F455110

General Info

Members Datasets Scaffolds Average Seq Length
497 329 994 112

Family's Representative Sequence

Representative Sequence 3300049824|Ga0501045_0895275|Ga0501045_0895275_235_606
Length 114
Sequence MNRLARVLIVLAGIMGADGVMLAAASAHLPDASRLGAASSMLLFHASAVLAVVALAERALIHARIGLVALFAGDLTLRQYAGHGLFPFAAPTGGTLLIASWLALAVAAAWPRRA

Samples

Sample ID Description Type Environment
1 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
68 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
69 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
70 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
71 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
72 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
73 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
74 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
80 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
81 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
166 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
170 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
171 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
172 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
173 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
174 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
175 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
176 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
177 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
178 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
179 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
180 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
181 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
182 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
183 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
184 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
185 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
186 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
187 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
188 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
189 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
190 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
191 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
192 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
193 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
194 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
195 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
196 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
197 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
198 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
199 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
200 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
201 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
202 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
203 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
204 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
205 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
206 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
207 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
208 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
209 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
210 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
211 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
212 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
213 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
214 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
215 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
216 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
217 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
218 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
219 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
220 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
221 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
222 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
223 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
224 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
225 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
226 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
227 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
228 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
229 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
230 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
231 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
232 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
233 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
234 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
235 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
236 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
237 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
238 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
239 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
240 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
241 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
242 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
243 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
244 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
245 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
246 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
247 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
248 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
249 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
250 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
251 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
252 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
253 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
254 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
255 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
256 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
257 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
258 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
259 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
260 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
261 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
262 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
263 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
264 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
265 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
266 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
267 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
268 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
269 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
270 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
271 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
272 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
273 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
274 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
275 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
276 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
277 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
278 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
279 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
280 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
281 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
282 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
283 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
284 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
285 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
286 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
291 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
292 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
293 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
294 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
295 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
296 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
297 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
298 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
299 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
300 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
301 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
302 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
303 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
304 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
305 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
306 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
307 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
308 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
309 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
310 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
311 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
312 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
313 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
314 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
315 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
316 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
317 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
318 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
319 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
320 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
321 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
322 2791355199
323 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
324 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
325 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
326 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
327 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
328 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
329 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.78
Metatranscriptomes 0.6
Isolates 1.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.46
Nodule 1.21
Rhizoplane 3.62
Rhizosphere 77.06
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501045_0895275 3300049824 Bacteria 652
2 JGI24744J21845_10058854 3300002077 Bacteria 703
3 JGI25153J46596_10002632 3300003215 Bacteria 10264
4 rootH2_10031619 3300003320 Bacteria 1020
5 JGI25404J52841_10017586 3300003659 Bacteria 1550
6 JGI25404J52841_10022192 3300003659 Bacteria 1372
7 JGI25404J52841_10043660 3300003659 Bacteria 947
8 JGI25404J52841_10048808 3300003659 Bacteria 891
9 Ga0070658_10238848 3300005327 Bacteria 1540
10 Ga0070683_100047136 3300005329 Bacteria 3982
11 Ga0068869_100500392 3300005334 Bacteria 1014
12 Ga0070680_100352508 3300005336 Bacteria 1251
13 Ga0070682_100193776 3300005337 Bacteria 1429
14 Ga0068868_100539598 3300005338 Bacteria 1026
15 Ga0068868_100674573 3300005338 Bacteria 922
16 Ga0070660_100032368 3300005339 Bacteria 3934
17 Ga0070660_100896530 3300005339 Bacteria 748
18 Ga0070689_100410925 3300005340 Bacteria 1145
19 Ga0070689_100424470 3300005340 Bacteria 1127
20 Ga0070689_100450967 3300005340 Bacteria 1094
21 Ga0070691_10121442 3300005341 Bacteria 1316
22 Ga0070687_100369703 3300005343 Bacteria 931
23 Ga0070661_100903443 3300005344 Bacteria 729
24 Ga0070661_101849451 3300005344 Bacteria 513
25 Ga0070668_100173755 3300005347 Bacteria 1755
26 Ga0070668_100457237 3300005347 Bacteria 1098
27 Ga0070668_100832508 3300005347 Bacteria 821
28 Ga0070669_100162285 3300005353 Bacteria 1737
29 Ga0070669_100290844 3300005353 Bacteria 1311
30 Ga0070669_100315223 3300005353 Bacteria 1262
31 Ga0070671_100991574 3300005355 Bacteria 736
32 Ga0070674_100097582 3300005356 Bacteria 2134
33 Ga0070674_100168174 3300005356 Bacteria 1669
34 Ga0070674_100687092 3300005356 Bacteria 874
35 Ga0070673_100725994 3300005364 Bacteria 914
36 Ga0070688_100451045 3300005365 Bacteria 962
37 Ga0070659_100158466 3300005366 Bacteria 1850
38 Ga0070659_100465012 3300005366 Bacteria 1075
39 Ga0070667_100436392 3300005367 Bacteria 1195
40 Ga0070714_100499539 3300005435 Bacteria 1160
41 Ga0070713_100962318 3300005436 Bacteria 823
42 Ga0070701_10380301 3300005438 Bacteria 890
43 Ga0070701_10389259 3300005438 Bacteria 881
44 Ga0070701_10476532 3300005438 Bacteria 806
45 Ga0070711_100072798 3300005439 Bacteria 2425
46 Ga0070711_100667738 3300005439 Bacteria 873
47 Ga0070711_101224723 3300005439 Bacteria 650
48 Ga0070705_100391816 3300005440 Bacteria 1026
49 Ga0070700_100051352 3300005441 Bacteria 2566
50 Ga0070694_100301116 3300005444 Bacteria 1229
51 Ga0070708_101551049 3300005445 Bacteria 617
52 Ga0070663_100007823 3300005455 Bacteria 6534
53 Ga0070663_100079403 3300005455 Bacteria 2407
54 Ga0070663_100767483 3300005455 Bacteria 824
55 Ga0070678_100483861 3300005456 Bacteria 1089
56 Ga0070681_11219188 3300005458 Bacteria 674
57 Ga0068867_100202304 3300005459 Bacteria 1590
58 Ga0070685_10158250 3300005466 Bacteria 1441
59 Ga0070685_10239684 3300005466 Bacteria 1197
60 Ga0070707_100218937 3300005468 Bacteria 1855
61 Ga0070698_100141625 3300005471 Bacteria 2356
62 Ga0070698_100631995 3300005471 Bacteria 1011
63 Ga0070698_100676581 3300005471 Bacteria 974
64 Ga0070699_100615575 3300005518 Bacteria 990
65 Ga0070684_100088869 3300005535 Bacteria 2745
66 Ga0068853_100038695 3300005539 Bacteria 4063
67 Ga0068853_101828294 3300005539 Bacteria 589
68 Ga0070672_100292807 3300005543 Bacteria 1379
69 Ga0070686_100462420 3300005544 Bacteria 977
70 Ga0070686_100502901 3300005544 Bacteria 941
71 Ga0070695_100119269 3300005545 Bacteria 1802
72 Ga0070693_100838845 3300005547 Bacteria 684
73 Ga0070665_100489087 3300005548 Bacteria 1241
74 Ga0070665_100525889 3300005548 Bacteria 1194
75 Ga0070665_101456277 3300005548 Bacteria 694
76 Ga0068855_100265089 3300005563 Bacteria 1912
77 Ga0068855_100709392 3300005563 Bacteria 1076
78 Ga0070664_100357424 3300005564 Bacteria 1330
79 Ga0070664_100588018 3300005564 Bacteria 1032
80 Ga0068854_100020930 3300005578 Bacteria 4432
81 Ga0068856_100003436 3300005614 Bacteria 16012
82 Ga0070702_100260362 3300005615 Bacteria 1181
83 Ga0068852_100409794 3300005616 Bacteria 1335
84 Ga0068859_100127055 3300005617 Bacteria 2619
85 Ga0068859_100622797 3300005617 Bacteria 1172
86 Ga0068864_100221287 3300005618 Bacteria 1746
87 Ga0068864_100879858 3300005618 Bacteria 884
88 Ga0068866_10031370 3300005718 Bacteria 2559
89 Ga0068861_100205672 3300005719 Bacteria 1655
90 Ga0068861_100228579 3300005719 Bacteria 1576
91 Ga0068861_100526916 3300005719 Bacteria 1072
92 Ga0068851_10028737 3300005834 Bacteria 2747
93 Ga0068870_10433307 3300005840 Bacteria 863
94 Ga0068870_10816972 3300005840 Bacteria 653
95 Ga0068858_100179874 3300005842 Bacteria 1996
96 Ga0068858_100488622 3300005842 Bacteria 1189
97 Ga0068858_100903384 3300005842 Bacteria 864
98 Ga0068860_100002621 3300005843 Bacteria 18698
99 Ga0068860_100203857 3300005843 Bacteria 1917
100 Ga0068860_100589368 3300005843 Bacteria 1116
101 Ga0068860_100693729 3300005843 Bacteria 1028
102 Ga0068860_100714278 3300005843 Bacteria 1012
103 Ga0068862_100139543 3300005844 Bacteria 2150
104 Ga0068862_100725832 3300005844 Bacteria 964
105 Ga0068862_100829889 3300005844 Bacteria 905
106 Ga0081455_10305331 3300005937 Bacteria 1140
107 Ga0081455_10902675 3300005937 Bacteria 549
108 Ga0081540_1005026 3300005983 Bacteria 9930
109 Ga0081540_1013846 3300005983 Bacteria 5216
110 Ga0081540_1019996 3300005983 Bacteria 4045
111 Ga0081540_1027314 3300005983 Bacteria 3237
112 Ga0081540_1031639 3300005983 Bacteria 2905
113 Ga0081540_1045886 3300005983 Bacteria 2213
114 Ga0081540_1118881 3300005983 Bacteria 1101
115 Ga0081539_10001394 3300005985 Bacteria 41637
116 Ga0081539_10302618 3300005985 Bacteria 687
117 Ga0070717_10214646 3300006028 Bacteria 1689
118 Ga0070717_10292792 3300006028 Bacteria 1446
119 Ga0075365_10035352 3300006038 Bacteria 3231
120 Ga0075365_10053796 3300006038 Bacteria 2667
121 Ga0075365_10155730 3300006038 Bacteria 1590
122 Ga0075368_10130859 3300006042 Bacteria 1043
123 Ga0075368_10180428 3300006042 Bacteria 890
124 Ga0075363_100002368 3300006048 Bacteria 7676
125 Ga0075363_100293341 3300006048 Bacteria 943
126 Ga0075362_10176649 3300006177 Bacteria 1033
127 Ga0075362_10207643 3300006177 Bacteria 955
128 Ga0075362_10214489 3300006177 Bacteria 939
129 Ga0075367_10027301 3300006178 Bacteria 3246
130 Ga0075367_10368153 3300006178 Bacteria 908
131 Ga0075369_10094251 3300006186 Bacteria 1338
132 Ga0075369_10122195 3300006186 Bacteria 1179
133 Ga0075366_10163114 3300006195 Bacteria 1351
134 Ga0075366_10306749 3300006195 Bacteria 971
135 Ga0075366_10613281 3300006195 Bacteria 675
136 Ga0075370_10129436 3300006353 Bacteria 1472
137 Ga0075370_10312365 3300006353 Bacteria 935
138 Ga0075434_100429878 3300006871 Bacteria 1342
139 Ga0068865_100178545 3300006881 Bacteria 1633
140 Ga0068865_100492301 3300006881 Bacteria 1021
141 Ga0097620_100127062 3300006931 Bacteria 2619
142 Ga0097620_100622785 3300006931 Bacteria 1172
143 Ga0075435_101520023 3300007076 Bacteria 587
144 Ga0099794_10344068 3300007265 Bacteria 775
145 Ga0099795_10042149 3300007788 Bacteria 1628
146 Ga0099795_10092319 3300007788 Bacteria 1175
147 Ga0099795_10287241 3300007788 Bacteria 720
148 Ga0105250_10040310 3300009092 Bacteria 1873
149 Ga0105250_10198072 3300009092 Bacteria 847
150 Ga0105240_10062401 3300009093 Bacteria 4640
151 Ga0111539_10718164 3300009094 Bacteria 1163
152 Ga0105245_10756057 3300009098 Bacteria 1008
153 Ga0105247_10098605 3300009101 Bacteria 1865
154 Ga0105247_10585515 3300009101 Bacteria 825
155 Ga0105247_11322605 3300009101 Bacteria 580
156 Ga0114129_10256125 3300009147 Bacteria 2347
157 Ga0105243_10042021 3300009148 Bacteria 3577
158 Ga0105243_10410000 3300009148 Bacteria 1261
159 Ga0105243_11517492 3300009148 Bacteria 694
160 Ga0105241_12621903 3300009174 Bacteria 506
161 Ga0105242_12554848 3300009176 Bacteria 559
162 Ga0105248_10673621 3300009177 Bacteria 1167
163 Ga0105248_11514219 3300009177 Bacteria 760
164 Ga0105237_10351316 3300009545 Bacteria 1479
165 Ga0105238_10051843 3300009551 Bacteria 4125
166 Ga0105249_10131789 3300009553 Bacteria 2387
167 Ga0105249_10414702 3300009553 Bacteria 1379
168 Ga0105249_13102846 3300009553 Bacteria 534
169 Ga0105249_13109243 3300009553 Bacteria 533
170 Ga0099796_10500072 3300010159 Bacteria 544
171 Ga0105239_10355233 3300010375 Bacteria 1655
172 Ga0105239_10613620 3300010375 Bacteria 1241
173 Ga0105239_10702170 3300010375 Bacteria 1157
174 Ga0105239_11318254 3300010375 Bacteria 833
175 Ga0157370_10390998 3300013104 Bacteria 1280
176 Ga0157369_10019064 3300013105 Bacteria 7681
177 Ga0157374_10588223 3300013296 Bacteria 1122
178 Ga0157374_10817748 3300013296 Bacteria 948
179 Ga0157374_12211469 3300013296 Bacteria 577
180 Ga0157378_10473537 3300013297 Bacteria 1247
181 Ga0163162_10427127 3300013306 Bacteria 1457
182 Ga0157375_12815637 3300013308 Bacteria 581
183 Ga0163163_10252906 3300014325 Bacteria 1813
184 Ga0163163_11017954 3300014325 Bacteria 892
185 Ga0163163_11977493 3300014325 Bacteria 643
186 Ga0157380_10935504 3300014326 Bacteria 896
187 Ga0157380_12118796 3300014326 Bacteria 625
188 Ga0157377_10083207 3300014745 Bacteria 1874
189 Ga0157377_10151612 3300014745 Bacteria 1434
190 Ga0157379_10490580 3300014968 Bacteria 1138
191 Ga0157376_10068216 3300014969 Bacteria 3011
192 Ga0157376_10581086 3300014969 Bacteria 1113
193 Ga0157376_12568804 3300014969 Bacteria 549
194 Ga0163161_10200016 3300017792 Bacteria 1539
195 Ga0163161_10466115 3300017792 Bacteria 1023
196 Ga0163161_11628051 3300017792 Bacteria 570
197 Ga0206356_10733192 3300020070 Bacteria 714
198 Ga0206353_11812454 3300020082 Bacteria 749
199 Ga0207656_10016061 3300025321 Bacteria 2908
200 Ga0207692_10665859 3300025898 Bacteria 673
201 Ga0207642_10073415 3300025899 Bacteria 1636
202 Ga0207710_10096646 3300025900 Bacteria 1389
203 Ga0207688_10397855 3300025901 Bacteria 854
204 Ga0207680_10125452 3300025903 Bacteria 1685
205 Ga0207699_10295558 3300025906 Bacteria 1130
206 Ga0207645_10021783 3300025907 Bacteria 4175
207 Ga0207645_10432828 3300025907 Bacteria 887
208 Ga0207643_10396586 3300025908 Bacteria 872
209 Ga0207684_10847717 3300025910 Bacteria 770
210 Ga0207707_10002866 3300025912 Bacteria 15405
211 Ga0207695_10220865 3300025913 Bacteria 1802
212 Ga0207671_10128595 3300025914 Bacteria 1943
213 Ga0207671_10838898 3300025914 Bacteria 728
214 Ga0207663_11619782 3300025916 Bacteria 521
215 Ga0207660_10283094 3300025917 Bacteria 1316
216 Ga0207657_10022988 3300025919 Bacteria 5817
217 Ga0207649_10071612 3300025920 Bacteria 2215
218 Ga0207652_10058991 3300025921 Bacteria 3307
219 Ga0207646_10241511 3300025922 Bacteria 1632
220 Ga0207681_10542769 3300025923 Bacteria 956
221 Ga0207681_10980139 3300025923 Bacteria 709
222 Ga0207694_10315129 3300025924 Bacteria 1290
223 Ga0207687_10127926 3300025927 Bacteria 1910
224 Ga0207700_10075569 3300025928 Bacteria 2611
225 Ga0207700_11069533 3300025928 Bacteria 721
226 Ga0207664_10242698 3300025929 Bacteria 1569
227 Ga0207690_10700129 3300025932 Bacteria 833
228 Ga0207706_10275317 3300025933 Bacteria 1468
229 Ga0207686_10181978 3300025934 Bacteria 1491
230 Ga0207709_10732311 3300025935 Bacteria 794
231 Ga0207709_11466351 3300025935 Bacteria 566
232 Ga0207670_10075586 3300025936 Bacteria 2342
233 Ga0207670_10361482 3300025936 Bacteria 1152
234 Ga0207670_10558171 3300025936 Bacteria 936
235 Ga0207669_10183794 3300025937 Bacteria 1501
236 Ga0207704_10993939 3300025938 Bacteria 709
237 Ga0207665_10377962 3300025939 Bacteria 1075
238 Ga0207691_10109706 3300025940 Bacteria 2455
239 Ga0207691_10767186 3300025940 Bacteria 811
240 Ga0207711_10567603 3300025941 Bacteria 1058
241 Ga0207689_10417018 3300025942 Bacteria 1120
242 Ga0207689_10629263 3300025942 Bacteria 904
243 Ga0207689_10765536 3300025942 Bacteria 815
244 Ga0207661_10446583 3300025944 Bacteria 1177
245 Ga0207679_11505239 3300025945 Bacteria 617
246 Ga0207679_11585595 3300025945 Bacteria 600
247 Ga0207667_10081868 3300025949 Bacteria 3344
248 Ga0207667_10586744 3300025949 Bacteria 1125
249 Ga0207712_10159059 3300025961 Bacteria 1753
250 Ga0207712_12105992 3300025961 Bacteria 505
251 Ga0207668_10258580 3300025972 Bacteria 1417
252 Ga0207668_10636228 3300025972 Bacteria 932
253 Ga0207640_10169461 3300025981 Bacteria 1625
254 Ga0207658_10334718 3300025986 Bacteria 1314
255 Ga0207677_10272820 3300026023 Bacteria 1384
256 Ga0207703_10424057 3300026035 Bacteria 1238
257 Ga0207703_10614528 3300026035 Bacteria 1029
258 Ga0207639_10203837 3300026041 Bacteria 1698
259 Ga0207678_10178754 3300026067 Bacteria 1812
260 Ga0207678_10810323 3300026067 Bacteria 827
261 Ga0207678_11458682 3300026067 Bacteria 604
262 Ga0207708_10037118 3300026075 Bacteria 3711
263 Ga0207708_10867631 3300026075 Bacteria 780
264 Ga0207702_10000101 3300026078 Bacteria 99845
265 Ga0207702_10315262 3300026078 Bacteria 1488
266 Ga0207702_10614010 3300026078 Bacteria 1068
267 Ga0207641_10361998 3300026088 Bacteria 1385
268 Ga0207674_10053755 3300026116 Bacteria 4103
269 Ga0207675_100296909 3300026118 Bacteria 1573
270 Ga0207675_100619120 3300026118 Bacteria 1087
271 Ga0207675_101172708 3300026118 Bacteria 788
272 Ga0207675_101649061 3300026118 Bacteria 661
273 Ga0207683_10315132 3300026121 Bacteria 1432
274 Ga0207698_10911109 3300026142 Bacteria 887
275 Ga0207698_11334798 3300026142 Bacteria 732
276 Ga0209179_1016880 3300027512 Bacteria 1375
277 Ga0209588_1056064 3300027671 Bacteria 1274
278 Ga0207428_10127053 3300027907 Bacteria 1952
279 Ga0268266_10426383 3300028379 Bacteria 1257
280 Ga0268266_10589470 3300028379 Bacteria 1067
281 Ga0268266_11314275 3300028379 Bacteria 698
282 Ga0268265_10367893 3300028380 Bacteria 1318
283 Ga0268264_10000187 3300028381 Bacteria 129270
284 Ga0268264_10129699 3300028381 Bacteria 2233
285 Ga0268264_10675971 3300028381 Bacteria 1024
286 Ga0265319_1011957 3300028563 Bacteria 3528
287 Ga0265334_10000741 3300028573 Bacteria 16339
288 Ga0265323_10001701 3300028653 Bacteria 10499
289 Ga0265322_10037472 3300028654 Bacteria 1381
290 Ga0265336_10001237 3300028666 Bacteria 12134
291 Ga0307517_10217613 3300028786 Bacteria 1166
292 Ga0265338_10000973 3300028800 Bacteria 48208
293 Ga0265338_10200794 3300028800 Bacteria 1504
294 Ga0265324_10003799 3300029957 Bacteria 7055
295 Ga0307511_10443182 3300030521 Bacteria 516
296 Ga0265330_10042957 3300031235 Bacteria 2001
297 Ga0265332_10166307 3300031238 Bacteria 921
298 Ga0265340_10002830 3300031247 Bacteria 9870
299 Ga0265339_10005363 3300031249 Bacteria 8538
300 Ga0265339_10056078 3300031249 Bacteria 2135
301 Ga0265331_10061837 3300031250 Bacteria 1767
302 Ga0265316_10198710 3300031344 Bacteria 1487
303 Ga0265316_10378739 3300031344 Bacteria 1021
304 Ga0307509_10108277 3300031507 Bacteria 2792
305 Ga0307508_10146697 3300031616 Bacteria 1963
306 Ga0265314_10011154 3300031711 Bacteria 7447
307 Ga0265314_10654589 3300031711 Bacteria 535
308 Ga0265342_10127769 3300031712 Bacteria 1426
309 Ga0265342_10266033 3300031712 Bacteria 911
310 Ga0307516_10217353 3300031730 Bacteria 1622
311 Ga0307516_10266502 3300031730 Bacteria 1401
312 Ga0307406_10113739 3300031901 Bacteria 1868
313 Ga0307409_101744914 3300031995 Bacteria 651
314 Ga0307416_101282928 3300032002 Bacteria 838
315 Ga0307416_101738384 3300032002 Bacteria 728
316 Ga0307415_100172763 3300032126 Bacteria 1687
317 Ga0307507_10018905 3300033179 Bacteria 7802
318 Ga0307510_10469283 3300033180 Bacteria 700
319 Ga0316215_1018785 3300033544 Bacteria 700
320 Ga0373934_0002341 3300035086 Bacteria 6975
321 Ga0373934_0096484 3300035086 Bacteria 1194
322 Ga0373923_0005063 3300035111 Bacteria 4442
323 Ga0373939_0470941 3300035114 Bacteria 532
324 Ga0373953_0000626 3300035117 Bacteria 9783
325 Ga0373954_0000182 3300035118 Bacteria 22786
326 Ga0373956_0001338 3300035119 Bacteria 10168
327 Ga0373957_0002101 3300035120 Bacteria 5591
328 Ga0373955_0000471 3300035172 Bacteria 16944
329 Ga0373924_0033971 3300035410 Bacteria 2062
330 Ga0373931_0545175 3300035691 Bacteria 753
331 Ga0373931_0924450 3300035691 Bacteria 587
332 Ga0373935_0198563 3300035692 Bacteria 1385
333 Ga0373935_0870950 3300035692 Bacteria 666
334 Ga0373927_0005727 3300035695 Bacteria 8534
335 Ga0373933_0002736 3300035724 Bacteria 9861
336 Ga0373933_0139336 3300035724 Bacteria 1531
337 Ga0373947_0232773 3300035725 Bacteria 1214
338 Ga0373947_0416114 3300035725 Bacteria 908
339 Ga0373937_0030048 3300036401 Bacteria 4921
340 Ga0372808_014234 3300036459 Bacteria 1135
341 Ga0373925_0204297 3300037068 Bacteria 1572
342 Ga0373925_0412733 3300037068 Bacteria 1102
343 Ga0451804_1111529 3300041463 Bacteria 508
344 Ga0451839_0392007 3300041496 Bacteria 524
345 Ga0439431_0244010 3300041997 Bacteria 532
346 Ga0466963_0290885 3300044694 Bacteria 1148
347 Ga0466967_0452183 3300045976 Bacteria 1255
348 Ga0495627_233906 3300046453 Bacteria 504
349 Ga0495592_0002891 3300046454 Bacteria 12215
350 Ga0495629_0005026 3300046459 Bacteria 9912
351 Ga0495629_0883037 3300046459 Bacteria 587
352 Ga0495638_0284183 3300046460 Bacteria 898
353 Ga0495651_0005264 3300046462 Bacteria 9861
354 Ga0495653_0023995 3300046463 Bacteria 4920
355 Ga0495580_0518211 3300046472 Bacteria 795
356 Ga0495605_0120904 3300046474 Bacteria 1187
357 Ga0495664_0200594 3300046477 Bacteria 1209
358 Ga0495584_0683340 3300046491 Bacteria 523
359 Ga0495594_0729487 3300046499 Bacteria 560
360 Ga0495583_0187822 3300046506 Bacteria 844
361 Ga0495608_0002114 3300046511 Bacteria 14307
362 Ga0495608_0625861 3300046511 Bacteria 645
363 Ga0495616_0175718 3300046513 Bacteria 955
364 Ga0495628_0057570 3300046516 Bacteria 3057
365 Ga0495630_0155634 3300046517 Bacteria 1740
366 Ga0495644_0068468 3300046523 Bacteria 1333
367 Ga0495648_0008803 3300046524 Bacteria 7896
368 Ga0495663_0029770 3300046525 Bacteria 1614
369 Ga0495652_0028805 3300046529 Bacteria 4882
370 Ga0495652_0631210 3300046529 Bacteria 727
371 Ga0495640_0035954 3300046533 Bacteria 3503
372 Ga0495587_0000403 3300046536 Bacteria 30588
373 Ga0495621_0239242 3300046539 Bacteria 739
374 Ga0495645_0020507 3300046543 Bacteria 4771
375 Ga0495622_0026644 3300046557 Bacteria 2698
376 Ga0495667_0007602 3300046559 Bacteria 7356
377 Ga0495656_0084204 3300046615 Bacteria 1441
378 Ga0495634_0019425 3300046642 Bacteria 4828
379 Ga0495635_0018102 3300046663 Bacteria 4920
380 Ga0495657_0001964 3300046675 Bacteria 17524
381 Ga0495599_0002959 3300046678 Bacteria 9885
382 Ga0495599_0625280 3300046678 Bacteria 625
383 Ga0495623_0003813 3300046679 Bacteria 9940
384 Ga0495646_0003545 3300046680 Bacteria 9724
385 Ga0495658_0170978 3300046683 Bacteria 1345
386 Ga0495669_0015156 3300046684 Bacteria 3298
387 Ga0495613_0022713 3300046689 Bacteria 4674
388 Ga0495649_0476641 3300046694 Bacteria 622
389 Ga0495600_0000221 3300046809 Bacteria 32170
390 Ga0495581_0214518 3300047315 Bacteria 1125
391 Ga0495604_0023528 3300047317 Bacteria 4914
392 Ga0495674_0040425 3300047319 Bacteria 4171
393 Ga0495680_0049664 3300047322 Bacteria 3284
394 Ga0495683_0272083 3300047323 Bacteria 736
395 Ga0495675_0000445 3300047444 Bacteria 27423
396 Ga0495684_0002603 3300047471 Bacteria 14332
397 Ga0495593_0004768 3300047673 Bacteria 8059
398 Ga0495602_0000907 3300048088 Bacteria 28629
399 Ga0495615_0150638 3300048090 Bacteria 692
400 Ga0496100_0251640 3300048903 Bacteria 1307
401 Ga0496100_0312148 3300048903 Bacteria 1179
402 Ga0496101_0497468 3300048904 Bacteria 963
403 Ga0496102_0057997 3300048905 Bacteria 3537
404 Ga0496103_0232564 3300048906 Bacteria 1186
405 Ga0496106_0028844 3300048909 Bacteria 4135
406 Ga0496106_0431865 3300048909 Bacteria 1058
407 Ga0496106_0775863 3300048909 Bacteria 761
408 Ga0496108_0316949 3300048911 Bacteria 1359
409 Ga0496109_0427300 3300048912 Bacteria 1251
410 Ga0496109_0664313 3300048912 Bacteria 979
411 Ga0496110_0104379 3300048913 Bacteria 2543
412 Ga0496112_0231322 3300048915 Bacteria 1803
413 Ga0496114_0291353 3300048917 Bacteria 1440
414 Ga0496114_0555524 3300048917 Bacteria 1014
415 Ga0496115_0816933 3300048918 Bacteria 724
416 Ga0496115_1440712 3300048918 Bacteria 507
417 Ga0496116_0054192 3300048919 Bacteria 2644
418 Ga0496116_0270007 3300048919 Bacteria 832
419 Ga0496117_0045366 3300048920 Bacteria 3175
420 Ga0496118_0096801 3300048921 Bacteria 2010
421 Ga0496118_0103410 3300048921 Bacteria 1916
422 Ga0496119_0307977 3300048922 Bacteria 779
423 Ga0496120_0052824 3300048923 Bacteria 2312
424 Ga0496120_0244692 3300048923 Bacteria 845
425 Ga0496120_0280738 3300048923 Bacteria 770
426 Ga0496121_0000144 3300048924 Bacteria 156856
427 Ga0496121_0004170 3300048924 Bacteria 19757
428 Ga0496121_0008147 3300048924 Bacteria 12447
429 Ga0496121_0031148 3300048924 Bacteria 4881
430 Ga0496121_0088792 3300048924 Bacteria 2422
431 Ga0496121_0117177 3300048924 Bacteria 2018
432 Ga0496121_0150947 3300048924 Bacteria 1710
433 Ga0496121_0155499 3300048924 Bacteria 1678
434 Ga0496124_0002408 3300048927 Bacteria 24540
435 Ga0496125_0000595 3300048928 Bacteria 61641
436 Ga0496125_0020757 3300048928 Bacteria 6157
437 Ga0496125_0022857 3300048928 Bacteria 5793
438 Ga0496125_0159460 3300048928 Bacteria 1535
439 Ga0496126_0006769 3300048929 Bacteria 12718
440 Ga0496126_0008346 3300048929 Bacteria 11179
441 Ga0496126_0063413 3300048929 Bacteria 3312
442 Ga0496126_0351462 3300048929 Bacteria 1205
443 Ga0496126_0357019 3300048929 Bacteria 1194
444 Ga0496126_1284122 3300048929 Bacteria 534
445 Ga0501038_0926255 3300049574 Bacteria 642
446 Ga0501041_0230895 3300049577 Bacteria 1162
447 Ga0501042_0416317 3300049578 Bacteria 974
448 Ga0501048_1052788 3300049582 Bacteria 585
449 Ga0501067_0071435 3300049583 Bacteria 1922
450 Ga0501071_0263200 3300049587 Bacteria 1303
451 Ga0501076_0112790 3300049592 Bacteria 2199
452 Ga0501081_0652114 3300049743 Bacteria 789
453 nmdc:mga0yw44_248297_c1 3300050492 Bacteria 1184
454 nmdc:mga0yw44_46759_c1 3300050492 Bacteria 2601
455 nmdc:mga0k408_44276_c1 3300050493 Bacteria 2566
456 nmdc:mga07m45_125634_c1 3300050496 Bacteria 1483
457 nmdc:mga05p37_68114_c1 3300050507 Bacteria 4377
458 nmdc:mga08y16_145666_c1 3300050511 Bacteria 2462
459 nmdc:mga0n895_111649_c1 3300050512 Bacteria 2750
460 nmdc:mga0a205_1537963_c1 3300050515 Bacteria 513
461 nmdc:mga0sz30_344880_c1 3300050516 Bacteria 665
462 nmdc:mga0sz30_41268_c1 3300050516 Bacteria 1940
463 Ga0495601_0032340 3300053077 Bacteria 3256
464 Ga0500635_0039187 3300053080 Bacteria 1575
465 Ga0495655_0141889 3300053083 Bacteria 749
466 Ga0495595_0002289 3300053084 Bacteria 7457
467 Ga0495619_0002350 3300053085 Bacteria 12447
468 Ga0500647_0143129 3300053091 Bacteria 1120
469 Ga0500595_002699 3300053119 Bacteria 8602
470 Ga0500595_004767 3300053119 Bacteria 6007
471 Ga0500595_028684 3300053119 Bacteria 1896
472 Ga0500595_050175 3300053119 Bacteria 1297
473 Ga0500559_0019073 3300053136 Bacteria 2898
474 Ga0500559_0241161 3300053136 Bacteria 852
475 Ga0500573_0113189 3300053140 Bacteria 1516
476 Ga0500577_0056678 3300053142 Bacteria 1492
477 Ga0500590_139953 3300053148 Bacteria 1107
478 Ga0500603_135571 3300053150 Bacteria 755
479 Ga0500638_046253 3300053162 Bacteria 2110
480 Ga0500639_334613 3300053163 Bacteria 546
481 Ga0500636_0088609 3300053177 Bacteria 1774
482 Ga0500636_0176270 3300053177 Bacteria 1152
483 Ga0500637_0076710 3300053178 Bacteria 1927
484 Ga0500637_0138289 3300053178 Bacteria 1410
485 Ga0500637_0499086 3300053178 Bacteria 604
486 Ga0500552_008804 3300053733 Bacteria 1201
487 Ga0500596_073952 3300053735 Bacteria 585
488 Ga0501082_0439380 3300060353 Bacteria 1140
489 2723849143 2721755755 Bacteria 8322773
490 2793078502
491 2874606918 2874604998 Bacteria 7834745
492 2876810676 2876808645 Bacteria 8824342
493 2879112571 2879110137 Bacteria 8907982
494 2889036166 2889033259 Bacteria 9099371
495 2922364540 2922361189 Bacteria 7436256
496 8006971404 8006964411 Bacteria 8966052
497 8056678388 8056673599 Bacteria 7871253
498 Ga0501045_0895275
499 JGI24744J21845_10058854
500 JGI25153J46596_10002632
501 rootH2_10031619
502 JGI25404J52841_10017586
503 JGI25404J52841_10022192
504 JGI25404J52841_10043660
505 JGI25404J52841_10048808
506 Ga0070658_10238848
507 Ga0070683_100047136
508 Ga0068869_100500392
509 Ga0070680_100352508
510 Ga0070682_100193776
511 Ga0068868_100539598
512 Ga0068868_100674573
513 Ga0070660_100032368
514 Ga0070660_100896530
515 Ga0070689_100410925
516 Ga0070689_100424470
517 Ga0070689_100450967
518 Ga0070691_10121442
519 Ga0070687_100369703
520 Ga0070661_100903443
521 Ga0070661_101849451
522 Ga0070668_100173755
523 Ga0070668_100457237
524 Ga0070668_100832508
525 Ga0070669_100162285
526 Ga0070669_100290844
527 Ga0070669_100315223
528 Ga0070671_100991574
529 Ga0070674_100097582
530 Ga0070674_100168174
531 Ga0070674_100687092
532 Ga0070673_100725994
533 Ga0070688_100451045
534 Ga0070659_100158466
535 Ga0070659_100465012
536 Ga0070667_100436392
537 Ga0070714_100499539
538 Ga0070713_100962318
539 Ga0070701_10380301
540 Ga0070701_10389259
541 Ga0070701_10476532
542 Ga0070711_100072798
543 Ga0070711_100667738
544 Ga0070711_101224723
545 Ga0070705_100391816
546 Ga0070700_100051352
547 Ga0070694_100301116
548 Ga0070708_101551049
549 Ga0070663_100007823
550 Ga0070663_100079403
551 Ga0070663_100767483
552 Ga0070678_100483861
553 Ga0070681_11219188
554 Ga0068867_100202304
555 Ga0070685_10158250
556 Ga0070685_10239684
557 Ga0070707_100218937
558 Ga0070698_100141625
559 Ga0070698_100631995
560 Ga0070698_100676581
561 Ga0070699_100615575
562 Ga0070684_100088869
563 Ga0068853_100038695
564 Ga0068853_101828294
565 Ga0070672_100292807
566 Ga0070686_100462420
567 Ga0070686_100502901
568 Ga0070695_100119269
569 Ga0070693_100838845
570 Ga0070665_100489087
571 Ga0070665_100525889
572 Ga0070665_101456277
573 Ga0068855_100265089
574 Ga0068855_100709392
575 Ga0070664_100357424
576 Ga0070664_100588018
577 Ga0068854_100020930
578 Ga0068856_100003436
579 Ga0070702_100260362
580 Ga0068852_100409794
581 Ga0068859_100127055
582 Ga0068859_100622797
583 Ga0068864_100221287
584 Ga0068864_100879858
585 Ga0068866_10031370
586 Ga0068861_100205672
587 Ga0068861_100228579
588 Ga0068861_100526916
589 Ga0068851_10028737
590 Ga0068870_10433307
591 Ga0068870_10816972
592 Ga0068858_100179874
593 Ga0068858_100488622
594 Ga0068858_100903384
595 Ga0068860_100002621
596 Ga0068860_100203857
597 Ga0068860_100589368
598 Ga0068860_100693729
599 Ga0068860_100714278
600 Ga0068862_100139543
601 Ga0068862_100725832
602 Ga0068862_100829889
603 Ga0081455_10305331
604 Ga0081455_10902675
605 Ga0081540_1005026
606 Ga0081540_1013846
607 Ga0081540_1019996
608 Ga0081540_1027314
609 Ga0081540_1031639
610 Ga0081540_1045886
611 Ga0081540_1118881
612 Ga0081539_10001394
613 Ga0081539_10302618
614 Ga0070717_10214646
615 Ga0070717_10292792
616 Ga0075365_10035352
617 Ga0075365_10053796
618 Ga0075365_10155730
619 Ga0075368_10130859
620 Ga0075368_10180428
621 Ga0075363_100002368
622 Ga0075363_100293341
623 Ga0075362_10176649
624 Ga0075362_10207643
625 Ga0075362_10214489
626 Ga0075367_10027301
627 Ga0075367_10368153
628 Ga0075369_10094251
629 Ga0075369_10122195
630 Ga0075366_10163114
631 Ga0075366_10306749
632 Ga0075366_10613281
633 Ga0075370_10129436
634 Ga0075370_10312365
635 Ga0075434_100429878
636 Ga0068865_100178545
637 Ga0068865_100492301
638 Ga0097620_100127062
639 Ga0097620_100622785
640 Ga0075435_101520023
641 Ga0099794_10344068
642 Ga0099795_10042149
643 Ga0099795_10092319
644 Ga0099795_10287241
645 Ga0105250_10040310
646 Ga0105250_10198072
647 Ga0105240_10062401
648 Ga0111539_10718164
649 Ga0105245_10756057
650 Ga0105247_10098605
651 Ga0105247_10585515
652 Ga0105247_11322605
653 Ga0114129_10256125
654 Ga0105243_10042021
655 Ga0105243_10410000
656 Ga0105243_11517492
657 Ga0105241_12621903
658 Ga0105242_12554848
659 Ga0105248_10673621
660 Ga0105248_11514219
661 Ga0105237_10351316
662 Ga0105238_10051843
663 Ga0105249_10131789
664 Ga0105249_10414702
665 Ga0105249_13102846
666 Ga0105249_13109243
667 Ga0099796_10500072
668 Ga0105239_10355233
669 Ga0105239_10613620
670 Ga0105239_10702170
671 Ga0105239_11318254
672 Ga0157370_10390998
673 Ga0157369_10019064
674 Ga0157374_10588223
675 Ga0157374_10817748
676 Ga0157374_12211469
677 Ga0157378_10473537
678 Ga0163162_10427127
679 Ga0157375_12815637
680 Ga0163163_10252906
681 Ga0163163_11017954
682 Ga0163163_11977493
683 Ga0157380_10935504
684 Ga0157380_12118796
685 Ga0157377_10083207
686 Ga0157377_10151612
687 Ga0157379_10490580
688 Ga0157376_10068216
689 Ga0157376_10581086
690 Ga0157376_12568804
691 Ga0163161_10200016
692 Ga0163161_10466115
693 Ga0163161_11628051
694 Ga0206356_10733192
695 Ga0206353_11812454
696 Ga0207656_10016061
697 Ga0207692_10665859
698 Ga0207642_10073415
699 Ga0207710_10096646
700 Ga0207688_10397855
701 Ga0207680_10125452
702 Ga0207699_10295558
703 Ga0207645_10021783
704 Ga0207645_10432828
705 Ga0207643_10396586
706 Ga0207684_10847717
707 Ga0207707_10002866
708 Ga0207695_10220865
709 Ga0207671_10128595
710 Ga0207671_10838898
711 Ga0207663_11619782
712 Ga0207660_10283094
713 Ga0207657_10022988
714 Ga0207649_10071612
715 Ga0207652_10058991
716 Ga0207646_10241511
717 Ga0207681_10542769
718 Ga0207681_10980139
719 Ga0207694_10315129
720 Ga0207687_10127926
721 Ga0207700_10075569
722 Ga0207700_11069533
723 Ga0207664_10242698
724 Ga0207690_10700129
725 Ga0207706_10275317
726 Ga0207686_10181978
727 Ga0207709_10732311
728 Ga0207709_11466351
729 Ga0207670_10075586
730 Ga0207670_10361482
731 Ga0207670_10558171
732 Ga0207669_10183794
733 Ga0207704_10993939
734 Ga0207665_10377962
735 Ga0207691_10109706
736 Ga0207691_10767186
737 Ga0207711_10567603
738 Ga0207689_10417018
739 Ga0207689_10629263
740 Ga0207689_10765536
741 Ga0207661_10446583
742 Ga0207679_11505239
743 Ga0207679_11585595
744 Ga0207667_10081868
745 Ga0207667_10586744
746 Ga0207712_10159059
747 Ga0207712_12105992
748 Ga0207668_10258580
749 Ga0207668_10636228
750 Ga0207640_10169461
751 Ga0207658_10334718
752 Ga0207677_10272820
753 Ga0207703_10424057
754 Ga0207703_10614528
755 Ga0207639_10203837
756 Ga0207678_10178754
757 Ga0207678_10810323
758 Ga0207678_11458682
759 Ga0207708_10037118
760 Ga0207708_10867631
761 Ga0207702_10000101
762 Ga0207702_10315262
763 Ga0207702_10614010
764 Ga0207641_10361998
765 Ga0207674_10053755
766 Ga0207675_100296909
767 Ga0207675_100619120
768 Ga0207675_101172708
769 Ga0207675_101649061
770 Ga0207683_10315132
771 Ga0207698_10911109
772 Ga0207698_11334798
773 Ga0209179_1016880
774 Ga0209588_1056064
775 Ga0207428_10127053
776 Ga0268266_10426383
777 Ga0268266_10589470
778 Ga0268266_11314275
779 Ga0268265_10367893
780 Ga0268264_10000187
781 Ga0268264_10129699
782 Ga0268264_10675971
783 Ga0265319_1011957
784 Ga0265334_10000741
785 Ga0265323_10001701
786 Ga0265322_10037472
787 Ga0265336_10001237
788 Ga0307517_10217613
789 Ga0265338_10000973
790 Ga0265338_10200794
791 Ga0265324_10003799
792 Ga0307511_10443182
793 Ga0265330_10042957
794 Ga0265332_10166307
795 Ga0265340_10002830
796 Ga0265339_10005363
797 Ga0265339_10056078
798 Ga0265331_10061837
799 Ga0265316_10198710
800 Ga0265316_10378739
801 Ga0307509_10108277
802 Ga0307508_10146697
803 Ga0265314_10011154
804 Ga0265314_10654589
805 Ga0265342_10127769
806 Ga0265342_10266033
807 Ga0307516_10217353
808 Ga0307516_10266502
809 Ga0307406_10113739
810 Ga0307409_101744914
811 Ga0307416_101282928
812 Ga0307416_101738384
813 Ga0307415_100172763
814 Ga0307507_10018905
815 Ga0307510_10469283
816 Ga0316215_1018785
817 Ga0373934_0002341
818 Ga0373934_0096484
819 Ga0373923_0005063
820 Ga0373939_0470941
821 Ga0373953_0000626
822 Ga0373954_0000182
823 Ga0373956_0001338
824 Ga0373957_0002101
825 Ga0373955_0000471
826 Ga0373924_0033971
827 Ga0373931_0545175
828 Ga0373931_0924450
829 Ga0373935_0198563
830 Ga0373935_0870950
831 Ga0373927_0005727
832 Ga0373933_0002736
833 Ga0373933_0139336
834 Ga0373947_0232773
835 Ga0373947_0416114
836 Ga0373937_0030048
837 Ga0372808_014234
838 Ga0373925_0204297
839 Ga0373925_0412733
840 Ga0451804_1111529
841 Ga0451839_0392007
842 Ga0439431_0244010
843 Ga0466963_0290885
844 Ga0466967_0452183
845 Ga0495627_233906
846 Ga0495592_0002891
847 Ga0495629_0005026
848 Ga0495629_0883037
849 Ga0495638_0284183
850 Ga0495651_0005264
851 Ga0495653_0023995
852 Ga0495580_0518211
853 Ga0495605_0120904
854 Ga0495664_0200594
855 Ga0495584_0683340
856 Ga0495594_0729487
857 Ga0495583_0187822
858 Ga0495608_0002114
859 Ga0495608_0625861
860 Ga0495616_0175718
861 Ga0495628_0057570
862 Ga0495630_0155634
863 Ga0495644_0068468
864 Ga0495648_0008803
865 Ga0495663_0029770
866 Ga0495652_0028805
867 Ga0495652_0631210
868 Ga0495640_0035954
869 Ga0495587_0000403
870 Ga0495621_0239242
871 Ga0495645_0020507
872 Ga0495622_0026644
873 Ga0495667_0007602
874 Ga0495656_0084204
875 Ga0495634_0019425
876 Ga0495635_0018102
877 Ga0495657_0001964
878 Ga0495599_0002959
879 Ga0495599_0625280
880 Ga0495623_0003813
881 Ga0495646_0003545
882 Ga0495658_0170978
883 Ga0495669_0015156
884 Ga0495613_0022713
885 Ga0495649_0476641
886 Ga0495600_0000221
887 Ga0495581_0214518
888 Ga0495604_0023528
889 Ga0495674_0040425
890 Ga0495680_0049664
891 Ga0495683_0272083
892 Ga0495675_0000445
893 Ga0495684_0002603
894 Ga0495593_0004768
895 Ga0495602_0000907
896 Ga0495615_0150638
897 Ga0496100_0251640
898 Ga0496100_0312148
899 Ga0496101_0497468
900 Ga0496102_0057997
901 Ga0496103_0232564
902 Ga0496106_0028844
903 Ga0496106_0431865
904 Ga0496106_0775863
905 Ga0496108_0316949
906 Ga0496109_0427300
907 Ga0496109_0664313
908 Ga0496110_0104379
909 Ga0496112_0231322
910 Ga0496114_0291353
911 Ga0496114_0555524
912 Ga0496115_0816933
913 Ga0496115_1440712
914 Ga0496116_0054192
915 Ga0496116_0270007
916 Ga0496117_0045366
917 Ga0496118_0096801
918 Ga0496118_0103410
919 Ga0496119_0307977
920 Ga0496120_0052824
921 Ga0496120_0244692
922 Ga0496120_0280738
923 Ga0496121_0000144
924 Ga0496121_0004170
925 Ga0496121_0008147
926 Ga0496121_0031148
927 Ga0496121_0088792
928 Ga0496121_0117177
929 Ga0496121_0150947
930 Ga0496121_0155499
931 Ga0496124_0002408
932 Ga0496125_0000595
933 Ga0496125_0020757
934 Ga0496125_0022857
935 Ga0496125_0159460
936 Ga0496126_0006769
937 Ga0496126_0008346
938 Ga0496126_0063413
939 Ga0496126_0351462
940 Ga0496126_0357019
941 Ga0496126_1284122
942 Ga0501038_0926255
943 Ga0501041_0230895
944 Ga0501042_0416317
945 Ga0501048_1052788
946 Ga0501067_0071435
947 Ga0501071_0263200
948 Ga0501076_0112790
949 Ga0501081_0652114
950 nmdc:mga0yw44_248297_c1
951 nmdc:mga0yw44_46759_c1
952 nmdc:mga0k408_44276_c1
953 nmdc:mga07m45_125634_c1
954 nmdc:mga05p37_68114_c1
955 nmdc:mga08y16_145666_c1
956 nmdc:mga0n895_111649_c1
957 nmdc:mga0a205_1537963_c1
958 nmdc:mga0sz30_344880_c1
959 nmdc:mga0sz30_41268_c1
960 Ga0495601_0032340
961 Ga0500635_0039187
962 Ga0495655_0141889
963 Ga0495595_0002289
964 Ga0495619_0002350
965 Ga0500647_0143129
966 Ga0500595_002699
967 Ga0500595_004767
968 Ga0500595_028684
969 Ga0500595_050175
970 Ga0500559_0019073
971 Ga0500559_0241161
972 Ga0500573_0113189
973 Ga0500577_0056678
974 Ga0500590_139953
975 Ga0500603_135571
976 Ga0500638_046253
977 Ga0500639_334613
978 Ga0500636_0088609
979 Ga0500636_0176270
980 Ga0500637_0076710
981 Ga0500637_0138289
982 Ga0500637_0499086
983 Ga0500552_008804
984 Ga0500596_073952
985 Ga0501082_0439380
986 2723849143
987 2793078502
988 2874606918
989 2876810676
990 2879112571
991 2889036166
992 2922364540
993 8006971404
994 8056678388

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5dwk-assembly1.cif.gz_B diacylglycerol kinase solved by multi crystal multi orientation native sad 0.663 20 100
7dgw-assembly1.cif.gz_A de novo designed protein h4a2s 0.5954 2 105
7dgw-assembly1.cif.gz_A de novo designed protein h4a2s 0.5708 2 105
5h6i-assembly2.cif.gz_B crystal structure of gbs camp factor 0.5599 27 102
6zvo-assembly1.cif.gz_A crystal structure of unliganded mlkl executioner domain 0.5479 1 104
ID Description Score Start End Superfamily
5dwkB00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.663 20 100 1.10.287.3610
1ocoP01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.6328 51 105 1.10.287.70
1ocoC01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.6326 51 105 1.10.287.70
af_F1LVJ1_87_191_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.6242 45 98 1.20.140.150
af_B7FF21_6_121_1.20.930.20 Mainly Alpha;Up-down Bundle;Transcription Elongation Factor S-II; Chain A;Adaptor protein Cbl, N-terminal domain 0.5799 3 100 1.20.930.20
ID Description Score Start End GO Terms
AF-A0A3N6N441-F1-model_v4 DUF423 domain-containing protein 0.9704 22 104 GO:0016020
AF-A0A1I5HW59-F1-model_v4 Uncharacterized membrane protein YgdD, TMEM256/DUF423 family 0.9341 5 103 GO:0016020
AF-A0A258L060-F1-model_v4 DUF423 domain-containing protein 0.934 3 100 GO:0016020
AF-A0A4V1P196-F1-model_v4 deleted 0.9329 4 105
AF-A0A7T8BPY8-F1-model_v4 deleted 0.9315 4 104

Map