F455143

General Info

Members Datasets Scaffolds Average Seq Length
498 228 996 98

Family's Representative Sequence

Representative Sequence 3300005345|Ga0070692_10230912|Ga0070692_102309122
Length 102
Sequence MGRRVLTSSKQNTNIAMSENFLSNYKAKHQHPLNRLSHSIGIPLIVALLLFIAGWILQFVGHAIEGNQPAFFKNPVYLLIGPLWLLRRAASVVGLARPKELQ

Samples

Sample ID Description Type Environment
1 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
76 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
153 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
154 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
155 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
156 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
157 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
158 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
161 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
162 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
163 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
164 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
165 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
166 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
167 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
168 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
169 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
170 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
171 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
172 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
173 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
174 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
175 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
176 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
177 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
178 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
179 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
180 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
181 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
182 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
183 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
184 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
185 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
186 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
187 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
188 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
189 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
190 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
191 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
192 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
193 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
194 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
197 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
198 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
199 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
200 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
201 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
202 3300049657 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought Metagenome Rhizosphere
203 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
204 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
205 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
206 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
207 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
208 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
209 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
210 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
211 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
212 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
213 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
214 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
215 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
216 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
217 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
218 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
219 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
220 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
221 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
222 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
223 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
224 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
225 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
226 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
227 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
228 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.01
Rhizosphere 97.79
Stem 0
Stem Tuber 0
Unclassified 41.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070692_10230912 3300005345 Unclassified 1098
2 SwRhRL2b_contig_232455 2162886007 Bacteria 1305
3 rootL2_10199559 3300003322 Bacteria 1862
4 Ga0065714_10064436 3300005288 Bacteria 116206
5 Ga0065704_10010747 3300005289 Bacteria 2346
6 Ga0065704_10159911 3300005289 Bacteria 1362
7 Ga0065704_10161384 3300005289 Unclassified 1352
8 Ga0065704_10575150 3300005289 Bacteria 621
9 Ga0065712_10000112 3300005290 Bacteria 340011
10 Ga0065712_10006866 3300005290 Bacteria 3006
11 Ga0065712_10288894 3300005290 Bacteria 874
12 Ga0065712_10406494 3300005290 Bacteria 686
13 Ga0065715_10134448 3300005293 Unclassified 1946
14 Ga0065715_10407279 3300005293 Bacteria 874
15 Ga0065715_10744614 3300005293 Bacteria 633
16 Ga0065707_10008393 3300005295 Bacteria 2181
17 Ga0065707_10093733 3300005295 Bacteria 3587
18 Ga0065707_10096876 3300005295 Bacteria 3225
19 Ga0070676_10281337 3300005328 Bacteria 1121
20 Ga0070690_100078312 3300005330 Bacteria 2159
21 Ga0070670_100104236 3300005331 Unclassified 2443
22 Ga0070670_100287838 3300005331 Bacteria 1435
23 Ga0070670_100532696 3300005331 Bacteria 1047
24 Ga0070670_100755855 3300005331 Unclassified 876
25 Ga0070677_10334177 3300005333 Unclassified 780
26 Ga0068869_100007332 3300005334 Bacteria 7036
27 Ga0068869_100083740 3300005334 Unclassified 2386
28 Ga0068869_100311092 3300005334 Bacteria 1275
29 Ga0068869_101286944 3300005334 Unclassified 645
30 Ga0068869_101580660 3300005334 Unclassified 584
31 Ga0070666_10366727 3300005335 Unclassified 1032
32 Ga0070680_100022719 3300005336 Bacteria 4997
33 Ga0070680_100197041 3300005336 Bacteria 1698
34 Ga0070680_100573168 3300005336 Unclassified 968
35 Ga0070682_100014703 3300005337 Bacteria 4526
36 Ga0070660_100015607 3300005339 Bacteria 5489
37 Ga0070660_101399585 3300005339 Bacteria 594
38 Ga0070689_100189406 3300005340 Bacteria 1675
39 Ga0070689_100645716 3300005340 Bacteria 920
40 Ga0070689_102126741 3300005340 Unclassified 514
41 Ga0070687_100012079 3300005343 Bacteria 3800
42 Ga0070661_100945309 3300005344 Bacteria 713
43 Ga0070692_10028821 3300005345 Unclassified 2763
44 Ga0070692_11081753 3300005345 Unclassified 565
45 Ga0070692_11318891 3300005345 Unclassified 518
46 Ga0070668_100843224 3300005347 Unclassified 816
47 Ga0070669_100184706 3300005353 Bacteria 1633
48 Ga0070669_100339659 3300005353 Unclassified 1217
49 Ga0070669_100748751 3300005353 Unclassified 828
50 Ga0070669_102041979 3300005353 Bacteria 501
51 Ga0070675_100505270 3300005354 Bacteria 1089
52 Ga0070675_101738780 3300005354 Unclassified 575
53 Ga0070671_100019771 3300005355 Bacteria 5485
54 Ga0070673_100173480 3300005364 Bacteria 1842
55 Ga0070673_100506908 3300005364 Unclassified 1092
56 Ga0070673_100651999 3300005364 Bacteria 964
57 Ga0070673_100893077 3300005364 Bacteria 824
58 Ga0070688_100006343 3300005365 Bacteria 6317
59 Ga0070688_100422470 3300005365 Bacteria 991
60 Ga0070667_100249834 3300005367 Bacteria 1585
61 Ga0070703_10599011 3300005406 Unclassified 508
62 Ga0070701_10120145 3300005438 Unclassified 1479
63 Ga0070705_100982910 3300005440 Unclassified 684
64 Ga0070700_100072008 3300005441 Bacteria 2208
65 Ga0070700_100293841 3300005441 Unclassified 1183
66 Ga0070700_101005044 3300005441 Unclassified 686
67 Ga0070694_100059735 3300005444 Bacteria 2598
68 Ga0070694_100299188 3300005444 Bacteria 1232
69 Ga0070694_100671894 3300005444 Bacteria 840
70 Ga0070694_101500005 3300005444 Unclassified 570
71 Ga0070694_101587641 3300005444 Bacteria 555
72 Ga0070678_100437336 3300005456 Bacteria 1143
73 Ga0070681_10642136 3300005458 Unclassified 976
74 Ga0068867_100011956 3300005459 Bacteria 6131
75 Ga0068867_100134063 3300005459 Bacteria 1928
76 Ga0068867_100254535 3300005459 Bacteria 1429
77 Ga0070685_10439217 3300005466 Bacteria 912
78 Ga0070706_100008640 3300005467 Bacteria 9491
79 Ga0070707_101162321 3300005468 Unclassified 738
80 Ga0070698_100022162 3300005471 Bacteria 6650
81 Ga0070698_101122022 3300005471 Bacteria 735
82 Ga0070698_101960975 3300005471 Unclassified 539
83 Ga0070699_100009306 3300005518 Bacteria 8508
84 Ga0070699_100359146 3300005518 Unclassified 1313
85 Ga0070679_100019240 3300005530 Bacteria 6636
86 Ga0068853_100080750 3300005539 Unclassified 2846
87 Ga0068853_100223284 3300005539 Bacteria 1721
88 Ga0068853_100831662 3300005539 Unclassified 885
89 Ga0070672_100123449 3300005543 Unclassified 2122
90 Ga0070672_100737957 3300005543 Bacteria 864
91 Ga0070672_101543055 3300005543 Unclassified 595
92 Ga0070695_100779581 3300005545 Unclassified 764
93 Ga0070695_101176910 3300005545 Unclassified 630
94 Ga0070695_101199582 3300005545 Bacteria 624
95 Ga0070696_100113896 3300005546 Bacteria 1950
96 Ga0070696_100269492 3300005546 Bacteria 1294
97 Ga0070696_100628749 3300005546 Bacteria 868
98 Ga0070696_101720863 3300005546 Unclassified 541
99 Ga0070696_101754870 3300005546 Unclassified 536
100 Ga0070693_100030879 3300005547 Bacteria 2933
101 Ga0070693_100134096 3300005547 Unclassified 1551
102 Ga0070693_100266275 3300005547 Unclassified 1142
103 Ga0070693_100680305 3300005547 Bacteria 751
104 Ga0070693_100979907 3300005547 Unclassified 638
105 Ga0070704_100107143 3300005549 Bacteria 2119
106 Ga0070704_100522305 3300005549 Unclassified 1033
107 Ga0070704_100614749 3300005549 Bacteria 956
108 Ga0070704_101035347 3300005549 Unclassified 744
109 Ga0070664_100009535 3300005564 Bacteria 7872
110 Ga0070664_100143034 3300005564 Unclassified 2107
111 Ga0070664_100624996 3300005564 Bacteria 1000
112 Ga0070664_100993503 3300005564 Bacteria 789
113 Ga0068857_100011666 3300005577 Bacteria 7643
114 Ga0068857_100317224 3300005577 Bacteria 1439
115 Ga0068857_100388607 3300005577 Unclassified 1297
116 Ga0068857_100485154 3300005577 Bacteria 1158
117 Ga0068857_102058715 3300005577 Unclassified 560
118 Ga0068854_100066581 3300005578 Bacteria 2622
119 Ga0068854_100075037 3300005578 Bacteria 2482
120 Ga0068854_100122825 3300005578 Bacteria 1974
121 Ga0068854_100147086 3300005578 Unclassified 1814
122 Ga0068854_100838961 3300005578 Unclassified 804
123 Ga0070702_100073501 3300005615 Bacteria 2026
124 Ga0070702_100158363 3300005615 Unclassified 1461
125 Ga0070702_100650384 3300005615 Bacteria 797
126 Ga0068852_100721280 3300005616 Unclassified 1008
127 Ga0068852_101188643 3300005616 Unclassified 783
128 Ga0068859_100015803 3300005617 Bacteria 7583
129 Ga0068859_100039424 3300005617 Archaea 4738
130 Ga0068859_100136923 3300005617 Bacteria 2522
131 Ga0068859_100368835 3300005617 Bacteria 1531
132 Ga0068859_100481515 3300005617 Unclassified 1336
133 Ga0068859_100675070 3300005617 Bacteria 1124
134 Ga0068859_100859868 3300005617 Bacteria 993
135 Ga0068859_102177247 3300005617 Unclassified 612
136 Ga0068859_103075249 3300005617 Bacteria 509
137 Ga0068859_103090171 3300005617 Unclassified 508
138 Ga0068864_100015189 3300005618 Bacteria 6404
139 Ga0068864_100107525 3300005618 Bacteria 2481
140 Ga0068864_100189104 3300005618 Bacteria 1887
141 Ga0068864_100205404 3300005618 Bacteria 1812
142 Ga0068864_100342281 3300005618 Unclassified 1409
143 Ga0068864_100360558 3300005618 Unclassified 1374
144 Ga0068864_100527778 3300005618 Unclassified 1139
145 Ga0068864_100531413 3300005618 Unclassified 1135
146 Ga0068864_101004386 3300005618 Bacteria 828
147 Ga0068864_101738381 3300005618 Unclassified 629
148 Ga0068864_101754616 3300005618 Unclassified 626
149 Ga0068866_10056388 3300005718 Bacteria 2020
150 Ga0068861_100068845 3300005719 Bacteria 2736
151 Ga0068861_100241359 3300005719 Unclassified 1537
152 Ga0068861_102075766 3300005719 Unclassified 568
153 Ga0068851_10055521 3300005834 Bacteria 2018
154 Ga0068870_10078138 3300005840 Unclassified 1822
155 Ga0068870_10138343 3300005840 Bacteria 1422
156 Ga0068870_10529774 3300005840 Unclassified 790
157 Ga0068863_100082449 3300005841 Bacteria 3048
158 Ga0068863_100199496 3300005841 Bacteria 1924
159 Ga0068863_100351969 3300005841 Unclassified 1434
160 Ga0068858_100147704 3300005842 Bacteria 2209
161 Ga0068858_100507941 3300005842 Bacteria 1165
162 Ga0068860_100321763 3300005843 Bacteria 1518
163 Ga0068860_100800072 3300005843 Bacteria 956
164 Ga0068860_101630341 3300005843 Bacteria 667
165 Ga0068862_100059830 3300005844 Bacteria 3272
166 Ga0068862_100283290 3300005844 Bacteria 1519
167 Ga0068862_100693598 3300005844 Unclassified 986
168 Ga0068862_101348160 3300005844 Bacteria 716
169 Ga0068862_102717563 3300005844 Unclassified 507
170 Ga0075432_10231120 3300006058 Bacteria 743
171 Ga0070716_100000014 3300006173 Bacteria 92762
172 Ga0097621_100169619 3300006237 Bacteria 1880
173 Ga0068871_100007961 3300006358 Bacteria 7602
174 Ga0068871_100227199 3300006358 Unclassified 1619
175 Ga0068871_101712571 3300006358 Bacteria 596
176 Ga0075428_100890910 3300006844 Bacteria 944
177 Ga0075430_100055375 3300006846 Bacteria 3335
178 Ga0075430_100966801 3300006846 Unclassified 702
179 Ga0075431_100061839 3300006847 Unclassified 3863
180 Ga0075433_10101010 3300006852 Bacteria 2554
181 Ga0075433_10634469 3300006852 Unclassified 937
182 Ga0075434_100393417 3300006871 Bacteria 1407
183 Ga0075429_100013432 3300006880 Bacteria 7101
184 Ga0075429_100238459 3300006880 Unclassified 1593
185 Ga0068865_100019423 3300006881 Bacteria 4397
186 Ga0097620_100015802 3300006931 Bacteria 7583
187 Ga0097620_100039425 3300006931 Archaea 4738
188 Ga0097620_100136921 3300006931 Bacteria 2522
189 Ga0097620_100368833 3300006931 Bacteria 1531
190 Ga0097620_100481498 3300006931 Unclassified 1336
191 Ga0097620_100675077 3300006931 Bacteria 1124
192 Ga0097620_100859831 3300006931 Bacteria 993
193 Ga0097620_102176611 3300006931 Unclassified 612
194 Ga0097620_103073730 3300006931 Bacteria 509
195 Ga0097620_103089440 3300006931 Unclassified 508
196 Ga0099794_10444774 3300007265 Bacteria 679
197 Ga0105251_10152806 3300009011 Bacteria 1042
198 Ga0105240_11904323 3300009093 Bacteria 619
199 Ga0111539_10336517 3300009094 Bacteria 1757
200 Ga0111539_10620011 3300009094 Bacteria 1260
201 Ga0105245_10052881 3300009098 Bacteria 3644
202 Ga0105245_11961671 3300009098 Unclassified 639
203 Ga0105247_10712080 3300009101 Unclassified 757
204 Ga0105247_11499962 3300009101 Unclassified 550
205 Ga0114129_10019437 3300009147 Bacteria 9671
206 Ga0114129_10059572 3300009147 Bacteria 5338
207 Ga0114129_10197329 3300009147 Bacteria 2728
208 Ga0114129_10356597 3300009147 Unclassified 1936
209 Ga0114129_10503636 3300009147 Unclassified 1581
210 Ga0114129_11828271 3300009147 Unclassified 738
211 Ga0114129_12858549 3300009147 Bacteria 572
212 Ga0105243_10094549 3300009148 Unclassified 2468
213 Ga0105243_11404022 3300009148 Unclassified 719
214 Ga0105243_11629157 3300009148 Bacteria 673
215 Ga0105243_12533943 3300009148 Unclassified 552
216 Ga0105243_12982407 3300009148 Unclassified 513
217 Ga0105241_10213995 3300009174 Bacteria 1616
218 Ga0105241_11562014 3300009174 Unclassified 637
219 Ga0105241_12161682 3300009174 Unclassified 551
220 Ga0105241_12161740 3300009174 Bacteria 551
221 Ga0105241_12705742 3300009174 Unclassified 500
222 Ga0105242_10098547 3300009176 Bacteria 2472
223 Ga0105248_10036754 3300009177 Bacteria 5477
224 Ga0105248_10246632 3300009177 Bacteria 2010
225 Ga0105248_10747333 3300009177 Unclassified 1104
226 Ga0105248_12642274 3300009177 Unclassified 572
227 Ga0105237_10001827 3300009545 Bacteria 27453
228 Ga0105237_10708625 3300009545 Bacteria 1013
229 Ga0105237_11501768 3300009545 Unclassified 680
230 Ga0105237_11975662 3300009545 Unclassified 592
231 Ga0105249_10105643 3300009553 Bacteria 2655
232 Ga0105249_10394467 3300009553 Bacteria 1413
233 Ga0105249_11417574 3300009553 Unclassified 767
234 Ga0105249_12499976 3300009553 Bacteria 589
235 Ga0105249_13335582 3300009553 Unclassified 517
236 Ga0105239_10058550 3300010375 Bacteria 4228
237 Ga0105239_10510711 3300010375 Bacteria 1367
238 Ga0105239_10710840 3300010375 Unclassified 1149
239 Ga0105246_10006703 3300011119 Bacteria 7039
240 Ga0105246_10060886 3300011119 Unclassified 2624
241 Ga0105246_11136324 3300011119 Unclassified 715
242 Ga0105246_11997035 3300011119 Unclassified 559
243 Ga0157373_10015766 3300013100 Bacteria 5519
244 Ga0157373_10058938 3300013100 Bacteria 2721
245 Ga0157373_11338857 3300013100 Unclassified 543
246 Ga0157371_10096940 3300013102 Bacteria 2090
247 Ga0157374_10076620 3300013296 Unclassified 3162
248 Ga0157378_10054631 3300013297 Bacteria 3556
249 Ga0157378_10310720 3300013297 Bacteria 1529
250 Ga0157378_10881337 3300013297 Bacteria 925
251 Ga0157378_10956336 3300013297 Unclassified 889
252 Ga0157378_11044198 3300013297 Unclassified 853
253 Ga0157378_11541656 3300013297 Unclassified 710
254 Ga0157378_11964991 3300013297 Bacteria 634
255 Ga0163162_10141811 3300013306 Unclassified 2517
256 Ga0163162_10390738 3300013306 Bacteria 1524
257 Ga0163162_11756859 3300013306 Unclassified 709
258 Ga0157372_10108201 3300013307 Unclassified 3181
259 Ga0157372_10212840 3300013307 Bacteria 2240
260 Ga0157372_12028179 3300013307 Unclassified 661
261 Ga0157375_10085937 3300013308 Bacteria 3196
262 Ga0157375_10418575 3300013308 Unclassified 1506
263 Ga0157375_10425381 3300013308 Bacteria 1494
264 Ga0157375_12178916 3300013308 Bacteria 660
265 Ga0157375_13748771 3300013308 Bacteria 505
266 Ga0163163_10102827 3300014325 Bacteria 2881
267 Ga0163163_10111602 3300014325 Bacteria 2763
268 Ga0163163_10864795 3300014325 Bacteria 967
269 Ga0163163_10928223 3300014325 Unclassified 934
270 Ga0163163_11278927 3300014325 Unclassified 796
271 Ga0157380_10014031 3300014326 Archaea 5855
272 Ga0157380_10959031 3300014326 Unclassified 886
273 Ga0157380_12723201 3300014326 Unclassified 561
274 Ga0157377_10004797 3300014745 Bacteria 6274
275 Ga0157377_10188842 3300014745 Unclassified 1301
276 Ga0157377_10270045 3300014745 Bacteria 1110
277 Ga0157377_10852892 3300014745 Unclassified 676
278 Ga0157379_10263940 3300014968 Bacteria 1565
279 Ga0157379_11229721 3300014968 Bacteria 721
280 Ga0157376_10025811 3300014969 Unclassified 4633
281 Ga0157376_11951987 3300014969 Unclassified 624
282 Ga0207656_10038632 3300025321 Bacteria 2015
283 Ga0207653_10003326 3300025885 Bacteria 5077
284 Ga0207653_10128264 3300025885 Unclassified 919
285 Ga0207653_10301301 3300025885 Unclassified 621
286 Ga0207642_10217770 3300025899 Bacteria 1065
287 Ga0207688_10148195 3300025901 Bacteria 1385
288 Ga0207647_10071396 3300025904 Unclassified 2095
289 Ga0207647_10381796 3300025904 Unclassified 795
290 Ga0207647_10571642 3300025904 Unclassified 625
291 Ga0207645_10353954 3300025907 Bacteria 983
292 Ga0207643_10026514 3300025908 Bacteria 3209
293 Ga0207643_10055764 3300025908 Bacteria 2247
294 Ga0207643_10147527 3300025908 Bacteria 1408
295 Ga0207643_10436870 3300025908 Bacteria 831
296 Ga0207643_10855917 3300025908 Unclassified 589
297 Ga0207654_10226421 3300025911 Bacteria 1243
298 Ga0207654_10740005 3300025911 Unclassified 708
299 Ga0207707_10017199 3300025912 Bacteria 6302
300 Ga0207707_10257042 3300025912 Bacteria 1516
301 Ga0207695_11261103 3300025913 Bacteria 619
302 Ga0207671_10021329 3300025914 Bacteria 4916
303 Ga0207671_10358460 3300025914 Bacteria 1157
304 Ga0207660_10050210 3300025917 Bacteria 2961
305 Ga0207660_10162480 3300025917 Bacteria 1724
306 Ga0207662_10005918 3300025918 Bacteria 6564
307 Ga0207662_10129621 3300025918 Unclassified 1589
308 Ga0207662_10352755 3300025918 Unclassified 988
309 Ga0207657_10078316 3300025919 Unclassified 2783
310 Ga0207657_10870466 3300025919 Bacteria 695
311 Ga0207649_10725959 3300025920 Bacteria 772
312 Ga0207652_10014028 3300025921 Bacteria 6487
313 Ga0207646_10299194 3300025922 Bacteria 1454
314 Ga0207681_10165839 3300025923 Bacteria 1670
315 Ga0207681_10459359 3300025923 Bacteria 1037
316 Ga0207650_10042714 3300025925 Bacteria 3326
317 Ga0207650_11022366 3300025925 Bacteria 703
318 Ga0207650_11171489 3300025925 Unclassified 654
319 Ga0207659_10320567 3300025926 Bacteria 1278
320 Ga0207659_11222411 3300025926 Unclassified 646
321 Ga0207687_10256566 3300025927 Bacteria 1392
322 Ga0207687_10971967 3300025927 Bacteria 728
323 Ga0207687_11241298 3300025927 Bacteria 641
324 Ga0207687_11757677 3300025927 Unclassified 531
325 Ga0207644_10254914 3300025931 Unclassified 1401
326 Ga0207644_10790071 3300025931 Bacteria 794
327 Ga0207690_10048880 3300025932 Unclassified 2816
328 Ga0207686_10403962 3300025934 Bacteria 1041
329 Ga0207670_10572886 3300025936 Bacteria 925
330 Ga0207670_10942544 3300025936 Bacteria 724
331 Ga0207669_10083582 3300025937 Bacteria 2054
332 Ga0207704_10363715 3300025938 Bacteria 1130
333 Ga0207665_10000029 3300025939 Bacteria 95174
334 Ga0207691_10012497 3300025940 Bacteria 8141
335 Ga0207711_10924801 3300025941 Bacteria 810
336 Ga0207689_10003938 3300025942 Bacteria 13516
337 Ga0207689_10046343 3300025942 Bacteria 3593
338 Ga0207689_10768329 3300025942 Bacteria 813
339 Ga0207689_11562337 3300025942 Unclassified 550
340 Ga0207679_10032221 3300025945 Bacteria 3676
341 Ga0207679_11830282 3300025945 Bacteria 554
342 Ga0207667_11208533 3300025949 Bacteria 735
343 Ga0207651_10348418 3300025960 Bacteria 1246
344 Ga0207651_10370266 3300025960 Unclassified 1212
345 Ga0207651_10624587 3300025960 Bacteria 944
346 Ga0207651_10644974 3300025960 Bacteria 929
347 Ga0207651_11099568 3300025960 Bacteria 712
348 Ga0207651_11148553 3300025960 Unclassified 697
349 Ga0207712_10814548 3300025961 Unclassified 821
350 Ga0207640_10061375 3300025981 Bacteria 2490
351 Ga0207640_10094111 3300025981 Bacteria 2083
352 Ga0207640_10116272 3300025981 Bacteria 1906
353 Ga0207658_10245216 3300025986 Bacteria 1520
354 Ga0207677_11078951 3300026023 Unclassified 731
355 Ga0207703_10276510 3300026035 Bacteria 1523
356 Ga0207703_10411987 3300026035 Unclassified 1256
357 Ga0207639_11626313 3300026041 Unclassified 606
358 Ga0207708_10090346 3300026075 Bacteria 2361
359 Ga0207708_10144700 3300026075 Bacteria 1867
360 Ga0207708_10288220 3300026075 Unclassified 1332
361 Ga0207708_10365177 3300026075 Unclassified 1187
362 Ga0207708_11478545 3300026075 Unclassified 597
363 Ga0207641_11622171 3300026088 Unclassified 649
364 Ga0207648_10051847 3300026089 Bacteria 3587
365 Ga0207648_10406412 3300026089 Bacteria 1234
366 Ga0207676_10041539 3300026095 Bacteria 3531
367 Ga0207676_10150653 3300026095 Bacteria 2003
368 Ga0207676_10252393 3300026095 Bacteria 1588
369 Ga0207676_10454931 3300026095 Bacteria 1207
370 Ga0207676_10619543 3300026095 Bacteria 1041
371 Ga0207676_10755548 3300026095 Bacteria 946
372 Ga0207676_11263068 3300026095 Bacteria 733
373 Ga0207676_11554423 3300026095 Bacteria 659
374 Ga0207674_10000216 3300026116 Bacteria 71622
375 Ga0207674_10417327 3300026116 Unclassified 1297
376 Ga0207674_10579305 3300026116 Bacteria 1084
377 Ga0207674_10807579 3300026116 Unclassified 905
378 Ga0207674_10887708 3300026116 Bacteria 859
379 Ga0207674_12276532 3300026116 Bacteria 504
380 Ga0207675_100294883 3300026118 Unclassified 1578
381 Ga0207675_102313799 3300026118 Unclassified 551
382 Ga0207683_10076389 3300026121 Bacteria 2966
383 Ga0207698_12106820 3300026142 Unclassified 577
384 Ga0268265_10205105 3300028380 Unclassified 1713
385 Ga0268265_11133032 3300028380 Bacteria 778
386 Ga0268265_11212558 3300028380 Bacteria 752
387 Ga0268265_11618550 3300028380 Bacteria 653
388 Ga0268265_11821761 3300028380 Bacteria 615
389 Ga0268264_10107546 3300028381 Unclassified 2437
390 Ga0268264_10667288 3300028381 Bacteria 1030
391 Ga0268264_10681477 3300028381 Bacteria 1020
392 Ga0307408_100119248 3300031548 Unclassified 2041
393 Ga0307408_100162534 3300031548 Bacteria 1775
394 Ga0307408_100917970 3300031548 Unclassified 802
395 Ga0307405_10090717 3300031731 Bacteria 2023
396 Ga0307405_10281760 3300031731 Unclassified 1251
397 Ga0307405_10824911 3300031731 Unclassified 779
398 Ga0307410_10810857 3300031852 Unclassified 797
399 Ga0307406_10648337 3300031901 Unclassified 876
400 Ga0307407_10094000 3300031903 Bacteria 1845
401 Ga0307412_10231605 3300031911 Bacteria 1423
402 Ga0307412_10249626 3300031911 Unclassified 1377
403 Ga0307412_10341953 3300031911 Bacteria 1198
404 Ga0307409_100118033 3300031995 Bacteria 2240
405 Ga0307416_100071773 3300032002 Unclassified 2878
406 Ga0307416_100398443 3300032002 Unclassified 1413
407 Ga0307416_100809201 3300032002 Unclassified 1033
408 Ga0307416_101320972 3300032002 Unclassified 827
409 Ga0307411_10189773 3300032005 Bacteria 1568
410 Ga0307411_10597044 3300032005 Unclassified 949
411 Ga0307411_11205654 3300032005 Unclassified 686
412 Ga0307415_100321414 3300032126 Unclassified 1290
413 Ga0307415_100539353 3300032126 Unclassified 1027
414 Ga0307415_101641158 3300032126 Unclassified 619
415 Ga0373930_0104426 3300034816 Bacteria 677
416 Ga0373958_0161513 3300034819 Unclassified 567
417 Ga0373940_0047730 3300035088 Bacteria 1195
418 Ga0373952_0008765 3300035092 Bacteria 1924
419 Ga0373941_0003515 3300035115 Bacteria 3554
420 Ga0373960_0391007 3300035121 Unclassified 535
421 Ga0373942_0138734 3300035207 Unclassified 773
422 Ga0373961_0271359 3300035241 Unclassified 620
423 Ga0373931_0013935 3300035691 Bacteria 3923
424 Ga0242422_01394 3300038699 Bacteria 1674
425 Ga0242420_002146 3300038996 Bacteria 2778
426 Ga0439446_0244009 3300042156 Unclassified 618
427 Ga0453683_0173805 3300044673 Unclassified 1365
428 Ga0451576_1257431 3300045051 Bacteria 772
429 Ga0495620_0171243 3300046515 Unclassified 842
430 Ga0495621_0178966 3300046539 Unclassified 845
431 Ga0496102_0767284 3300048905 Bacteria 887
432 Ga0496106_0044235 3300048909 Unclassified 3342
433 Ga0496107_0064198 3300048910 Bacteria 2662
434 Ga0496107_0162581 3300048910 Bacteria 1655
435 Ga0496108_0348608 3300048911 Bacteria 1292
436 Ga0496109_0366386 3300048912 Bacteria 1361
437 Ga0496110_1702732 3300048913 Bacteria 541
438 Ga0496112_0386474 3300048915 Bacteria 1340
439 Ga0496112_0618960 3300048915 Bacteria 1014
440 Ga0496113_0552278 3300048916 Bacteria 924
441 Ga0501290_017369 3300049513 Unclassified 964
442 Ga0501291_010845 3300049514 Unclassified 1304
443 Ga0501292_001325 3300049515 Unclassified 3047
444 Ga0501295_150753 3300049518 Unclassified 574
445 Ga0501296_010054 3300049519 Bacteria 1117
446 Ga0501297_034194 3300049520 Unclassified 689
447 Ga0501298_050809 3300049521 Bacteria 860
448 Ga0501299_092054 3300049522 Unclassified 691
449 Ga0501042_0182048 3300049578 Bacteria 1516
450 Ga0501048_0097527 3300049582 Bacteria 2074
451 Ga0501071_0259676 3300049587 Unclassified 1312
452 Ga0501077_0233262 3300049593 Bacteria 1170
453 Ga0501201_006975 3300049651 Unclassified 1076
454 Ga0501206_008367 3300049653 Bacteria 1367
455 Ga0501207_011875 3300049654 Unclassified 1302
456 Ga0501207_025578 3300049654 Unclassified 969
457 Ga0501207_041747 3300049654 Unclassified 799
458 Ga0501208_071932 3300049655 Unclassified 697
459 Ga0501208_103429 3300049655 Unclassified 612
460 Ga0501210_008700 3300049657 Unclassified 788
461 Ga0501216_097264 3300049660 Unclassified 644
462 Ga0501217_076823 3300049661 Bacteria 918
463 Ga0501217_076842 3300049661 Bacteria 918
464 Ga0501223_074249 3300049663 Unclassified 675
465 Ga0501223_083510 3300049663 Bacteria 642
466 Ga0501235_027411 3300049669 Unclassified 1278
467 Ga0501235_037048 3300049669 Unclassified 1109
468 Ga0501235_184820 3300049669 Unclassified 557
469 Ga0501236_020296 3300049670 Unclassified 976
470 Ga0501243_009485 3300049675 Unclassified 1514
471 Ga0501247_016487 3300049677 Unclassified 930
472 Ga0501249_029691 3300049679 Bacteria 1216
473 Ga0501251_008758 3300049681 Bacteria 1151
474 Ga0501253_027869 3300049683 Bacteria 1053
475 Ga0501219_003415 3300049703 Bacteria 1151
476 Ga0501221_011798 3300049704 Unclassified 1580
477 Ga0501225_0006076 3300049705 Unclassified 3527
478 Ga0501225_0009710 3300049705 Bacteria 2737
479 Ga0501245_024458 3300049708 Unclassified 965
480 Ga0501079_0162977 3300049741 Bacteria 1739
481 Ga0501266_002199 3300049763 Bacteria 2465
482 Ga0501268_040399 3300049765 Unclassified 876
483 Ga0501268_114836 3300049765 Unclassified 591
484 Ga0501283_018831 3300049779 Unclassified 1089
485 Ga0501204_013291 3300049850 Bacteria 998
486 nmdc:mga05p37_1033609_c1 3300050507 Bacteria 869
487 nmdc:mga05p37_1163013_c1 3300050507 Unclassified 801
488 nmdc:mga05p37_375467_c1 3300050507 Unclassified 1667
489 nmdc:mga05p37_54185_c1 3300050507 Bacteria 4934
490 nmdc:mga09592_125430_c1 3300050508 Unclassified 2207
491 nmdc:mga09592_389179_c1 3300050508 Unclassified 1205
492 nmdc:mga0qj67_810546_c1 3300050509 Bacteria 741
493 nmdc:mga06r32_737737_c1 3300050510 Bacteria 949
494 nmdc:mga0n895_1542401_c1 3300050512 Unclassified 630
495 nmdc:mga0n895_1639449_c1 3300050512 Unclassified 607
496 nmdc:mga0n895_652373_c1 3300050512 Unclassified 1051
497 nmdc:mga0rr50_42370_c1 3300050513 Bacteria 3324
498 nmdc:mga0a205_251994_c1 3300050515 Bacteria 1645
499 Ga0070692_10230912
500 SwRhRL2b_contig_232455
501 rootL2_10199559
502 Ga0065714_10064436
503 Ga0065704_10010747
504 Ga0065704_10159911
505 Ga0065704_10161384
506 Ga0065704_10575150
507 Ga0065712_10000112
508 Ga0065712_10006866
509 Ga0065712_10288894
510 Ga0065712_10406494
511 Ga0065715_10134448
512 Ga0065715_10407279
513 Ga0065715_10744614
514 Ga0065707_10008393
515 Ga0065707_10093733
516 Ga0065707_10096876
517 Ga0070676_10281337
518 Ga0070690_100078312
519 Ga0070670_100104236
520 Ga0070670_100287838
521 Ga0070670_100532696
522 Ga0070670_100755855
523 Ga0070677_10334177
524 Ga0068869_100007332
525 Ga0068869_100083740
526 Ga0068869_100311092
527 Ga0068869_101286944
528 Ga0068869_101580660
529 Ga0070666_10366727
530 Ga0070680_100022719
531 Ga0070680_100197041
532 Ga0070680_100573168
533 Ga0070682_100014703
534 Ga0070660_100015607
535 Ga0070660_101399585
536 Ga0070689_100189406
537 Ga0070689_100645716
538 Ga0070689_102126741
539 Ga0070687_100012079
540 Ga0070661_100945309
541 Ga0070692_10028821
542 Ga0070692_11081753
543 Ga0070692_11318891
544 Ga0070668_100843224
545 Ga0070669_100184706
546 Ga0070669_100339659
547 Ga0070669_100748751
548 Ga0070669_102041979
549 Ga0070675_100505270
550 Ga0070675_101738780
551 Ga0070671_100019771
552 Ga0070673_100173480
553 Ga0070673_100506908
554 Ga0070673_100651999
555 Ga0070673_100893077
556 Ga0070688_100006343
557 Ga0070688_100422470
558 Ga0070667_100249834
559 Ga0070703_10599011
560 Ga0070701_10120145
561 Ga0070705_100982910
562 Ga0070700_100072008
563 Ga0070700_100293841
564 Ga0070700_101005044
565 Ga0070694_100059735
566 Ga0070694_100299188
567 Ga0070694_100671894
568 Ga0070694_101500005
569 Ga0070694_101587641
570 Ga0070678_100437336
571 Ga0070681_10642136
572 Ga0068867_100011956
573 Ga0068867_100134063
574 Ga0068867_100254535
575 Ga0070685_10439217
576 Ga0070706_100008640
577 Ga0070707_101162321
578 Ga0070698_100022162
579 Ga0070698_101122022
580 Ga0070698_101960975
581 Ga0070699_100009306
582 Ga0070699_100359146
583 Ga0070679_100019240
584 Ga0068853_100080750
585 Ga0068853_100223284
586 Ga0068853_100831662
587 Ga0070672_100123449
588 Ga0070672_100737957
589 Ga0070672_101543055
590 Ga0070695_100779581
591 Ga0070695_101176910
592 Ga0070695_101199582
593 Ga0070696_100113896
594 Ga0070696_100269492
595 Ga0070696_100628749
596 Ga0070696_101720863
597 Ga0070696_101754870
598 Ga0070693_100030879
599 Ga0070693_100134096
600 Ga0070693_100266275
601 Ga0070693_100680305
602 Ga0070693_100979907
603 Ga0070704_100107143
604 Ga0070704_100522305
605 Ga0070704_100614749
606 Ga0070704_101035347
607 Ga0070664_100009535
608 Ga0070664_100143034
609 Ga0070664_100624996
610 Ga0070664_100993503
611 Ga0068857_100011666
612 Ga0068857_100317224
613 Ga0068857_100388607
614 Ga0068857_100485154
615 Ga0068857_102058715
616 Ga0068854_100066581
617 Ga0068854_100075037
618 Ga0068854_100122825
619 Ga0068854_100147086
620 Ga0068854_100838961
621 Ga0070702_100073501
622 Ga0070702_100158363
623 Ga0070702_100650384
624 Ga0068852_100721280
625 Ga0068852_101188643
626 Ga0068859_100015803
627 Ga0068859_100039424
628 Ga0068859_100136923
629 Ga0068859_100368835
630 Ga0068859_100481515
631 Ga0068859_100675070
632 Ga0068859_100859868
633 Ga0068859_102177247
634 Ga0068859_103075249
635 Ga0068859_103090171
636 Ga0068864_100015189
637 Ga0068864_100107525
638 Ga0068864_100189104
639 Ga0068864_100205404
640 Ga0068864_100342281
641 Ga0068864_100360558
642 Ga0068864_100527778
643 Ga0068864_100531413
644 Ga0068864_101004386
645 Ga0068864_101738381
646 Ga0068864_101754616
647 Ga0068866_10056388
648 Ga0068861_100068845
649 Ga0068861_100241359
650 Ga0068861_102075766
651 Ga0068851_10055521
652 Ga0068870_10078138
653 Ga0068870_10138343
654 Ga0068870_10529774
655 Ga0068863_100082449
656 Ga0068863_100199496
657 Ga0068863_100351969
658 Ga0068858_100147704
659 Ga0068858_100507941
660 Ga0068860_100321763
661 Ga0068860_100800072
662 Ga0068860_101630341
663 Ga0068862_100059830
664 Ga0068862_100283290
665 Ga0068862_100693598
666 Ga0068862_101348160
667 Ga0068862_102717563
668 Ga0075432_10231120
669 Ga0070716_100000014
670 Ga0097621_100169619
671 Ga0068871_100007961
672 Ga0068871_100227199
673 Ga0068871_101712571
674 Ga0075428_100890910
675 Ga0075430_100055375
676 Ga0075430_100966801
677 Ga0075431_100061839
678 Ga0075433_10101010
679 Ga0075433_10634469
680 Ga0075434_100393417
681 Ga0075429_100013432
682 Ga0075429_100238459
683 Ga0068865_100019423
684 Ga0097620_100015802
685 Ga0097620_100039425
686 Ga0097620_100136921
687 Ga0097620_100368833
688 Ga0097620_100481498
689 Ga0097620_100675077
690 Ga0097620_100859831
691 Ga0097620_102176611
692 Ga0097620_103073730
693 Ga0097620_103089440
694 Ga0099794_10444774
695 Ga0105251_10152806
696 Ga0105240_11904323
697 Ga0111539_10336517
698 Ga0111539_10620011
699 Ga0105245_10052881
700 Ga0105245_11961671
701 Ga0105247_10712080
702 Ga0105247_11499962
703 Ga0114129_10019437
704 Ga0114129_10059572
705 Ga0114129_10197329
706 Ga0114129_10356597
707 Ga0114129_10503636
708 Ga0114129_11828271
709 Ga0114129_12858549
710 Ga0105243_10094549
711 Ga0105243_11404022
712 Ga0105243_11629157
713 Ga0105243_12533943
714 Ga0105243_12982407
715 Ga0105241_10213995
716 Ga0105241_11562014
717 Ga0105241_12161682
718 Ga0105241_12161740
719 Ga0105241_12705742
720 Ga0105242_10098547
721 Ga0105248_10036754
722 Ga0105248_10246632
723 Ga0105248_10747333
724 Ga0105248_12642274
725 Ga0105237_10001827
726 Ga0105237_10708625
727 Ga0105237_11501768
728 Ga0105237_11975662
729 Ga0105249_10105643
730 Ga0105249_10394467
731 Ga0105249_11417574
732 Ga0105249_12499976
733 Ga0105249_13335582
734 Ga0105239_10058550
735 Ga0105239_10510711
736 Ga0105239_10710840
737 Ga0105246_10006703
738 Ga0105246_10060886
739 Ga0105246_11136324
740 Ga0105246_11997035
741 Ga0157373_10015766
742 Ga0157373_10058938
743 Ga0157373_11338857
744 Ga0157371_10096940
745 Ga0157374_10076620
746 Ga0157378_10054631
747 Ga0157378_10310720
748 Ga0157378_10881337
749 Ga0157378_10956336
750 Ga0157378_11044198
751 Ga0157378_11541656
752 Ga0157378_11964991
753 Ga0163162_10141811
754 Ga0163162_10390738
755 Ga0163162_11756859
756 Ga0157372_10108201
757 Ga0157372_10212840
758 Ga0157372_12028179
759 Ga0157375_10085937
760 Ga0157375_10418575
761 Ga0157375_10425381
762 Ga0157375_12178916
763 Ga0157375_13748771
764 Ga0163163_10102827
765 Ga0163163_10111602
766 Ga0163163_10864795
767 Ga0163163_10928223
768 Ga0163163_11278927
769 Ga0157380_10014031
770 Ga0157380_10959031
771 Ga0157380_12723201
772 Ga0157377_10004797
773 Ga0157377_10188842
774 Ga0157377_10270045
775 Ga0157377_10852892
776 Ga0157379_10263940
777 Ga0157379_11229721
778 Ga0157376_10025811
779 Ga0157376_11951987
780 Ga0207656_10038632
781 Ga0207653_10003326
782 Ga0207653_10128264
783 Ga0207653_10301301
784 Ga0207642_10217770
785 Ga0207688_10148195
786 Ga0207647_10071396
787 Ga0207647_10381796
788 Ga0207647_10571642
789 Ga0207645_10353954
790 Ga0207643_10026514
791 Ga0207643_10055764
792 Ga0207643_10147527
793 Ga0207643_10436870
794 Ga0207643_10855917
795 Ga0207654_10226421
796 Ga0207654_10740005
797 Ga0207707_10017199
798 Ga0207707_10257042
799 Ga0207695_11261103
800 Ga0207671_10021329
801 Ga0207671_10358460
802 Ga0207660_10050210
803 Ga0207660_10162480
804 Ga0207662_10005918
805 Ga0207662_10129621
806 Ga0207662_10352755
807 Ga0207657_10078316
808 Ga0207657_10870466
809 Ga0207649_10725959
810 Ga0207652_10014028
811 Ga0207646_10299194
812 Ga0207681_10165839
813 Ga0207681_10459359
814 Ga0207650_10042714
815 Ga0207650_11022366
816 Ga0207650_11171489
817 Ga0207659_10320567
818 Ga0207659_11222411
819 Ga0207687_10256566
820 Ga0207687_10971967
821 Ga0207687_11241298
822 Ga0207687_11757677
823 Ga0207644_10254914
824 Ga0207644_10790071
825 Ga0207690_10048880
826 Ga0207686_10403962
827 Ga0207670_10572886
828 Ga0207670_10942544
829 Ga0207669_10083582
830 Ga0207704_10363715
831 Ga0207665_10000029
832 Ga0207691_10012497
833 Ga0207711_10924801
834 Ga0207689_10003938
835 Ga0207689_10046343
836 Ga0207689_10768329
837 Ga0207689_11562337
838 Ga0207679_10032221
839 Ga0207679_11830282
840 Ga0207667_11208533
841 Ga0207651_10348418
842 Ga0207651_10370266
843 Ga0207651_10624587
844 Ga0207651_10644974
845 Ga0207651_11099568
846 Ga0207651_11148553
847 Ga0207712_10814548
848 Ga0207640_10061375
849 Ga0207640_10094111
850 Ga0207640_10116272
851 Ga0207658_10245216
852 Ga0207677_11078951
853 Ga0207703_10276510
854 Ga0207703_10411987
855 Ga0207639_11626313
856 Ga0207708_10090346
857 Ga0207708_10144700
858 Ga0207708_10288220
859 Ga0207708_10365177
860 Ga0207708_11478545
861 Ga0207641_11622171
862 Ga0207648_10051847
863 Ga0207648_10406412
864 Ga0207676_10041539
865 Ga0207676_10150653
866 Ga0207676_10252393
867 Ga0207676_10454931
868 Ga0207676_10619543
869 Ga0207676_10755548
870 Ga0207676_11263068
871 Ga0207676_11554423
872 Ga0207674_10000216
873 Ga0207674_10417327
874 Ga0207674_10579305
875 Ga0207674_10807579
876 Ga0207674_10887708
877 Ga0207674_12276532
878 Ga0207675_100294883
879 Ga0207675_102313799
880 Ga0207683_10076389
881 Ga0207698_12106820
882 Ga0268265_10205105
883 Ga0268265_11133032
884 Ga0268265_11212558
885 Ga0268265_11618550
886 Ga0268265_11821761
887 Ga0268264_10107546
888 Ga0268264_10667288
889 Ga0268264_10681477
890 Ga0307408_100119248
891 Ga0307408_100162534
892 Ga0307408_100917970
893 Ga0307405_10090717
894 Ga0307405_10281760
895 Ga0307405_10824911
896 Ga0307410_10810857
897 Ga0307406_10648337
898 Ga0307407_10094000
899 Ga0307412_10231605
900 Ga0307412_10249626
901 Ga0307412_10341953
902 Ga0307409_100118033
903 Ga0307416_100071773
904 Ga0307416_100398443
905 Ga0307416_100809201
906 Ga0307416_101320972
907 Ga0307411_10189773
908 Ga0307411_10597044
909 Ga0307411_11205654
910 Ga0307415_100321414
911 Ga0307415_100539353
912 Ga0307415_101641158
913 Ga0373930_0104426
914 Ga0373958_0161513
915 Ga0373940_0047730
916 Ga0373952_0008765
917 Ga0373941_0003515
918 Ga0373960_0391007
919 Ga0373942_0138734
920 Ga0373961_0271359
921 Ga0373931_0013935
922 Ga0242422_01394
923 Ga0242420_002146
924 Ga0439446_0244009
925 Ga0453683_0173805
926 Ga0451576_1257431
927 Ga0495620_0171243
928 Ga0495621_0178966
929 Ga0496102_0767284
930 Ga0496106_0044235
931 Ga0496107_0064198
932 Ga0496107_0162581
933 Ga0496108_0348608
934 Ga0496109_0366386
935 Ga0496110_1702732
936 Ga0496112_0386474
937 Ga0496112_0618960
938 Ga0496113_0552278
939 Ga0501290_017369
940 Ga0501291_010845
941 Ga0501292_001325
942 Ga0501295_150753
943 Ga0501296_010054
944 Ga0501297_034194
945 Ga0501298_050809
946 Ga0501299_092054
947 Ga0501042_0182048
948 Ga0501048_0097527
949 Ga0501071_0259676
950 Ga0501077_0233262
951 Ga0501201_006975
952 Ga0501206_008367
953 Ga0501207_011875
954 Ga0501207_025578
955 Ga0501207_041747
956 Ga0501208_071932
957 Ga0501208_103429
958 Ga0501210_008700
959 Ga0501216_097264
960 Ga0501217_076823
961 Ga0501217_076842
962 Ga0501223_074249
963 Ga0501223_083510
964 Ga0501235_027411
965 Ga0501235_037048
966 Ga0501235_184820
967 Ga0501236_020296
968 Ga0501243_009485
969 Ga0501247_016487
970 Ga0501249_029691
971 Ga0501251_008758
972 Ga0501253_027869
973 Ga0501219_003415
974 Ga0501221_011798
975 Ga0501225_0006076
976 Ga0501225_0009710
977 Ga0501245_024458
978 Ga0501079_0162977
979 Ga0501266_002199
980 Ga0501268_040399
981 Ga0501268_114836
982 Ga0501283_018831
983 Ga0501204_013291
984 nmdc:mga05p37_1033609_c1
985 nmdc:mga05p37_1163013_c1
986 nmdc:mga05p37_375467_c1
987 nmdc:mga05p37_54185_c1
988 nmdc:mga09592_125430_c1
989 nmdc:mga09592_389179_c1
990 nmdc:mga0qj67_810546_c1
991 nmdc:mga06r32_737737_c1
992 nmdc:mga0n895_1542401_c1
993 nmdc:mga0n895_1639449_c1
994 nmdc:mga0n895_652373_c1
995 nmdc:mga0rr50_42370_c1
996 nmdc:mga0a205_251994_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06127

Mpo1-like

2-hydroxy-palmitic acid dioxygenase Mpo1-like

15

51

0.91

PF06127

Mpo1-like

2-hydroxy-palmitic acid dioxygenase Mpo1-like

44

92

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p3r-assembly1.cif.gz_C error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8227 18 62
2yik-assembly1.cif.gz_A catalytic domain of clostridium thermocellum celt 0.7587 13 65
6ys8-assembly1.cif.gz_F structure of gldlm, the proton-powered motor that drives protein transport and gliding motility 0.7556 17 66
1rq5-assembly1.cif.gz_A structural basis for the exocellulase activity of the cellobiohydrolase cbha from c. thermocellum 0.7247 18 66
6ys8-assembly1.cif.gz_E structure of gldlm, the proton-powered motor that drives protein transport and gliding motility 0.6766 13 66
ID Description Score Start End Superfamily
af_P40064_901_1066_1.25.40.450 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Nucleoporin, helical domain, N-terminal subdomain 0.9103 21 53 1.25.40.450
af_Q9VDE4_121_211_1.20.58.80 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.9035 19 53 1.20.58.80
af_K7M4Y5_1_400_1.50.10.10 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; 0.8554 13 63 1.50.10.10
af_P53870_25_540_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.8533 18 59 1.25.10.10
3v5sA01 Special;Helix non-globular;Methane Monooxygenase Hydroxylase; Chain G, domain 1;NCX, peripheral helical region 0.8085 17 57 6.10.280.80
ID Description Score Start End GO Terms
AF-A0A3N5IA83-F1-model_v4 ComEC family DNA internalization-related competence protein 0.9481 15 57 GO:0005886
AF-A0A1S8TMS2-F1-model_v4 Uncharacterized protein 0.9411 17 58 GO:0016020
AF-A0A836UG96-F1-model_v4 DUF5673 domain-containing protein 0.9281 17 57 GO:0016020
AF-A0A090PN17-F1-model_v4 deleted 0.9262 13 57
AF-A0A0P6YA84-F1-model_v4 Zinc metalloprotease 0.9219 18 61 GO:0005886
GO:0006508
GO:0008237
GO:0046872

Map