095 Bacteria 1188
127 Ga0207674_10372363 3300026116 Bacteria 1380
128 Ga0268266_11716936 3300028379 Unclassified 603
129 Ga0265337_1032953 3300028556 Unclassified 1531
130 Ga0265319_1009133 3300028563 Bacteria 4253
131 Ga0265318_10003022 3300028577 Bacteria 8668
132 Ga0265323_10023272 3300028653 Bacteria 2363
133 Ga0265322_10002388 3300028654 Bacteria 5805
134 Ga0265322_10020606 3300028654 Bacteria 1889
135 Ga0265336_10025345 3300028666 Bacteria 1869
136 Ga0265338_10011536 3300028800 Bacteria 10191
137 Ga0265338_10037766 3300028800 Bacteria 4588
138 Ga0265324_10011143 3300029957 Bacteria 3437
139 Ga0265324_10130948 3300029957 Bacteria 851
140 Ga0265330_10004277 3300031235 Bacteria 7269
141 Ga0265328_10041021 3300031239 Bacteria 1704
142 Ga0265320_10026030 3300031240 Bacteria 3068
143 Ga0265325_10008930 3300031241 Bacteria 5886
144 Ga0265325_10189655 3300031241 Bacteria 953
145 Ga0265340_10022047 3300031247 Bacteria 3259
146 Ga0265339_10046748 3300031249 Bacteria 2377
147 Ga0265339_10082674 3300031249 Bacteria 1694
148 Ga0265331_10015623 3300031250 Bacteria 4003
149 Ga0265331_10096374 3300031250 Bacteria 1364
150 Ga0265327_10392196 3300031251 Bacteria 603
151 Ga0265316_10016110 3300031344 Bacteria 6500
152 Ga0265313_10080299 3300031595 Bacteria 1482
153 Ga0265314_10101547 3300031711 Bacteria 1848
154 Ga0265314_10115774 3300031711 Bacteria 1695
155 Ga0265342_10154962 3300031712 Bacteria 1270
156 Ga0373926_0009937 3300035083 Bacteria 3185
157 Ga0373934_0253426 3300035086 Unclassified 728
158 Ga0373944_0037271 3300035089 Bacteria 1489
159 Ga0373923_0176095 3300035111 Bacteria 981
160 Ga0373936_0074698 3300035113 Bacteria 1403
161 Ga0373943_0002587 3300035170 Bacteria 8227
162 Ga0373946_0092949 3300035171 Bacteria 1340
163 Ga0373955_0164356 3300035172 Bacteria 1312
164 Ga0373955_0301221 3300035172 Bacteria 967
165 Ga0373955_0574921 3300035172 Unclassified 690
166 Ga0373924_0058854 3300035410 Bacteria 1604
167 Ga0373931_0065608 3300035691 Bacteria 1968
168 Ga0373935_0045605 3300035692 Bacteria 2766
169 Ga0373927_0278405 3300035695 Bacteria 1100
170 Ga0373933_0079758 3300035724 Bacteria 2005
171 Ga0373947_0843201 3300035725 Bacteria 626
172 Ga0373937_0001601 3300036401 Bacteria 19014
173 Ga0373937_0436469 3300036401 Unclassified 1243
174 Ga0373925_0006395 3300037068 Bacteria 8672
175 Ga0395900_0433457 3300037418 Bacteria 1273
176 Ga0395898_0456613 3300037466 Bacteria 1216
177 Ga0395898_0458465 3300037466 Bacteria 1214
178 Ga0395905_0212564 3300037471 Bacteria 1812
179 Ga0395901_0036634 3300038443 Bacteria 5071
180 Ga0395901_0649074 3300038443 Bacteria 1059
181 Ga0395901_0814417 3300038443 Unclassified 922
182 Ga0451853_1108072 3300041512 Bacteria 785
183 Ga0439454_026068 3300042011 Unclassified 892
184 Ga0466969_0007964 3300044656 Bacteria 5624
185 Ga0466969_0190460 3300044656 Bacteria 937
186 Ga0466965_0104959 3300044683 Bacteria 1448
187 Ga0466965_0824020 3300044683 Unclassified 538
188 Ga0466966_0007751 3300044684 Bacteria 7112
189 Ga0466966_0111558 3300044684 Bacteria 1685
190 Ga0466966_0157294 3300044684 Unclassified 1384
191 Ga0466966_0230520 3300044684 Bacteria 1117
192 Ga0466961_0008701 3300044693 Bacteria 6470
193 Ga0466961_0022530 3300044693 Bacteria 4052
194 Ga0466961_0286122 3300044693 Bacteria 1008
195 Ga0466963_0015670 3300044694 Bacteria 4701
196 Ga0466963_0015853 3300044694 Bacteria 4677
197 Ga0466963_0016012 3300044694 Bacteria 4655
198 Ga0466963_0031182 3300044694 Bacteria 3444
199 Ga0466963_0031852 3300044694 Bacteria 3410
200 Ga0466963_0043467 3300044694 Bacteria 2954
201 Ga0466963_0046902 3300044694 Bacteria 2850
202 Ga0466963_0053345 3300044694 Bacteria 2684
203 Ga0466963_0062706 3300044694 Bacteria 2486
204 Ga0466963_0096180 3300044694 Bacteria 2022
205 Ga0466963_0141204 3300044694 Bacteria 1668
206 Ga0466963_0153742 3300044694 Bacteria 1598
207 Ga0466963_0350138 3300044694 Unclassified 1040
208 Ga0466964_0000296 3300044706 Bacteria 14594
209 Ga0466964_0007018 3300044706 Bacteria 4213
210 Ga0466964_0008795 3300044706 Bacteria 3796
211 Ga0466964_0044443 3300044706 Bacteria 1804
212 Ga0466964_0044611 3300044706 Bacteria 1801
213 Ga0466964_0061226 3300044706 Bacteria 1567
214 Ga0466964_0071941 3300044706 Bacteria 1464
215 Ga0466964_0085304 3300044706 Unclassified 1363
216 Ga0466971_0003329 3300044719 Bacteria 6863
217 Ga0466971_0008382 3300044719 Bacteria 4511
218 Ga0466971_0008578 3300044719 Bacteria 4458
219 Ga0466971_0013765 3300044719 Bacteria 3556
220 Ga0466971_0014022 3300044719 Bacteria 3523
221 Ga0466968_0007070 3300044735 Bacteria 4256
222 Ga0466968_0155305 3300044735 Bacteria 1053
223 Ga0466968_0192427 3300044735 Unclassified 952
224 Ga0466968_0441816 3300044735 Unclassified 642
225 Ga0466970_0077985 3300044765 Bacteria 1787
226 Ga0466957_0004568 3300044842 Bacteria 7733
227 Ga0466957_0005101 3300044842 Bacteria 7341
228 Ga0466957_0012737 3300044842 Bacteria 4873
229 Ga0466957_0020438 3300044842 Bacteria 3896
230 Ga0466957_0063237 3300044842 Bacteria 2274
231 Ga0466957_0064790 3300044842 Bacteria 2249
232 Ga0466957_0119182 3300044842 Bacteria 1681
233 Ga0466957_0156235 3300044842 Bacteria 1478
234 Ga0466957_0291656 3300044842 Bacteria 1094
235 Ga0466957_0756114 3300044842 Bacteria 688
236 Ga0466960_0006357 3300044901 Bacteria 4737
237 Ga0466960_0010192 3300044901 Bacteria 3899
238 Ga0466960_0969779 3300044901 Unclassified 521
239 Ga0466959_0001305 3300045049 Bacteria 15109
240 Ga0466959_0041824 3300045049 Bacteria 3382
241 Ga0466959_0068430 3300045049 Bacteria 2573
242 Ga0466959_0124104 3300045049 Unclassified 1833
243 Ga0466959_0167751 3300045049 Bacteria 1541
244 Ga0466958_0000729 3300045836 Bacteria 14379
245 Ga0466958_0002369 3300045836 Bacteria 9438
246 Ga0466958_0003200 3300045836 Bacteria 8447
247 Ga0466958_0008288 3300045836 Bacteria 5754
248 Ga0466958_0020911 3300045836 Bacteria 3819
249 Ga0466958_0044710 3300045836 Bacteria 2669
250 Ga0466958_0052585 3300045836 Bacteria 2469
251 Ga0466958_0056027 3300045836 Bacteria 2393
252 Ga0466958_0056884 3300045836 Bacteria 2377
253 Ga0466967_0000193 3300045976 Bacteria 25500
254 Ga0466967_0002242 3300045976 Bacteria 11916
255 Ga0466967_0010982 3300045976 Bacteria 6828
256 Ga0466967_0031989 3300045976 Bacteria 4437
257 Ga0466967_0042239 3300045976 Bacteria 3938
258 Ga0466967_0048944 3300045976 Bacteria 3694
259 Ga0466967_0052378 3300045976 Bacteria 3582
260 Ga0466967_0070193 3300045976 Bacteria 3133
261 Ga0466967_0074410 3300045976 Bacteria 3050
262 Ga0466967_0122822 3300045976 Bacteria 2402
263 Ga0466967_0137182 3300045976 Bacteria 2275
264 Ga0466967_0232103 3300045976 Bacteria 1757
265 Ga0466967_0299426 3300045976 Bacteria 1547
266 Ga0466967_0561954 3300045976 Unclassified 1123
267 Ga0466967_0693161 3300045976 Bacteria 1008
268 Ga0466967_1221218 3300045976 Unclassified 749
269 Ga0495592_0012025 3300046454 Bacteria 6560
270 Ga0495592_0025847 3300046454 Bacteria 4456
271 Ga0495592_0156943 3300046454 Unclassified 1569
272 Ga0495592_0344303 3300046454 Bacteria 957
273 Ga0495603_0023549 3300046455 Bacteria 3724
274 Ga0495603_0160777 3300046455 Bacteria 1303
275 Ga0495629_0008088 3300046459 Bacteria 7740
276 Ga0495629_0849556 3300046459 Bacteria 600
277 Ga0495641_0004571 3300046461 Bacteria 9703
278 Ga0495641_0027637 3300046461 Bacteria 2756
279 Ga0495641_0091005 3300046461 Bacteria 1363
280 Ga0495641_0218405 3300046461 Bacteria 855
281 Ga0495641_0305066 3300046461 Bacteria 718
282 Ga0495651_0000344 3300046462 Bacteria 35980
283 Ga0495651_0638754 3300046462 Unclassified 668
284 Ga0495653_0004353 3300046463 Bacteria 11455
285 Ga0495653_0209977 3300046463 Bacteria 1315
286 Ga0495653_0254878 3300046463 Unclassified 1163
287 Ga0495653_0312237 3300046463 Unclassified 1022
288 Ga0495653_0608526 3300046463 Bacteria 671
289 Ga0495580_0023533 3300046472 Bacteria 4521
290 Ga0495582_0014256 3300046473 Bacteria 4372
291 Ga0495582_0037842 3300046473 Bacteria 2654
292 Ga0495582_0153026 3300046473 Unclassified 1310
293 Ga0495582_0278826 3300046473 Bacteria 960
294 Ga0495639_0003535 3300046475 Bacteria 6745
295 Ga0495662_0002883 3300046476 Bacteria 8697
296 Ga0495664_0055031 3300046477 Bacteria 2367
297 Ga0495664_0089466 3300046477 Bacteria 1850
298 Ga0495664_0280546 3300046477 Bacteria 1007
299 Ga0495664_0452784 3300046477 Bacteria 768
300 Ga0495584_0010851 3300046491 Bacteria 4676
301 Ga0495585_0023692 3300046492 Bacteria 3522
302 Ga0495594_0254597 3300046499 Bacteria 1000
303 Ga0495607_0031513 3300046501 Bacteria 3246
304 Ga0495608_0003505 3300046511 Bacteria 11243
305 Ga0495608_0006948 3300046511 Bacteria 8014
306 Ga0495608_0038912 3300046511 Bacteria 3191
307 Ga0495608_0261530 3300046511 Bacteria 1077
308 Ga0495618_0001392 3300046514 Bacteria 16277
309 Ga0495618_0066455 3300046514 Bacteria 2292
310 Ga0495628_0000329 3300046516 Bacteria 42884
311 Ga0495628_0008319 3300046516 Bacteria 8911
312 Ga0495628_0108286 3300046516 Bacteria 2139
313 Ga0495628_0108864 3300046516 Bacteria 2133
314 Ga0495628_0209213 3300046516 Unclassified 1468
315 Ga0495628_1217986 3300046516 Unclassified 510
316 Ga0495630_0015947 3300046517 Bacteria 5490
317 Ga0495630_0123700 3300046517 Bacteria 1963
318 Ga0495630_0183497 3300046517 Unclassified 1596
319 Ga0495637_0163159 3300046520 Bacteria 835
320 Ga0495644_0008793 3300046523 Bacteria 3884
321 Ga0495663_0088328 3300046525 Bacteria 1007
322 Ga0495666_0001406 3300046526 Bacteria 11650
323 Ga0495652_0042778 3300046529 Bacteria 3905
324 Ga0495652_0046015 3300046529 Bacteria 3748
325 Ga0495652_0120395 3300046529 Bacteria 2095
326 Ga0495652_0145609 3300046529 Bacteria 1857
327 Ga0495652_0155630 3300046529 Bacteria 1780
328 Ga0495652_0178287 3300046529 Unclassified 1633
329 Ga0495665_0003369 3300046531 Bacteria 8673
330 Ga0495665_0231546 3300046531 Bacteria 954
331 Ga0495640_0044367 3300046533 Bacteria 3091
332 Ga0495640_0206388 3300046533 Unclassified 1244
333 Ga0495640_0287630 3300046533 Bacteria 1023
334 Ga0495586_0005573 3300046535 Bacteria 6737
335 Ga0495587_0015271 3300046536 Bacteria 4798
336 Ga0495587_0017462 3300046536 Bacteria 4456
337 Ga0495587_0466582 3300046536 Unclassified 699
338 Ga0495598_0019122 3300046537 Bacteria 1791
339 Ga0495609_0021545 3300046538 Bacteria 2974
340 Ga0495645_0000563 3300046543 Bacteria 25436
341 Ga0495645_0109323 3300046543 Bacteria 1957
342 Ga0495645_0306002 3300046543 Bacteria 1036
343 Ga0495667_0067004 3300046559 Bacteria 2346
344 Ga0495667_0473314 3300046559 Bacteria 786
345 Ga0495667_0552264 3300046559 Bacteria 719
346 Ga0495656_0000851 3300046615 Bacteria 9853
347 Ga0495634_0048001 3300046642 Bacteria 2876
348 Ga0495634_0234272 3300046642 Bacteria 1128
349 Ga0495634_0269717 3300046642 Bacteria 1036
350 Ga0495634_0323698 3300046642 Unclassified 928
351 Ga0495635_0011767 3300046663 Bacteria 6135
352 Ga0495635_0069835 3300046663 Bacteria 2408
353 Ga0495635_0147583 3300046663 Bacteria 1601
354 Ga0495635_0317865 3300046663 Unclassified 1042
355 Ga0495588_0383903 3300046674 Bacteria 738
356 Ga0495657_0030798 3300046675 Bacteria 3754
357 Ga0495657_0104973 3300046675 Bacteria 1796
358 Ga0495657_0121639 3300046675 Unclassified 1643
359 Ga0495599_0000086 3300046678 Bacteria 64425
360 Ga0495599_0041358 3300046678 Bacteria 2894
361 Ga0495599_0130134 3300046678 Unclassified 1563
362 Ga0495599_0152133 3300046678 Bacteria 1432
363 Ga0495623_0000037 3300046679 Bacteria 80938
364 Ga0495623_0087292 3300046679 Bacteria 1922
365 Ga0495623_0090985 3300046679 Bacteria 1873
366 Ga0495623_0255407 3300046679 Bacteria 984
367 Ga0495646_0089938 3300046680 Bacteria 1775
368 Ga0495646_0119516 3300046680 Unclassified 1492
369 Ga0495646_0190995 3300046680 Bacteria 1119
370 Ga0495647_0001420 3300046681 Bacteria 7401
371 Ga0495647_0065675 3300046681 Bacteria 1441
372 Ga0495647_0123961 3300046681 Bacteria 1089
373 Ga0495658_0170531 3300046683 Bacteria 1346
374 Ga0495613_0014297 3300046689 Bacteria 5889
375 Ga0495613_0060300 3300046689 Bacteria 2779
376 Ga0495613_0276483 3300046689 Unclassified 1167
377 Ga0495613_0532700 3300046689 Bacteria 788
378 Ga0495613_0813778 3300046689 Bacteria 609
379 Ga0495624_0006777 3300046690 Bacteria 8094
380 Ga0495624_0206043 3300046690 Bacteria 1194
381 Ga0495624_0612179 3300046690 Bacteria 649
382 Ga0495589_0020351 3300046794 Bacteria 3394
383 Ga0495589_0239799 3300046794 Bacteria 849
384 Ga0495600_0069305 3300046809 Bacteria 2305
385 Ga0495600_0125231 3300046809 Bacteria 1671
386 Ga0495600_0454642 3300046809 Bacteria 791
387 Ga0495581_0008640 3300047315 Bacteria 5899
388 Ga0495604_0000080 3300047317 Bacteria 83113
389 Ga0495604_0058770 3300047317 Bacteria 2952
390 Ga0495604_0138787 3300047317 Bacteria 1739
391 Ga0495604_0152386 3300047317 Bacteria 1641
392 Ga0495604_0421774 3300047317 Bacteria 876
393 Ga0495674_0053512 3300047319 Bacteria 3548
394 Ga0495674_0068128 3300047319 Bacteria 3080
395 Ga0495674_0069588 3300047319 Bacteria 3042
396 Ga0495674_0353576 3300047319 Unclassified 1192
397 Ga0495676_0007468 3300047321 Bacteria 10024
398 Ga0495676_0343922 3300047321 Bacteria 998
399 Ga0495680_0024871 3300047322 Bacteria 4959
400 Ga0495680_0030768 3300047322 Bacteria 4377
401 Ga0495680_0032562 3300047322 Bacteria 4229
402 Ga0495680_0035444 3300047322 Bacteria 4019
403 Ga0495680_0193272 3300047322 Unclassified 1463
404 Ga0495680_0269142 3300047322 Bacteria 1203
405 Ga0495675_0022326 3300047444 Bacteria 4033
406 Ga0495675_0136766 3300047444 Bacteria 1521
407 Ga0495685_067333 3300047447 Bacteria 1202
408 Ga0495684_0107844 3300047471 Bacteria 2103
409 Ga0495684_0308402 3300047471 Bacteria 1135
410 Ga0495684_0876874 3300047471 Unclassified 580
411 Ga0495593_0001892 3300047673 Bacteria 12466
412 Ga0495602_0039716 3300048088 Bacteria 4328
413 Ga0495602_0208217 3300048088 Unclassified 1487
414 Ga0495602_0391771 3300048088 Unclassified 993
415 Ga0495602_0503777 3300048088 Unclassified 846
416 Ga0495614_0001676 3300048089 Bacteria 9668
417 Ga0496100_0031579 3300048903 Bacteria 3294
418 Ga0496100_0300041 3300048903 Unclassified 1202
419 Ga0496101_0109992 3300048904 Unclassified 2073
420 Ga0496101_0397321 3300048904 Bacteria 1085
421 Ga0496101_1111138 3300048904 Bacteria 620
422 Ga0496102_0352525 3300048905 Bacteria 1386
423 Ga0496102_0359936 3300048905 Bacteria 1370
424 Ga0496103_0124492 3300048906 Bacteria 1643
425 Ga0496103_0226001 3300048906 Bacteria 1204
426 Ga0496103_0242053 3300048906 Bacteria 1161
427 Ga0496104_0001688 3300048907 Bacteria 19063
428 Ga0496104_0073553 3300048907 Bacteria 3251
429 Ga0496104_0100389 3300048907 Bacteria 2770
430 Ga0496104_0481272 3300048907 Bacteria 1153
431 Ga0496105_0050129 3300048908 Bacteria 3448
432 Ga0496105_0142364 3300048908 Bacteria 1973
433 Ga0496105_0361671 3300048908 Bacteria 1157
434 Ga0496105_0569757 3300048908 Bacteria 882
435 Ga0496106_0071126 3300048909 Bacteria 2658
436 Ga0496107_0042937 3300048910 Bacteria 3248
437 Ga0496107_0059683 3300048910 Bacteria 2760
438 Ga0496107_0078008 3300048910 Bacteria 2413
439 Ga0496108_0023755 3300048911 Bacteria 5045
440 Ga0496108_0055878 3300048911 Bacteria 3315
441 Ga0496108_0138760 3300048911 Bacteria 2094
442 Ga0496109_0022931 3300048912 Bacteria 5534
443 Ga0496109_0025081 3300048912 Bacteria 5308
444 Ga0496109_0045409 3300048912 Bacteria 3986
445 Ga0496109_0305639 3300048912 Bacteria 1500
446 Ga0496109_0383008 3300048912 Bacteria 1329
447 Ga0496110_0069053 3300048913 Bacteria 3128
448 Ga0496110_0333518 3300048913 Bacteria 1382
449 Ga0496111_0142165 3300048914 Bacteria 1778
450 Ga0496111_0254285 3300048914 Bacteria 1304
451 Ga0496112_0038552 3300048915 Bacteria 4666
452 Ga0496112_0054006 3300048915 Bacteria 3947
453 Ga0496112_0154984 3300048915 Bacteria 2258
454 Ga0496112_0536682 3300048915 Bacteria 1104
455 Ga0496113_0079155 3300048916 Bacteria 2515
456 Ga0496113_0081079 3300048916 Bacteria 2486
457 Ga0496113_0148641 3300048916 Bacteria 1847
458 Ga0496113_0608155 3300048916 Unclassified 875
459 Ga0496114_0023711 3300048917 Bacteria 5008
460 Ga0496114_0031107 3300048917 Bacteria 4391
461 Ga0496114_0103271 3300048917 Bacteria 2436
462 Ga0496114_0248212 3300048917 Bacteria 1566
463 Ga0496115_0024550 3300048918 Bacteria 4687
464 Ga0496115_0057951 3300048918 Bacteria 3116
465 Ga0496115_0093074 3300048918 Bacteria 2464
466 Ga0496115_0105439 3300048918 Bacteria 2313
467 Ga0496115_0136762 3300048918 Bacteria 2020
468 Ga0496122_0376975 3300048925 Bacteria 730
469 Ga0496126_0112754 3300048929 Bacteria 2367
470 Ga0501067_0035842 3300049583 Bacteria 2755
471 Ga0501069_0463543 3300049585 Bacteria 754
472 nmdc:mga08y16_912102_c1 3300050511 Bacteria 864
473 nmdc:mga0rr50_80716_c1 3300050513 Bacteria 2508
474 nmdc:mga0a205_356801_c1 3300050515 Bacteria 1329
475 Ga0495601_0004250 3300053077 Bacteria 8272
476 Ga0495601_0964127 3300053077 Bacteria 537
477 Ga0495612_0003252 3300053078 Bacteria 6738
478 Ga0495612_0020020 3300053078 Unclassified 2681
479 Ga0495612_0022788 3300053078 Bacteria 2511
480 Ga0495612_0071073 3300053078 Bacteria 1451
481 Ga0495612_0245891 3300053078 Unclassified 795
482 Ga0495595_0029645 3300053084 Bacteria 2450
483 Ga0495595_0055106 3300053084 Unclassified 1850
484 Ga0495595_0059704 3300053084 Bacteria 1783
485 Ga0495595_0150747 3300053084 Unclassified 1144
486 Ga0495595_0716711 3300053084 Bacteria 513
487 Ga0495619_0001678 3300053085 Bacteria 14640
488 Ga0495619_0036366 3300053085 Bacteria 3206
489 Ga0495619_0069546 3300053085 Bacteria 2353
490 Ga0495619_0171479 3300053085 Bacteria 1500
491 Ga0495619_0195336 3300053085 Unclassified 1401
492 Ga0500566_0066770 3300053094 Bacteria 2026
493 Ga0466962_0002314 3300061719 Bacteria 9019
494 Ga0466962_0003264 3300061719 Bacteria 7704
495 Ga0466962_0019125 3300061719 Bacteria 3290
496 Ga0466962_0025894 3300061719 Bacteria 2815
497 Ga0466962_0080708 3300061719 Bacteria 1555
498 Ga0466962_0207322 3300061719 Bacteria 958
499 Ga0070694_100215108
500 Ga0070658_10073052
501 Ga0070658_10545749
502 Ga0070683_100032332
503 Ga0070680_100052873
504 Ga0070680_100271506
505 Ga0070682_100408700
506 Ga0068868_101009031
507 Ga0070660_100060390
508 Ga0070691_10222066
509 Ga0070661_100226796
510 Ga0070692_10126984
511 Ga0070659_100106204
512 Ga0070709_10063574
513 Ga0070714_100047617
514 Ga0070714_100058552
515 Ga0070713_100095446
516 Ga0070713_100386380
517 Ga0070713_100898513
518 Ga0070710_10023799
519 Ga0070710_10168443
520 Ga0070710_10979374
521 Ga0070711_100058118
522 Ga0070711_100073167
523 Ga0070681_10295321
524 Ga0070707_100028397
525 Ga0070707_100600715
526 Ga0070707_100865522
527 Ga0070698_100112715
528 Ga0070679_100124671
529 Ga0070679_100125813
530 Ga0070684_100098276
531 Ga0068853_100454452
532 Ga0070672_100952261
533 Ga0070695_100000001
534 Ga0070696_100155828
535 Ga0070704_100549191
536 Ga0070704_100615189
537 Ga0068855_100080252
538 Ga0070664_100625403
539 Ga0068857_100805753
540 Ga0068856_100049321
541 Ga0068856_100398858
542 Ga0070702_100053155
543 Ga0068852_100154431
544 Ga0068863_100587280
545 Ga0081455_10026432
546 Ga0070717_10001826
547 Ga0070717_10037895
548 Ga0070717_10042596
549 Ga0070717_10207536
550 Ga0070717_10501416
551 Ga0070716_100007978
552 Ga0070716_100157979
553 Ga0070712_100178452
554 Ga0097621_100078669
555 Ga0075434_100099867
556 Ga0075436_100387877
557 Ga0075435_100094702
558 Ga0105240_10015096
559 Ga0105240_10212956
560 Ga0111539_10243667
561 Ga0105245_10215510
562 Ga0105245_10318606
563 Ga0105247_10261138
564 Ga0105247_10579629
565 Ga0105241_10865073
566 Ga0105241_11026268
567 Ga0105237_10073320
568 Ga0105237_10349798
569 Ga0105238_10128113
570 Ga0105249_10347910
571 Ga0105239_10452799
572 Ga0105239_10931866
573 Ga0105246_10188075
574 Ga0157371_10290677
575 Ga0157369_10014610
576 Ga0157369_10027414
577 Ga0157374_10133427
578 Ga0157374_10678706
579 Ga0157374_10717968
580 Ga0163162_11897713
581 Ga0157372_10130620
582 Ga0157372_10174810
583 Ga0163163_10703424
584 Ga0157376_10045172
585 Ga0163161_11712896
586 Ga0206354_11695195
587 Ga0224712_10132740
588 Ga0207692_10036914
589 Ga0207692_10146441
590 Ga0207699_10062566
591 Ga0207705_10095680
592 Ga0207695_10110028
593 Ga0207695_10957285
594 Ga0207693_10001411
595 Ga0207693_10198951
596 Ga0207663_10562935
597 Ga0207663_10766013
598 Ga0207663_10776180
599 Ga0207660_10177931
600 Ga0207657_10003323
601 Ga0207652_10251551
602 Ga0207652_11316586
603 Ga0207646_10012880
604 Ga0207694_10094269
605 Ga0207687_10161712
606 Ga0207687_10893936
607 Ga0207700_10131559
608 Ga0207700_10836544
609 Ga0207700_10862137
610 Ga0207664_10095927
611 Ga0207664_10140226
612 Ga0207664_10153654
613 Ga0207664_10264394
614 Ga0207664_10283382
615 Ga0207644_10653660
616 Ga0207690_10396488
617 Ga0207704_10218021
618 Ga0207665_10000476
619 Ga0207661_10170303
620 Ga0207661_10253237
621 Ga0207679_10337741
622 Ga0207702_10038577
623 Ga0207641_10576973
624 Ga0207676_10470863
625 Ga0207674_10372363
626 Ga0268266_11716936
627 Ga0265337_1032953
628 Ga0265319_1009133
629 Ga0265318_10003022
630 Ga0265323_10023272
631 Ga0265322_10002388
632 Ga0265322_10020606
633 Ga0265336_10025345
634 Ga0265338_10011536
635 Ga0265338_10037766
636 Ga0265324_10011143
637 Ga0265324_10130948
638 Ga0265330_10004277
639 Ga0265328_10041021
640 Ga0265320_10026030
641 Ga0265325_10008930
642 Ga0265325_10189655
643 Ga0265340_10022047
644 Ga0265339_10046748
645 Ga0265339_10082674
646 Ga0265331_10015623
647 Ga0265331_10096374
648 Ga0265327_10392196
649 Ga0265316_10016110
650 Ga0265313_10080299
651 Ga0265314_10101547
652 Ga0265314_10115774
653 Ga0265342_10154962
654 Ga0373926_0009937
655 Ga0373934_0253426
656 Ga0373944_0037271
657 Ga0373923_0176095
658 Ga0373936_0074698
659 Ga0373943_0002587
660 Ga0373946_0092949
661 Ga0373955_0164356
662 Ga0373955_0301221
663 Ga0373955_0574921
664 Ga0373924_0058854
665 Ga0373931_0065608
666 Ga0373935_0045605
667 Ga0373927_0278405
668 Ga0373933_0079758
669 Ga0373947_0843201
670 Ga0373937_0001601
671 Ga0373937_0436469
672 Ga0373925_0006395
673 Ga0395900_0433457
674 Ga0395898_0456613
675 Ga0395898_0458465
676 Ga0395905_0212564
677 Ga0395901_0036634
678 Ga0395901_0649074
679 Ga0395901_0814417
680 Ga0451853_1108072
681 Ga0439454_026068
682 Ga0466969_0007964
683 Ga0466969_0190460
684 Ga0466965_0104959
685 Ga0466965_0824020
686 Ga0466966_0007751
687 Ga0466966_0111558
688 Ga0466966_0157294
689 Ga0466966_0230520
690 Ga0466961_0008701
691 Ga0466961_0022530
692 Ga0466961_0286122
693 Ga0466963_0015670
694 Ga0466963_0015853
695 Ga0466963_0016012
696 Ga0466963_0031182
697 Ga0466963_0031852
698 Ga0466963_0043467
699 Ga0466963_0046902
700 Ga0466963_0053345
701 Ga0466963_0062706
702 Ga0466963_0096180
703 Ga0466963_0141204
704 Ga0466963_0153742
705 Ga0466963_0350138
706 Ga0466964_0000296
707 Ga0466964_0007018
708 Ga0466964_0008795
709 Ga0466964_0044443
710 Ga0466964_0044611
711 Ga0466964_0061226
712 Ga0466964_0071941
713 Ga0466964_0085304
714 Ga0466971_0003329
715 Ga0466971_0008382
716 Ga0466971_0008578
717 Ga0466971_0013765
718 Ga0466971_0014022
719 Ga0466968_0007070
720 Ga0466968_0155305
721 Ga0466968_0192427
722 Ga0466968_0441816
723 Ga0466970_0077985
724 Ga0466957_0004568
725 Ga0466957_0005101
726 Ga0466957_0012737
727 Ga0466957_0020438
728 Ga0466957_0063237
729 Ga0466957_0064790
730 Ga0466957_0119182
731 Ga0466957_0156235
732 Ga0466957_0291656
733 Ga0466957_0756114
734 Ga0466960_0006357
735 Ga0466960_0010192
736 Ga0466960_0969779
737 Ga0466959_0001305
738 Ga0466959_0041824
739 Ga0466959_0068430
740 Ga0466959_0124104
741 Ga0466959_0167751
742 Ga0466958_0000729
743 Ga0466958_0002369
744 Ga0466958_0003200
745 Ga0466958_0008288
746 Ga0466958_0020911
747 Ga0466958_0044710
748 Ga0466958_0052585
749 Ga0466958_0056027
750 Ga0466958_0056884
751 Ga0466967_0000193
752 Ga0466967_0002242
753 Ga0466967_0010982
754 Ga0466967_0031989
755 Ga0466967_0042239
756 Ga0466967_0048944
757 Ga0466967_0052378
758 Ga0466967_0070193
759 Ga0466967_0074410
760 Ga0466967_0122822
761 Ga0466967_0137182
762 Ga0466967_0232103
763 Ga0466967_0299426
764 Ga0466967_0561954
765 Ga0466967_0693161
766 Ga0466967_1221218
767 Ga0495592_0012025
768 Ga0495592_0025847
769 Ga0495592_0156943
770 Ga0495592_0344303
771 Ga0495603_0023549
772 Ga0495603_0160777
773 Ga0495629_0008088
774 Ga0495629_0849556
775 Ga0495641_0004571
776 Ga0495641_0027637
777 Ga0495641_0091005
778 Ga0495641_0218405
779 Ga0495641_0305066
780 Ga0495651_0000344
781 Ga0495651_0638754
782 Ga0495653_0004353
783 Ga0495653_0209977
784 Ga0495653_0254878
785 Ga0495653_0312237
786 Ga0495653_0608526
787 Ga0495580_0023533
788 Ga0495582_0014256
789 Ga0495582_0037842
790 Ga0495582_0153026
791 Ga0495582_0278826
792 Ga0495639_0003535
793 Ga0495662_0002883
794 Ga0495664_0055031
795 Ga0495664_0089466
796 Ga0495664_0280546
797 Ga0495664_0452784
798 Ga0495584_0010851
799 Ga0495585_0023692
800 Ga0495594_0254597
801 Ga0495607_0031513
802 Ga0495608_0003505
803 Ga0495608_0006948
804 Ga0495608_0038912
805 Ga0495608_0261530
806 Ga0495618_0001392
807 Ga0495618_0066455
808 Ga0495628_0000329
809 Ga0495628_0008319
810 Ga0495628_0108286
811 Ga0495628_0108864
812 Ga0495628_0209213
813 Ga0495628_1217986
814 Ga0495630_0015947
815 Ga0495630_0123700
816 Ga0495630_0183497
817 Ga0495637_0163159
818 Ga0495644_0008793
819 Ga0495663_0088328
820 Ga0495666_0001406
821 Ga0495652_0042778
822 Ga0495652_0046015
823 Ga0495652_0120395
824 Ga0495652_0145609
825 Ga0495652_0155630
826 Ga0495652_0178287
827 Ga0495665_0003369
828 Ga0495665_0231546
829 Ga0495640_0044367
830 Ga0495640_0206388
831 Ga0495640_0287630
832 Ga0495586_0005573
833 Ga0495587_0015271
834 Ga0495587_0017462
835 Ga0495587_0466582
836 Ga0495598_0019122
837 Ga0495609_0021545
838 Ga0495645_0000563
839 Ga0495645_0109323
840 Ga0495645_0306002
841 Ga0495667_0067004
842 Ga0495667_0473314
843 Ga0495667_0552264
844 Ga0495656_0000851
845 Ga0495634_0048001
846 Ga0495634_0234272
847 Ga0495634_0269717
848 Ga0495634_0323698
849 Ga0495635_0011767
850 Ga0495635_0069835
851 Ga0495635_0147583
852 Ga0495635_0317865
853 Ga0495588_0383903
854 Ga0495657_0030798
855 Ga0495657_0104973
856 Ga0495657_0121639
857 Ga0495599_0000086
858 Ga0495599_0041358
859 Ga0495599_0130134
860 Ga0495599_0152133
861 Ga0495623_0000037
862 Ga0495623_0087292
863 Ga0495623_0090985
864 Ga0495623_0255407
865 Ga0495646_0089938
866 Ga0495646_0119516
867 Ga0495646_0190995
868 Ga0495647_0001420
869 Ga0495647_0065675
870 Ga0495647_0123961
871 Ga0495658_0170531
872 Ga0495613_0014297
873 Ga0495613_0060300
874 Ga0495613_0276483
875 Ga0495613_0532700
876 Ga0495613_0813778
877 Ga0495624_0006777
878 Ga0495624_0206043
879 Ga0495624_0612179
880 Ga0495589_0020351
881 Ga0495589_0239799
882 Ga0495600_0069305
883 Ga0495600_0125231
884 Ga0495600_0454642
885 Ga0495581_0008640
886 Ga0495604_0000080
887 Ga0495604_0058770
888 Ga0495604_0138787
889 Ga0495604_0152386
890 Ga0495604_0421774
891 Ga0495674_0053512
892 Ga0495674_0068128
893 Ga0495674_0069588
894 Ga0495674_0353576
895 Ga0495676_0007468
896 Ga0495676_0343922
897 Ga0495680_0024871
898 Ga0495680_0030768
899 Ga0495680_0032562
900 Ga0495680_0035444
901 Ga0495680_0193272
902 Ga0495680_0269142
903 Ga0495675_0022326
904 Ga0495675_0136766
905 Ga0495685_067333
906 Ga0495684_0107844
907 Ga0495684_0308402
908 Ga0495684_0876874
909 Ga0495593_0001892
910 Ga0495602_0039716
911 Ga0495602_0208217
912 Ga0495602_0391771
913 Ga0495602_0503777
914 Ga0495614_0001676
915 Ga0496100_0031579
916 Ga0496100_0300041
917 Ga0496101_0109992
918 Ga0496101_0397321
919 Ga0496101_1111138
920 Ga0496102_0352525
921 Ga0496102_0359936
922 Ga0496103_0124492
923 Ga0496103_0226001
924 Ga0496103_0242053
925 Ga0496104_0001688
926 Ga0496104_0073553
927 Ga0496104_0100389
928 Ga0496104_0481272
929 Ga0496105_0050129
930 Ga0496105_0142364
931 Ga0496105_0361671
932 Ga0496105_0569757
933 Ga0496106_0071126
934 Ga0496107_0042937
935 Ga0496107_0059683
936 Ga0496107_0078008
937 Ga0496108_0023755
938 Ga0496108_0055878
939 Ga0496108_0138760
940 Ga0496109_0022931
941 Ga0496109_0025081
942 Ga0496109_0045409
943 Ga0496109_0305639
944 Ga0496109_0383008
945 Ga0496110_0069053
946 Ga0496110_0333518
947 Ga0496111_0142165
948 Ga0496111_0254285
949 Ga0496112_0038552
950 Ga0496112_0054006
951 Ga0496112_0154984
952 Ga0496112_0536682
953 Ga0496113_0079155
954 Ga0496113_0081079
955 Ga0496113_0148641
956 Ga0496113_0608155
957 Ga0496114_0023711
958 Ga0496114_0031107
959 Ga0496114_0103271
960 Ga0496114_0248212
961 Ga0496115_0024550
962 Ga0496115_0057951
963 Ga0496115_0093074
964 Ga0496115_0105439
965 Ga0496115_0136762
966 Ga0496122_0376975
967 Ga0496126_0112754
968 Ga0501067_0035842
969 Ga0501069_0463543
970 nmdc:mga08y16_912102_c1
971 nmdc:mga0rr50_80716_c1
972 nmdc:mga0a205_356801_c1
973 Ga0495601_0004250
974 Ga0495601_0964127
975 Ga0495612_0003252
976 Ga0495612_0020020
977 Ga0495612_0022788
978 Ga0495612_0071073
979 Ga0495612_0245891
980 Ga0495595_0029645
981 Ga0495595_0055106
982 Ga0495595_0059704
983 Ga0495595_0150747
984 Ga0495595_0716711
985 Ga0495619_0001678
986 Ga0495619_0036366
987 Ga0495619_0069546
988 Ga0495619_0171479
989 Ga0495619_0195336
990 Ga0500566_0066770
991 Ga0466962_0002314
992 Ga0466962_0003264
993 Ga0466962_0019125
994 Ga0466962_0025894
995 Ga0466962_0080708
996 Ga0466962_0207322

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04138

GtrA

GtrA-like protein

50

164

0.98

Map