F455108

General Info

Members Datasets Scaffolds Average Seq Length
497 269 994 188

Family's Representative Sequence

Representative Sequence 3300049580|Ga0501046_0606494|Ga0501046_0606494_85_735
Length 216
Sequence LIRKAAENTVRASQSRGRKPVGDEDRENPMSATTNGQVNNGVNVQALIDARAALTEAPAAAQFNWRATCTWKNGTHSHSTVKGFFGLGEEQKHKTTFSFDADHPEVFASEDHGATPVEFVLVALASCLTAGVAAVAQHRGIQLRSVSATVEGAMDLQGILGIDSDVRNGFSGIKVTYDIDADASRDDIKALVAQSQKRSAVYDIITNPTNVTVEVK

Samples

Sample ID Description Type Environment
1 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
2 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
50 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
84 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
85 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
86 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
87 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
88 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
89 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
128 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
129 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
130 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
131 3300030888 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
134 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
135 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
136 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
137 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
138 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
139 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
140 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
141 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
142 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
143 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
144 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
145 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
146 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
147 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
148 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
149 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
150 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
151 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
152 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
153 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
154 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
155 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
156 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
157 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
158 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
159 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
160 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
161 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
162 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
163 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
164 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
165 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
166 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
167 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
168 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
169 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
170 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
171 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
172 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
173 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
174 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
175 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
176 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
177 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
178 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
179 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
180 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
181 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
182 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
183 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
184 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
185 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
186 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
187 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
188 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
189 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
190 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
191 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
192 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
193 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
194 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
195 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
196 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
197 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
198 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
199 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
200 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
201 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
202 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
203 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
204 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
205 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
206 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
207 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
208 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
209 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
210 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
211 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
212 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
213 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
214 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
215 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
216 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
217 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
218 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
219 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
220 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
221 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
222 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
223 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
224 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
225 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
226 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
227 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
228 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
229 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
230 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
244 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
245 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
246 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
247 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
248 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
249 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
250 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
251 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
252 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
253 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
254 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
255 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
256 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
258 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
259 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
260 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
261 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
262 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
263 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
264 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
265 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
266 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
267 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
268 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
269 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.99
Metatranscriptomes 1.01
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.8
Nodule 0
Rhizoplane 5.63
Rhizosphere 91.55
Stem 0
Stem Tuber 0
Unclassified 1.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501046_0606494 3300049580 Unclassified 776
2 Ga0058859_11617028 3300004798 Bacteria 1109
3 Ga0065712_10329901 3300005290 Bacteria 815
4 Ga0070670_100011361 3300005331 Bacteria 7611
5 Ga0070670_100248309 3300005331 Bacteria 1550
6 Ga0068868_100166358 3300005338 Bacteria 1824
7 Ga0070689_100264502 3300005340 Bacteria 1422
8 Ga0070687_100150556 3300005343 Bacteria 1365
9 Ga0070687_100300727 3300005343 Bacteria 1018
10 Ga0070668_100609276 3300005347 Bacteria 956
11 Ga0070669_100050199 3300005353 Bacteria 3047
12 Ga0070669_100099632 3300005353 Bacteria 2190
13 Ga0070669_100270295 3300005353 Bacteria 1359
14 Ga0070669_100356741 3300005353 Bacteria 1188
15 Ga0070669_100655184 3300005353 Bacteria 884
16 Ga0070675_100409556 3300005354 Bacteria 1211
17 Ga0070671_100008557 3300005355 Bacteria 8204
18 Ga0070671_100569028 3300005355 Bacteria 978
19 Ga0070673_100062447 3300005364 Bacteria 2959
20 Ga0070688_100002361 3300005365 Bacteria 9525
21 Ga0070688_100033505 3300005365 Bacteria 3106
22 Ga0070659_100161928 3300005366 Bacteria 1830
23 Ga0070667_100005319 3300005367 Bacteria 10751
24 Ga0070667_100190220 3300005367 Bacteria 1818
25 Ga0070667_100502986 3300005367 Bacteria 1111
26 Ga0070703_10153351 3300005406 Bacteria 867
27 Ga0070709_10000811 3300005434 Bacteria 17423
28 Ga0070709_10045026 3300005434 Bacteria 2736
29 Ga0070709_10863395 3300005434 Bacteria 714
30 Ga0070714_100005591 3300005435 Bacteria 9606
31 Ga0070714_100016764 3300005435 Bacteria 5924
32 Ga0070714_100202916 3300005435 Bacteria 1814
33 Ga0070714_100304397 3300005435 Bacteria 1487
34 Ga0070714_100326715 3300005435 Bacteria 1436
35 Ga0070713_100005039 3300005436 Bacteria 8982
36 Ga0070713_100014313 3300005436 Bacteria 5885
37 Ga0070713_100211626 3300005436 Bacteria 1755
38 Ga0070713_100680343 3300005436 Bacteria 981
39 Ga0070710_10016052 3300005437 Bacteria 3802
40 Ga0070710_10160978 3300005437 Bacteria 1392
41 Ga0070701_10588258 3300005438 Bacteria 735
42 Ga0070711_100103327 3300005439 Bacteria 2077
43 Ga0070694_100027686 3300005444 Bacteria 3684
44 Ga0070694_100662099 3300005444 Unclassified 846
45 Ga0070708_100026066 3300005445 Bacteria 5001
46 Ga0070678_100138995 3300005456 Bacteria 1941
47 Ga0070685_10071246 3300005466 Bacteria 2060
48 Ga0070706_100001577 3300005467 Bacteria 23786
49 Ga0070706_100024113 3300005467 Bacteria 5600
50 Ga0070706_100048101 3300005467 Bacteria 3936
51 Ga0070707_100000512 3300005468 Bacteria 38630
52 Ga0070707_100020521 3300005468 Bacteria 6235
53 Ga0070707_100219839 3300005468 Bacteria 1850
54 Ga0070707_100628776 3300005468 Bacteria 1036
55 Ga0070698_100000855 3300005471 Bacteria 33419
56 Ga0070698_100002470 3300005471 Bacteria 20404
57 Ga0070698_100008694 3300005471 Bacteria 10937
58 Ga0070698_100022465 3300005471 Bacteria 6600
59 Ga0070698_100234364 3300005471 Bacteria 1769
60 Ga0070698_100268101 3300005471 Bacteria 1639
61 Ga0070699_100187952 3300005518 Bacteria 1834
62 Ga0070699_100546453 3300005518 Bacteria 1054
63 Ga0070697_100091317 3300005536 Bacteria 2518
64 Ga0070697_100910740 3300005536 Bacteria 780
65 Ga0070672_100002915 3300005543 Bacteria 11007
66 Ga0070672_100006827 3300005543 Bacteria 7706
67 Ga0070672_100540970 3300005543 Bacteria 1010
68 Ga0070686_100066125 3300005544 Bacteria 2350
69 Ga0070686_100087787 3300005544 Bacteria 2074
70 Ga0070695_100198511 3300005545 Bacteria 1432
71 Ga0070665_100088688 3300005548 Bacteria 3099
72 Ga0070665_101056640 3300005548 Unclassified 824
73 Ga0070704_100039180 3300005549 Bacteria 3252
74 Ga0070704_100044945 3300005549 Bacteria 3072
75 Ga0070704_100128172 3300005549 Bacteria 1962
76 Ga0070704_100369374 3300005549 Unclassified 1216
77 Ga0070664_100043174 3300005564 Bacteria 3804
78 Ga0068856_101059275 3300005614 Bacteria 829
79 Ga0070702_100226830 3300005615 Bacteria 1252
80 Ga0068852_100586237 3300005616 Bacteria 1118
81 Ga0068859_100000031 3300005617 Bacteria 174715
82 Ga0068859_100011045 3300005617 Bacteria 9086
83 Ga0068859_100339429 3300005617 Bacteria 1596
84 Ga0068864_100519890 3300005618 Bacteria 1147
85 Ga0068861_100000477 3300005719 Bacteria 23302
86 Ga0068863_100001243 3300005841 Bacteria 25378
87 Ga0068863_100034838 3300005841 Bacteria 4795
88 Ga0068858_100058361 3300005842 Bacteria 3568
89 Ga0068858_100136650 3300005842 Bacteria 2300
90 Ga0068858_100139428 3300005842 Bacteria 2276
91 Ga0068862_100495292 3300005844 Bacteria 1159
92 Ga0070717_10025081 3300006028 Bacteria 4736
93 Ga0070717_10036441 3300006028 Bacteria 3989
94 Ga0070717_10063926 3300006028 Bacteria 3056
95 Ga0070717_10084382 3300006028 Bacteria 2672
96 Ga0070717_10343468 3300006028 Bacteria 1333
97 Ga0075365_10452949 3300006038 Bacteria 906
98 Ga0075363_100021325 3300006048 Bacteria 3261
99 Ga0070715_10017295 3300006163 Bacteria 2728
100 Ga0070716_100121495 3300006173 Bacteria 1636
101 Ga0070712_100042317 3300006175 Bacteria 3132
102 Ga0070712_100187602 3300006175 Bacteria 1616
103 Ga0070712_100240700 3300006175 Bacteria 1441
104 Ga0075369_10081693 3300006186 Bacteria 1434
105 Ga0068871_100308913 3300006358 Bacteria 1390
106 Ga0075428_100027862 3300006844 Bacteria 6251
107 Ga0075428_100115300 3300006844 Bacteria 2927
108 Ga0075428_101070796 3300006844 Bacteria 852
109 Ga0075430_100462565 3300006846 Bacteria 1047
110 Ga0075430_100639469 3300006846 Bacteria 877
111 Ga0075431_100001911 3300006847 Bacteria 19787
112 Ga0075433_10024237 3300006852 Bacteria 5118
113 Ga0075433_10186318 3300006852 Bacteria 1846
114 Ga0075433_10313053 3300006852 Bacteria 1389
115 Ga0075434_100024568 3300006871 Bacteria 5892
116 Ga0075434_100134419 3300006871 Bacteria 2493
117 Ga0075429_100094801 3300006880 Bacteria 2603
118 Ga0068865_100826130 3300006881 Bacteria 801
119 Ga0075436_100007686 3300006914 Bacteria 7365
120 Ga0097620_100000031 3300006931 Bacteria 174715
121 Ga0097620_100011045 3300006931 Bacteria 9086
122 Ga0097620_100339445 3300006931 Bacteria 1596
123 Ga0075435_100066936 3300007076 Bacteria 2924
124 Ga0111539_10023822 3300009094 Bacteria 7522
125 Ga0105245_11123923 3300009098 Bacteria 832
126 Ga0105247_10186833 3300009101 Bacteria 1385
127 Ga0105247_10348246 3300009101 Bacteria 1041
128 Ga0114129_10005971 3300009147 Bacteria 17243
129 Ga0114129_10072973 3300009147 Bacteria 4782
130 Ga0114129_10205677 3300009147 Bacteria 2663
131 Ga0105243_10134670 3300009148 Bacteria 2101
132 Ga0105241_10317400 3300009174 Bacteria 1342
133 Ga0105248_10001228 3300009177 Bacteria 28626
134 Ga0105248_10183314 3300009177 Bacteria 2359
135 Ga0105248_10458420 3300009177 Bacteria 1437
136 Ga0105248_10847912 3300009177 Bacteria 1031
137 Ga0105237_10066572 3300009545 Bacteria 3597
138 Ga0105238_10512053 3300009551 Bacteria 1202
139 Ga0105249_10144496 3300009553 Bacteria 2284
140 Ga0105249_10973871 3300009553 Bacteria 916
141 Ga0105239_10264474 3300010375 Bacteria 1934
142 Ga0105239_11579469 3300010375 Bacteria 758
143 Ga0105246_10141012 3300011119 Bacteria 1812
144 Ga0157374_11121793 3300013296 Bacteria 807
145 Ga0157378_10129262 3300013297 Bacteria 2336
146 Ga0157375_10262452 3300013308 Bacteria 1889
147 Ga0157375_10263206 3300013308 Bacteria 1886
148 Ga0157375_11793301 3300013308 Bacteria 727
149 Ga0157379_10000057 3300014968 Bacteria 70302
150 Ga0157376_10188647 3300014969 Bacteria 1889
151 Ga0157376_10440051 3300014969 Bacteria 1269
152 Ga0163161_10146440 3300017792 Bacteria 1792
153 Ga0213876_10353124 3300021384 Bacteria 782
154 Ga0213875_10001958 3300021388 Bacteria 12743
155 Ga0213871_10197612 3300021441 Bacteria 626
156 Ga0224571_102751 3300022734 Bacteria 1121
157 Ga0224572_1010573 3300024225 Bacteria 1739
158 Ga0228598_1007615 3300024227 Bacteria 2200
159 Ga0228598_1017314 3300024227 Bacteria 1422
160 Ga0207692_10027426 3300025898 Bacteria 2683
161 Ga0207692_10062364 3300025898 Bacteria 1934
162 Ga0207685_10076352 3300025905 Unclassified 1373
163 Ga0207699_10016999 3300025906 Bacteria 3818
164 Ga0207699_10085825 3300025906 Bacteria 1964
165 Ga0207699_10696450 3300025906 Bacteria 744
166 Ga0207684_10002163 3300025910 Bacteria 20138
167 Ga0207684_10057680 3300025910 Bacteria 3295
168 Ga0207684_10057956 3300025910 Bacteria 3287
169 Ga0207684_10211740 3300025910 Bacteria 1672
170 Ga0207693_10041010 3300025915 Bacteria 3646
171 Ga0207693_10051867 3300025915 Bacteria 3218
172 Ga0207693_10076748 3300025915 Bacteria 2616
173 Ga0207693_10814125 3300025915 Bacteria 719
174 Ga0207663_10097520 3300025916 Bacteria 1966
175 Ga0207663_10242975 3300025916 Bacteria 1321
176 Ga0207663_10472526 3300025916 Bacteria 970
177 Ga0207662_10268341 3300025918 Bacteria 1125
178 Ga0207662_10463719 3300025918 Bacteria 868
179 Ga0207649_10225673 3300025920 Bacteria 1337
180 Ga0207646_10000765 3300025922 Bacteria 41623
181 Ga0207646_10083594 3300025922 Bacteria 2855
182 Ga0207646_10128179 3300025922 Bacteria 2282
183 Ga0207694_10673691 3300025924 Bacteria 872
184 Ga0207650_10001460 3300025925 Bacteria 17016
185 Ga0207659_10541767 3300025926 Bacteria 988
186 Ga0207700_10007307 3300025928 Bacteria 6742
187 Ga0207700_10038619 3300025928 Bacteria 3467
188 Ga0207700_10285394 3300025928 Bacteria 1421
189 Ga0207700_10381256 3300025928 Bacteria 1233
190 Ga0207664_10008530 3300025929 Bacteria 7156
191 Ga0207664_10013782 3300025929 Bacteria 5817
192 Ga0207664_10118944 3300025929 Bacteria 2208
193 Ga0207664_10361200 3300025929 Bacteria 1287
194 Ga0207664_10898857 3300025929 Bacteria 795
195 Ga0207644_10005428 3300025931 Bacteria 8315
196 Ga0207644_10958852 3300025931 Bacteria 717
197 Ga0207670_10133471 3300025936 Bacteria 1822
198 Ga0207670_10974541 3300025936 Bacteria 713
199 Ga0207669_10439595 3300025937 Bacteria 1031
200 Ga0207704_10768383 3300025938 Bacteria 803
201 Ga0207665_10033967 3300025939 Bacteria 3384
202 Ga0207665_10051329 3300025939 Bacteria 2775
203 Ga0207691_10016885 3300025940 Bacteria 6925
204 Ga0207691_10193630 3300025940 Bacteria 1772
205 Ga0207691_10264549 3300025940 Bacteria 1482
206 Ga0207689_10655428 3300025942 Bacteria 884
207 Ga0207679_10110504 3300025945 Bacteria 2169
208 Ga0207679_10157923 3300025945 Bacteria 1854
209 Ga0207667_10337327 3300025949 Bacteria 1539
210 Ga0207651_10410820 3300025960 Bacteria 1153
211 Ga0207651_10539089 3300025960 Unclassified 1013
212 Ga0207712_10312323 3300025961 Bacteria 1294
213 Ga0207668_11185107 3300025972 Bacteria 686
214 Ga0207658_10070839 3300025986 Bacteria 2639
215 Ga0207703_10035689 3300026035 Bacteria 3951
216 Ga0207708_10372419 3300026075 Bacteria 1176
217 Ga0207708_10598117 3300026075 Bacteria 934
218 Ga0207641_10000943 3300026088 Bacteria 29987
219 Ga0207641_10078276 3300026088 Bacteria 2863
220 Ga0207641_10431816 3300026088 Bacteria 1270
221 Ga0207676_11146653 3300026095 Bacteria 769
222 Ga0207675_100002799 3300026118 Bacteria 17143
223 Ga0207683_10053337 3300026121 Bacteria 3545
224 Ga0207683_10191158 3300026121 Bacteria 1859
225 Ga0207698_10279650 3300026142 Bacteria 1543
226 Ga0209974_10033679 3300027876 Bacteria 1700
227 Ga0268266_10122232 3300028379 Bacteria 2318
228 Ga0268266_10136338 3300028379 Bacteria 2199
229 Ga0268265_10241376 3300028380 Bacteria 1595
230 Ga0268264_10031261 3300028381 Bacteria 4365
231 Ga0268264_10272643 3300028381 Bacteria 1581
232 Ga0268264_10331277 3300028381 Bacteria 1443
233 Ga0265319_1013064 3300028563 Bacteria 3323
234 Ga0265334_10000779 3300028573 Bacteria 15932
235 Ga0265318_10003299 3300028577 Bacteria 8191
236 Ga0265338_10011154 3300028800 Bacteria 10416
237 Ga0265769_110644 3300030888 Bacteria 632
238 Ga0265760_10049653 3300031090 Bacteria 1261
239 Ga0265330_10008786 3300031235 Bacteria 4839
240 Ga0265332_10014718 3300031238 Bacteria 3457
241 Ga0265328_10005049 3300031239 Bacteria 5687
242 Ga0265320_10006160 3300031240 Bacteria 7595
243 Ga0265325_10002349 3300031241 Bacteria 12807
244 Ga0265329_10017860 3300031242 Bacteria 2433
245 Ga0265340_10110403 3300031247 Unclassified 1272
246 Ga0265331_10008923 3300031250 Bacteria 5670
247 Ga0265316_10025164 3300031344 Bacteria 4970
248 Ga0265313_10005174 3300031595 Bacteria 9685
249 Ga0316579_10041500 3300031691 Bacteria 2136
250 Ga0265314_10003142 3300031711 Bacteria 16199
251 Ga0265342_10034067 3300031712 Bacteria 3127
252 Ga0316576_10013429 3300031727 Bacteria 5445
253 Ga0316578_10017337 3300031728 Bacteria 3916
254 Ga0316585_10037605 3300032137 Bacteria 1537
255 Ga0316580_10009691 3300032139 Bacteria 2899
256 Ga0373926_0050816 3300035083 Bacteria 1495
257 Ga0373934_0012485 3300035086 Bacteria 3206
258 Ga0373934_0023851 3300035086 Bacteria 2365
259 Ga0373923_0053909 3300035111 Bacteria 1692
260 Ga0373936_0014173 3300035113 Bacteria 3045
261 Ga0373945_0038029 3300035116 Bacteria 1730
262 Ga0373954_0025961 3300035118 Bacteria 2682
263 Ga0373954_0030405 3300035118 Bacteria 2490
264 Ga0373954_0167075 3300035118 Bacteria 1077
265 Ga0373954_0169977 3300035118 Bacteria 1067
266 Ga0373956_0028966 3300035119 Bacteria 2413
267 Ga0373957_0026765 3300035120 Bacteria 2089
268 Ga0373960_0133455 3300035121 Bacteria 835
269 Ga0373946_0022733 3300035171 Bacteria 2444
270 Ga0373955_0009250 3300035172 Bacteria 4613
271 Ga0373955_0103674 3300035172 Bacteria 1636
272 Ga0373931_0097074 3300035691 Bacteria 1652
273 Ga0373931_0111138 3300035691 Bacteria 1555
274 Ga0373935_0085414 3300035692 Bacteria 2057
275 Ga0373935_0216276 3300035692 Bacteria 1329
276 Ga0373933_0011313 3300035724 Bacteria 4914
277 Ga0373933_0115742 3300035724 Bacteria 1675
278 Ga0373933_0150924 3300035724 Bacteria 1471
279 Ga0373947_0067686 3300035725 Bacteria 2182
280 Ga0373947_0311575 3300035725 Bacteria 1051
281 Ga0373937_0003684 3300036401 Bacteria 12940
282 Ga0373937_0013727 3300036401 Bacteria 7137
283 Ga0373937_0137215 3300036401 Bacteria 2287
284 Ga0373937_0257185 3300036401 Bacteria 1646
285 Ga0373937_0311637 3300036401 Bacteria 1488
286 Ga0373937_0469268 3300036401 Bacteria 1195
287 Ga0316582_0039689 3300036647 Bacteria 2932
288 Ga0316584_0123244 3300036712 Bacteria 1936
289 Ga0373925_0361975 3300037068 Bacteria 1179
290 Ga0436364_0118260 3300037853 Bacteria 72361
291 Ga0436364_0209635 3300037853 Bacteria 1052
292 Ga0436364_0532730 3300037853 Bacteria 2244
293 Ga0436364_0756097 3300037853 Bacteria 1374
294 Ga0436365_0639646 3300039437 Bacteria 3056
295 Ga0436360_1263099 3300039438 Bacteria 939
296 Ga0436362_0443675 3300039453 Bacteria 727
297 Ga0436362_0917786 3300039453 Bacteria 5000
298 Ga0451789_0051478 3300041443 Bacteria 828
299 Ga0451793_1541229 3300041452 Unclassified 803
300 Ga0451843_0884011 3300041509 Bacteria 713
301 Ga0451853_3460370 3300041512 Bacteria 917
302 Ga0439435_0119919 3300042436 Bacteria 823
303 Ga0453683_0065735 3300044673 Bacteria 2267
304 Ga0451576_0398989 3300045051 Bacteria 1442
305 Ga0451576_0535255 3300045051 Bacteria 1231
306 Ga0466967_0100813 3300045976 Bacteria 2639
307 Ga0495592_0389314 3300046454 Bacteria 885
308 Ga0495592_0460319 3300046454 Bacteria 795
309 Ga0495603_0209637 3300046455 Bacteria 1125
310 Ga0495638_0057740 3300046460 Bacteria 2407
311 Ga0495641_0186760 3300046461 Bacteria 928
312 Ga0495651_0048782 3300046462 Bacteria 3269
313 Ga0495651_0238519 3300046462 Bacteria 1248
314 Ga0495653_0047966 3300046463 Bacteria 3300
315 Ga0495580_0003180 3300046472 Bacteria 14073
316 Ga0495580_0237784 3300046472 Bacteria 1249
317 Ga0495582_0198751 3300046473 Bacteria 1145
318 Ga0495662_0176523 3300046476 Bacteria 1053
319 Ga0495664_0035802 3300046477 Bacteria 2924
320 Ga0495664_0207054 3300046477 Bacteria 1188
321 Ga0495664_0539151 3300046477 Bacteria 696
322 Ga0495608_0045475 3300046511 Bacteria 2925
323 Ga0495608_0121037 3300046511 Bacteria 1678
324 Ga0495618_0037622 3300046514 Bacteria 3039
325 Ga0495618_0124434 3300046514 Bacteria 1651
326 Ga0495628_0098374 3300046516 Bacteria 2260
327 Ga0495666_0129834 3300046526 Bacteria 1178
328 Ga0495652_0013129 3300046529 Bacteria 7458
329 Ga0495652_0235760 3300046529 Bacteria 1365
330 Ga0495665_0105165 3300046531 Bacteria 1481
331 Ga0495665_0156925 3300046531 Bacteria 1187
332 Ga0495640_0083618 3300046533 Bacteria 2118
333 Ga0495640_0144190 3300046533 Bacteria 1533
334 Ga0495587_0049056 3300046536 Bacteria 2500
335 Ga0495587_0049351 3300046536 Bacteria 2491
336 Ga0495587_0076268 3300046536 Bacteria 1947
337 Ga0495598_0223881 3300046537 Bacteria 688
338 Ga0495645_0008273 3300046543 Bacteria 7256
339 Ga0495645_0043550 3300046543 Bacteria 3274
340 Ga0495645_0114490 3300046543 Bacteria 1906
341 Ga0495667_0001087 3300046559 Bacteria 17638
342 Ga0495667_0056402 3300046559 Bacteria 2583
343 Ga0495634_0037611 3300046642 Bacteria 3306
344 Ga0495635_0006148 3300046663 Bacteria 8373
345 Ga0495635_0037629 3300046663 Bacteria 3349
346 Ga0495635_0479919 3300046663 Bacteria 820
347 Ga0495657_0063385 3300046675 Bacteria 2439
348 Ga0495657_0087212 3300046675 Bacteria 2008
349 Ga0495657_0092879 3300046675 Bacteria 1932
350 Ga0495657_0169478 3300046675 Bacteria 1345
351 Ga0495599_0158661 3300046678 Bacteria 1399
352 Ga0495599_0251044 3300046678 Bacteria 1076
353 Ga0495646_0188573 3300046680 Bacteria 1128
354 Ga0495658_0355109 3300046683 Bacteria 932
355 Ga0495600_0110548 3300046809 Bacteria 1789
356 Ga0495600_0217369 3300046809 Bacteria 1223
357 Ga0495604_0057575 3300047317 Bacteria 2988
358 Ga0495604_0190763 3300047317 Bacteria 1428
359 Ga0495636_0084068 3300047318 Bacteria 1374
360 Ga0495636_0089888 3300047318 Bacteria 1332
361 Ga0495674_0052539 3300047319 Bacteria 3585
362 Ga0495674_0287184 3300047319 Bacteria 1346
363 Ga0495676_0343158 3300047321 Bacteria 999
364 Ga0495680_0006367 3300047322 Bacteria 10987
365 Ga0495680_0065794 3300047322 Bacteria 2775
366 Ga0495680_0067404 3300047322 Bacteria 2736
367 Ga0495675_0201683 3300047444 Bacteria 1211
368 Ga0495675_0403638 3300047444 Bacteria 796
369 Ga0495684_0054381 3300047471 Bacteria 3053
370 Ga0495684_0122961 3300047471 Bacteria 1953
371 Ga0495602_0068309 3300048088 Bacteria 3052
372 Ga0495602_0261540 3300048088 Bacteria 1283
373 Ga0496100_0142041 3300048903 Bacteria 1703
374 Ga0496100_0396321 3300048903 Bacteria 1051
375 Ga0496100_0437572 3300048903 Bacteria 1001
376 Ga0496100_0857086 3300048903 Bacteria 713
377 Ga0496101_0281874 3300048904 Bacteria 1299
378 Ga0496101_0410323 3300048904 Bacteria 1067
379 Ga0496102_0209702 3300048905 Bacteria 1837
380 Ga0496102_0752780 3300048905 Bacteria 897
381 Ga0496104_0387615 3300048907 Bacteria 1309
382 Ga0496104_0523164 3300048907 Bacteria 1097
383 Ga0496104_0553307 3300048907 Bacteria 1061
384 Ga0496106_0009224 3300048909 Bacteria 7289
385 Ga0496107_0060726 3300048910 Bacteria 2736
386 Ga0496108_0112318 3300048911 Bacteria 2331
387 Ga0496108_1371567 3300048911 Bacteria 592
388 Ga0496109_0706277 3300048912 Bacteria 946
389 Ga0496109_0812287 3300048912 Bacteria 873
390 Ga0496110_0332231 3300048913 Bacteria 1385
391 Ga0496110_0661907 3300048913 Bacteria 944
392 Ga0496110_0813591 3300048913 Bacteria 839
393 Ga0496111_0226403 3300048914 Bacteria 1389
394 Ga0496112_0069868 3300048915 Bacteria 3469
395 Ga0496112_0148692 3300048915 Bacteria 2310
396 Ga0496114_0308648 3300048917 Bacteria 1397
397 Ga0496115_0261616 3300048918 Bacteria 1423
398 Ga0496115_1064406 3300048918 Bacteria 615
399 Ga0501311_053252 3300049527 Bacteria 639
400 Ga0501312_056541 3300049528 Bacteria 672
401 Ga0501031_0302122 3300049568 Bacteria 1037
402 Ga0501033_0089041 3300049570 Bacteria 2258
403 Ga0501033_0149672 3300049570 Bacteria 1685
404 Ga0501036_0044819 3300049572 Bacteria 3747
405 Ga0501036_0162164 3300049572 Bacteria 1884
406 Ga0501036_0280204 3300049572 Bacteria 1395
407 Ga0501036_0979589 3300049572 Bacteria 692
408 Ga0501037_0120051 3300049573 Bacteria 1891
409 Ga0501037_0127062 3300049573 Bacteria 1830
410 Ga0501038_0085216 3300049574 Bacteria 2658
411 Ga0501038_0185569 3300049574 Bacteria 1676
412 Ga0501038_0205010 3300049574 Bacteria 1581
413 Ga0501038_0329434 3300049574 Bacteria 1193
414 Ga0501039_0008275 3300049575 Bacteria 7927
415 Ga0501039_0140226 3300049575 Bacteria 1899
416 Ga0501039_0318249 3300049575 Bacteria 1223
417 Ga0501040_0022108 3300049576 Bacteria 4254
418 Ga0501040_0065115 3300049576 Bacteria 2510
419 Ga0501040_0073268 3300049576 Bacteria 2366
420 Ga0501040_0126660 3300049576 Bacteria 1794
421 Ga0501040_0480303 3300049576 Bacteria 895
422 Ga0501041_0042518 3300049577 Bacteria 2762
423 Ga0501041_0341821 3300049577 Bacteria 945
424 Ga0501042_0063256 3300049578 Bacteria 2645
425 Ga0501042_0110593 3300049578 Bacteria 1978
426 Ga0501043_0194598 3300049579 Bacteria 1576
427 Ga0501046_0021188 3300049580 Bacteria 5367
428 Ga0501046_0495928 3300049580 Bacteria 875
429 Ga0501048_0126823 3300049582 Bacteria 1804
430 Ga0501048_0386772 3300049582 Bacteria 999
431 Ga0501068_0021748 3300049584 Bacteria 3749
432 Ga0501069_0268250 3300049585 Bacteria 997
433 Ga0501070_0217818 3300049586 Bacteria 1566
434 Ga0501071_0018541 3300049587 Bacteria 4820
435 Ga0501071_0076194 3300049587 Bacteria 2449
436 Ga0501071_0137960 3300049587 Bacteria 1815
437 Ga0501072_0033332 3300049588 Bacteria 4036
438 Ga0501072_0121163 3300049588 Bacteria 2084
439 Ga0501072_0242909 3300049588 Bacteria 1434
440 Ga0501072_0536861 3300049588 Bacteria 924
441 Ga0501072_0855010 3300049588 Bacteria 711
442 Ga0501074_0236498 3300049590 Bacteria 1300
443 Ga0501075_0022573 3300049591 Bacteria 4598
444 Ga0501075_0070809 3300049591 Bacteria 2635
445 Ga0501075_0094999 3300049591 Bacteria 2262
446 Ga0501075_0454158 3300049591 Bacteria 977
447 Ga0501076_0049818 3300049592 Bacteria 3313
448 Ga0501076_0102168 3300049592 Bacteria 2311
449 Ga0501076_0262677 3300049592 Bacteria 1413
450 Ga0501076_0839125 3300049592 Bacteria 758
451 Ga0501077_0307454 3300049593 Bacteria 1010
452 Ga0501077_0372484 3300049593 Bacteria 912
453 Ga0501079_0101697 3300049741 Unclassified 2229
454 Ga0501079_0107021 3300049741 Bacteria 2170
455 Ga0501079_0127165 3300049741 Bacteria 1982
456 Ga0501079_0306776 3300049741 Bacteria 1242
457 Ga0501079_0455390 3300049741 Bacteria 1005
458 Ga0501080_0010728 3300049742 Bacteria 8381
459 Ga0501080_0259102 3300049742 Bacteria 1585
460 Ga0501080_0330347 3300049742 Bacteria 1379
461 Ga0501080_1274107 3300049742 Bacteria 630
462 Ga0501081_0110359 3300049743 Bacteria 1951
463 Ga0501081_0119901 3300049743 Bacteria 1873
464 Ga0501081_0148286 3300049743 Bacteria 1684
465 Ga0501083_0285489 3300049744 Bacteria 1073
466 Ga0501035_0019294 3300049822 Bacteria 6275
467 Ga0501035_0459347 3300049822 Bacteria 1053
468 Ga0501045_0029442 3300049824 Bacteria 3969
469 Ga0501045_0030864 3300049824 Bacteria 3880
470 Ga0501045_0174160 3300049824 Bacteria 1603
471 nmdc:mga05p37_12357_c1 3300050507 Bacteria 10199
472 nmdc:mga05p37_238432_c1 3300050507 Bacteria 2188
473 nmdc:mga05p37_286897_c1 3300050507 Bacteria 1960
474 nmdc:mga09592_240773_c1 3300050508 Bacteria 1568
475 nmdc:mga06r32_249408_c1 3300050510 Bacteria 1763
476 nmdc:mga06r32_574359_c1 3300050510 Bacteria 1100
477 nmdc:mga08y16_201750_c1 3300050511 Bacteria 2061
478 nmdc:mga0n895_138793_c1 3300050512 Bacteria 2458
479 nmdc:mga0n895_186091_c1 3300050512 Bacteria 2108
480 nmdc:mga08x19_13237_c1 3300050514 Bacteria 4982
481 nmdc:mga0a205_120101_c1 3300050515 Bacteria 2527
482 nmdc:mga0a205_57996_c2 3300050515 Bacteria 2688
483 nmdc:mga0a205_590085_c1 3300050515 Bacteria 965
484 nmdc:mga0sz30_64512_c1 3300050516 Bacteria 1569
485 Ga0495619_0306985 3300053085 Bacteria 1099
486 Ga0501084_0057874 3300054114 Bacteria 3243
487 Ga0501084_0142150 3300054114 Bacteria 2021
488 Ga0501084_0211443 3300054114 Bacteria 1636
489 Ga0501084_0606142 3300054114 Bacteria 925
490 Ga0501084_0817479 3300054114 Bacteria 785
491 Ga0501082_0036775 3300060353 Bacteria 4217
492 Ga0501082_0077338 3300060353 Bacteria 2869
493 Ga0501082_0211056 3300060353 Bacteria 1689
494 Ga0501082_1113236 3300060353 Bacteria 690
495 Ga0530510_0022992 3300061734 Bacteria 4442
496 Ga0530510_0061356 3300061734 Bacteria 2722
497 Ga0530510_0098363 3300061734 Bacteria 2139
498 Ga0501046_0606494
499 Ga0058859_11617028
500 Ga0065712_10329901
501 Ga0070670_100011361
502 Ga0070670_100248309
503 Ga0068868_100166358
504 Ga0070689_100264502
505 Ga0070687_100150556
506 Ga0070687_100300727
507 Ga0070668_100609276
508 Ga0070669_100050199
509 Ga0070669_100099632
510 Ga0070669_100270295
511 Ga0070669_100356741
512 Ga0070669_100655184
513 Ga0070675_100409556
514 Ga0070671_100008557
515 Ga0070671_100569028
516 Ga0070673_100062447
517 Ga0070688_100002361
518 Ga0070688_100033505
519 Ga0070659_100161928
520 Ga0070667_100005319
521 Ga0070667_100190220
522 Ga0070667_100502986
523 Ga0070703_10153351
524 Ga0070709_10000811
525 Ga0070709_10045026
526 Ga0070709_10863395
527 Ga0070714_100005591
528 Ga0070714_100016764
529 Ga0070714_100202916
530 Ga0070714_100304397
531 Ga0070714_100326715
532 Ga0070713_100005039
533 Ga0070713_100014313
534 Ga0070713_100211626
535 Ga0070713_100680343
536 Ga0070710_10016052
537 Ga0070710_10160978
538 Ga0070701_10588258
539 Ga0070711_100103327
540 Ga0070694_100027686
541 Ga0070694_100662099
542 Ga0070708_100026066
543 Ga0070678_100138995
544 Ga0070685_10071246
545 Ga0070706_100001577
546 Ga0070706_100024113
547 Ga0070706_100048101
548 Ga0070707_100000512
549 Ga0070707_100020521
550 Ga0070707_100219839
551 Ga0070707_100628776
552 Ga0070698_100000855
553 Ga0070698_100002470
554 Ga0070698_100008694
555 Ga0070698_100022465
556 Ga0070698_100234364
557 Ga0070698_100268101
558 Ga0070699_100187952
559 Ga0070699_100546453
560 Ga0070697_100091317
561 Ga0070697_100910740
562 Ga0070672_100002915
563 Ga0070672_100006827
564 Ga0070672_100540970
565 Ga0070686_100066125
566 Ga0070686_100087787
567 Ga0070695_100198511
568 Ga0070665_100088688
569 Ga0070665_101056640
570 Ga0070704_100039180
571 Ga0070704_100044945
572 Ga0070704_100128172
573 Ga0070704_100369374
574 Ga0070664_100043174
575 Ga0068856_101059275
576 Ga0070702_100226830
577 Ga0068852_100586237
578 Ga0068859_100000031
579 Ga0068859_100011045
580 Ga0068859_100339429
581 Ga0068864_100519890
582 Ga0068861_100000477
583 Ga0068863_100001243
584 Ga0068863_100034838
585 Ga0068858_100058361
586 Ga0068858_100136650
587 Ga0068858_100139428
588 Ga0068862_100495292
589 Ga0070717_10025081
590 Ga0070717_10036441
591 Ga0070717_10063926
592 Ga0070717_10084382
593 Ga0070717_10343468
594 Ga0075365_10452949
595 Ga0075363_100021325
596 Ga0070715_10017295
597 Ga0070716_100121495
598 Ga0070712_100042317
599 Ga0070712_100187602
600 Ga0070712_100240700
601 Ga0075369_10081693
602 Ga0068871_100308913
603 Ga0075428_100027862
604 Ga0075428_100115300
605 Ga0075428_101070796
606 Ga0075430_100462565
607 Ga0075430_100639469
608 Ga0075431_100001911
609 Ga0075433_10024237
610 Ga0075433_10186318
611 Ga0075433_10313053
612 Ga0075434_100024568
613 Ga0075434_100134419
614 Ga0075429_100094801
615 Ga0068865_100826130
616 Ga0075436_100007686
617 Ga0097620_100000031
618 Ga0097620_100011045
619 Ga0097620_100339445
620 Ga0075435_100066936
621 Ga0111539_10023822
622 Ga0105245_11123923
623 Ga0105247_10186833
624 Ga0105247_10348246
625 Ga0114129_10005971
626 Ga0114129_10072973
627 Ga0114129_10205677
628 Ga0105243_10134670
629 Ga0105241_10317400
630 Ga0105248_10001228
631 Ga0105248_10183314
632 Ga0105248_10458420
633 Ga0105248_10847912
634 Ga0105237_10066572
635 Ga0105238_10512053
636 Ga0105249_10144496
637 Ga0105249_10973871
638 Ga0105239_10264474
639 Ga0105239_11579469
640 Ga0105246_10141012
641 Ga0157374_11121793
642 Ga0157378_10129262
643 Ga0157375_10262452
644 Ga0157375_10263206
645 Ga0157375_11793301
646 Ga0157379_10000057
647 Ga0157376_10188647
648 Ga0157376_10440051
649 Ga0163161_10146440
650 Ga0213876_10353124
651 Ga0213875_10001958
652 Ga0213871_10197612
653 Ga0224571_102751
654 Ga0224572_1010573
655 Ga0228598_1007615
656 Ga0228598_1017314
657 Ga0207692_10027426
658 Ga0207692_10062364
659 Ga0207685_10076352
660 Ga0207699_10016999
661 Ga0207699_10085825
662 Ga0207699_10696450
663 Ga0207684_10002163
664 Ga0207684_10057680
665 Ga0207684_10057956
666 Ga0207684_10211740
667 Ga0207693_10041010
668 Ga0207693_10051867
669 Ga0207693_10076748
670 Ga0207693_10814125
671 Ga0207663_10097520
672 Ga0207663_10242975
673 Ga0207663_10472526
674 Ga0207662_10268341
675 Ga0207662_10463719
676 Ga0207649_10225673
677 Ga0207646_10000765
678 Ga0207646_10083594
679 Ga0207646_10128179
680 Ga0207694_10673691
681 Ga0207650_10001460
682 Ga0207659_10541767
683 Ga0207700_10007307
684 Ga0207700_10038619
685 Ga0207700_10285394
686 Ga0207700_10381256
687 Ga0207664_10008530
688 Ga0207664_10013782
689 Ga0207664_10118944
690 Ga0207664_10361200
691 Ga0207664_10898857
692 Ga0207644_10005428
693 Ga0207644_10958852
694 Ga0207670_10133471
695 Ga0207670_10974541
696 Ga0207669_10439595
697 Ga0207704_10768383
698 Ga0207665_10033967
699 Ga0207665_10051329
700 Ga0207691_10016885
701 Ga0207691_10193630
702 Ga0207691_10264549
703 Ga0207689_10655428
704 Ga0207679_10110504
705 Ga0207679_10157923
706 Ga0207667_10337327
707 Ga0207651_10410820
708 Ga0207651_10539089
709 Ga0207712_10312323
710 Ga0207668_11185107
711 Ga0207658_10070839
712 Ga0207703_10035689
713 Ga0207708_10372419
714 Ga0207708_10598117
715 Ga0207641_10000943
716 Ga0207641_10078276
717 Ga0207641_10431816
718 Ga0207676_11146653
719 Ga0207675_100002799
720 Ga0207683_10053337
721 Ga0207683_10191158
722 Ga0207698_10279650
723 Ga0209974_10033679
724 Ga0268266_10122232
725 Ga0268266_10136338
726 Ga0268265_10241376
727 Ga0268264_10031261
728 Ga0268264_10272643
729 Ga0268264_10331277
730 Ga0265319_1013064
731 Ga0265334_10000779
732 Ga0265318_10003299
733 Ga0265338_10011154
734 Ga0265769_110644
735 Ga0265760_10049653
736 Ga0265330_10008786
737 Ga0265332_10014718
738 Ga0265328_10005049
739 Ga0265320_10006160
740 Ga0265325_10002349
741 Ga0265329_10017860
742 Ga0265340_10110403
743 Ga0265331_10008923
744 Ga0265316_10025164
745 Ga0265313_10005174
746 Ga0316579_10041500
747 Ga0265314_10003142
748 Ga0265342_10034067
749 Ga0316576_10013429
750 Ga0316578_10017337
751 Ga0316585_10037605
752 Ga0316580_10009691
753 Ga0373926_0050816
754 Ga0373934_0012485
755 Ga0373934_0023851
756 Ga0373923_0053909
757 Ga0373936_0014173
758 Ga0373945_0038029
759 Ga0373954_0025961
760 Ga0373954_0030405
761 Ga0373954_0167075
762 Ga0373954_0169977
763 Ga0373956_0028966
764 Ga0373957_0026765
765 Ga0373960_0133455
766 Ga0373946_0022733
767 Ga0373955_0009250
768 Ga0373955_0103674
769 Ga0373931_0097074
770 Ga0373931_0111138
771 Ga0373935_0085414
772 Ga0373935_0216276
773 Ga0373933_0011313
774 Ga0373933_0115742
775 Ga0373933_0150924
776 Ga0373947_0067686
777 Ga0373947_0311575
778 Ga0373937_0003684
779 Ga0373937_0013727
780 Ga0373937_0137215
781 Ga0373937_0257185
782 Ga0373937_0311637
783 Ga0373937_0469268
784 Ga0316582_0039689
785 Ga0316584_0123244
786 Ga0373925_0361975
787 Ga0436364_0118260
788 Ga0436364_0209635
789 Ga0436364_0532730
790 Ga0436364_0756097
791 Ga0436365_0639646
792 Ga0436360_1263099
793 Ga0436362_0443675
794 Ga0436362_0917786
795 Ga0451789_0051478
796 Ga0451793_1541229
797 Ga0451843_0884011
798 Ga0451853_3460370
799 Ga0439435_0119919
800 Ga0453683_0065735
801 Ga0451576_0398989
802 Ga0451576_0535255
803 Ga0466967_0100813
804 Ga0495592_0389314
805 Ga0495592_0460319
806 Ga0495603_0209637
807 Ga0495638_0057740
808 Ga0495641_0186760
809 Ga0495651_0048782
810 Ga0495651_0238519
811 Ga0495653_0047966
812 Ga0495580_0003180
813 Ga0495580_0237784
814 Ga0495582_0198751
815 Ga0495662_0176523
816 Ga0495664_0035802
817 Ga0495664_0207054
818 Ga0495664_0539151
819 Ga0495608_0045475
820 Ga0495608_0121037
821 Ga0495618_0037622
822 Ga0495618_0124434
823 Ga0495628_0098374
824 Ga0495666_0129834
825 Ga0495652_0013129
826 Ga0495652_0235760
827 Ga0495665_0105165
828 Ga0495665_0156925
829 Ga0495640_0083618
830 Ga0495640_0144190
831 Ga0495587_0049056
832 Ga0495587_0049351
833 Ga0495587_0076268
834 Ga0495598_0223881
835 Ga0495645_0008273
836 Ga0495645_0043550
837 Ga0495645_0114490
838 Ga0495667_0001087
839 Ga0495667_0056402
840 Ga0495634_0037611
841 Ga0495635_0006148
842 Ga0495635_0037629
843 Ga0495635_0479919
844 Ga0495657_0063385
845 Ga0495657_0087212
846 Ga0495657_0092879
847 Ga0495657_0169478
848 Ga0495599_0158661
849 Ga0495599_0251044
850 Ga0495646_0188573
851 Ga0495658_0355109
852 Ga0495600_0110548
853 Ga0495600_0217369
854 Ga0495604_0057575
855 Ga0495604_0190763
856 Ga0495636_0084068
857 Ga0495636_0089888
858 Ga0495674_0052539
859 Ga0495674_0287184
860 Ga0495676_0343158
861 Ga0495680_0006367
862 Ga0495680_0065794
863 Ga0495680_0067404
864 Ga0495675_0201683
865 Ga0495675_0403638
866 Ga0495684_0054381
867 Ga0495684_0122961
868 Ga0495602_0068309
869 Ga0495602_0261540
870 Ga0496100_0142041
871 Ga0496100_0396321
872 Ga0496100_0437572
873 Ga0496100_0857086
874 Ga0496101_0281874
875 Ga0496101_0410323
876 Ga0496102_0209702
877 Ga0496102_0752780
878 Ga0496104_0387615
879 Ga0496104_0523164
880 Ga0496104_0553307
881 Ga0496106_0009224
882 Ga0496107_0060726
883 Ga0496108_0112318
884 Ga0496108_1371567
885 Ga0496109_0706277
886 Ga0496109_0812287
887 Ga0496110_0332231
888 Ga0496110_0661907
889 Ga0496110_0813591
890 Ga0496111_0226403
891 Ga0496112_0069868
892 Ga0496112_0148692
893 Ga0496114_0308648
894 Ga0496115_0261616
895 Ga0496115_1064406
896 Ga0501311_053252
897 Ga0501312_056541
898 Ga0501031_0302122
899 Ga0501033_0089041
900 Ga0501033_0149672
901 Ga0501036_0044819
902 Ga0501036_0162164
903 Ga0501036_0280204
904 Ga0501036_0979589
905 Ga0501037_0120051
906 Ga0501037_0127062
907 Ga0501038_0085216
908 Ga0501038_0185569
909 Ga0501038_0205010
910 Ga0501038_0329434
911 Ga0501039_0008275
912 Ga0501039_0140226
913 Ga0501039_0318249
914 Ga0501040_0022108
915 Ga0501040_0065115
916 Ga0501040_0073268
917 Ga0501040_0126660
918 Ga0501040_0480303
919 Ga0501041_0042518
920 Ga0501041_0341821
921 Ga0501042_0063256
922 Ga0501042_0110593
923 Ga0501043_0194598
924 Ga0501046_0021188
925 Ga0501046_0495928
926 Ga0501048_0126823
927 Ga0501048_0386772
928 Ga0501068_0021748
929 Ga0501069_0268250
930 Ga0501070_0217818
931 Ga0501071_0018541
932 Ga0501071_0076194
933 Ga0501071_0137960
934 Ga0501072_0033332
935 Ga0501072_0121163
936 Ga0501072_0242909
937 Ga0501072_0536861
938 Ga0501072_0855010
939 Ga0501074_0236498
940 Ga0501075_0022573
941 Ga0501075_0070809
942 Ga0501075_0094999
943 Ga0501075_0454158
944 Ga0501076_0049818
945 Ga0501076_0102168
946 Ga0501076_0262677
947 Ga0501076_0839125
948 Ga0501077_0307454
949 Ga0501077_0372484
950 Ga0501079_0101697
951 Ga0501079_0107021
952 Ga0501079_0127165
953 Ga0501079_0306776
954 Ga0501079_0455390
955 Ga0501080_0010728
956 Ga0501080_0259102
957 Ga0501080_0330347
958 Ga0501080_1274107
959 Ga0501081_0110359
960 Ga0501081_0119901
961 Ga0501081_0148286
962 Ga0501083_0285489
963 Ga0501035_0019294
964 Ga0501035_0459347
965 Ga0501045_0029442
966 Ga0501045_0030864
967 Ga0501045_0174160
968 nmdc:mga05p37_12357_c1
969 nmdc:mga05p37_238432_c1
970 nmdc:mga05p37_286897_c1
971 nmdc:mga09592_240773_c1
972 nmdc:mga06r32_249408_c1
973 nmdc:mga06r32_574359_c1
974 nmdc:mga08y16_201750_c1
975 nmdc:mga0n895_138793_c1
976 nmdc:mga0n895_186091_c1
977 nmdc:mga08x19_13237_c1
978 nmdc:mga0a205_120101_c1
979 nmdc:mga0a205_57996_c2
980 nmdc:mga0a205_590085_c1
981 nmdc:mga0sz30_64512_c1
982 Ga0495619_0306985
983 Ga0501084_0057874
984 Ga0501084_0142150
985 Ga0501084_0211443
986 Ga0501084_0606142
987 Ga0501084_0817479
988 Ga0501082_0036775
989 Ga0501082_0077338
990 Ga0501082_0211056
991 Ga0501082_1113236
992 Ga0530510_0022992
993 Ga0530510_0061356
994 Ga0530510_0098363

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02566

OsmC

OsmC-like protein

109

214

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2opl-assembly1.cif.gz_A crystal structure of an osmc-like protein (gsu2788) from geobacter sulfurreducens at 1.50 a resolution 0.828 4 181
1ml8-assembly1.cif.gz_A-2 structural genomics 0.8172 34 184
2opl-assembly1.cif.gz_A crystal structure of an osmc-like protein (gsu2788) from geobacter sulfurreducens at 1.50 a resolution 0.8116 4 181
2pn2-assembly1.cif.gz_A-2 crystal structure of a putative osmotic stress induced and detoxification response protein (psyc_0566) from psychrobacter arcticus 273-4 at 2.15 a resolution 0.8077 32 184
2onf-assembly1.cif.gz_B crystal structure of a putative osmotically inducible protein c (ta0195) from thermoplasma acidophilum at 1.70 a resolution 0.8052 32 184
ID Description Score Start End Superfamily
1ml8A02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8495 83 184 3.30.300.20
2oplB01 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8494 5 174 3.30.300.20
2oplB01 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.845 5 174 3.30.300.20
1lqlE02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.839 81 184 3.30.300.20
1lqlE02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8098 81 184 3.30.300.20
ID Description Score Start End GO Terms
AF-A0A1V3WZZ7-F1-model_v4 OsmC-like family protein 0.9308 1 119
AF-A0A7G1IAG3-F1-model_v4 Pyridine nucleotide-disulfide oxidoreductase family protein 0.91 2 159 GO:0004497
GO:0050660
AF-A0A498QKM1-F1-model_v4 OsmC-like protein 0.8965 1 107
AF-A0A523K324-F1-model_v4 OsmC family peroxiredoxin 0.8903 1 143
AF-A0A1T4MRQ3-F1-model_v4 Uncharacterized OsmC-related protein 0.879 32 184

Map