F455087

General Info

Members Datasets Scaffolds Average Seq Length
497 379 389 144

Family's Representative Sequence

Representative Sequence 3300046674|Ga0495588_0090262|Ga0495588_0090262_265_699
Length 144
Sequence METVNPATTAWTRDSVTVEKRDVWTAMKRGFASRCPRCGKGKLFRAFLKVDDHCSECGLDFTPHRADDLPAYLVIVGHIVVPTALWIETNYSPAVWLQLSIYLPFTFIASLALLQPVKGAVVGLQWALRMHGFDEHGADDIAPG

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
5 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
6 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
7 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
8 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
9 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
10 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
11 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
12 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
13 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
14 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
15 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
16 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
17 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
18 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
19 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
20 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
21 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
22 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
23 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
24 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
25 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
26 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
27 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
28 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
29 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
30 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
31 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
32 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
33 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
34 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
35 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
36 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
37 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
38 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
39 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
40 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
41 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
42 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
43 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
44 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
45 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
46 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
47 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
48 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
49 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
50 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
51 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
52 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
53 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
54 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
55 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
56 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
57 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
58 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
59 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
60 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
61 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
62 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
63 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
64 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
65 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
66 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
67 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
68 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
69 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
70 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
71 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
72 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
73 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
74 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
75 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
76 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
77 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
78 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
79 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
80 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
81 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
82 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
83 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
84 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
85 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
86 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
87 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
88 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
89 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
90 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
91 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
92 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
93 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
94 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
95 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
96 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
97 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
98 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
99 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
100 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
101 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
102 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
103 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
104 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
105 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
106 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
107 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
108 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
109 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
110 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
111 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
112 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
113 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
114 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
115 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
116 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
117 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
118 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
119 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
120 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
121 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
122 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
123 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
124 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
125 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
126 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
127 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
128 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
129 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
130 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
131 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
132 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
133 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
134 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
135 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
136 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
137 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
138 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
139 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
140 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
141 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
142 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
143 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
144 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
145 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
146 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
147 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
148 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
149 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
150 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
151 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
153 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
154 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
155 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
156 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
157 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
189 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
190 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
191 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
192 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
194 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
195 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
196 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
197 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
198 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
199 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
200 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
201 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
202 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
203 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
204 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
205 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
206 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
207 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
208 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
209 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
210 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
211 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
212 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
213 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
214 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
215 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
216 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
217 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
218 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
219 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
220 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
221 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
222 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
223 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
224 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
225 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
226 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
227 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
228 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
229 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
230 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
231 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
232 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
233 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
234 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
235 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
236 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
237 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
238 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
239 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
240 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
241 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
242 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
243 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
244 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
245 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
246 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
247 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
248 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
249 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
250 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
251 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
252 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
253 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
254 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
255 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
256 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
257 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
258 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
259 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
260 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
261 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
262 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
263 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
264 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
265 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
266 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
267 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
268 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
269 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
270 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
271 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
272 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
273 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
274 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
275 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
276 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
277 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
278 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
279 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
280 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
281 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
282 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
283 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
284 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
285 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
286 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
287 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
288 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
289 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
290 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
291 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
292 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
293 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
294 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
295 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
296 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
297 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
305 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
311 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
312 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
313 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
314 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
315 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
316 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
317 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
318 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
319 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
320 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
321 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
323 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
324 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
325 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
326 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
327 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
328 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
329 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
330 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
331 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
332 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
333 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
334 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
335 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
336 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
337 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
338 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
339 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
340 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
341 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
342 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
343 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
344 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
345 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
346 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
347 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
348 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
349 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
350 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
351 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
352 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
353 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
354 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
355 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
356 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
357 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
358 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
359 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
360 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
361 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
362 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
363 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
364 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
365 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
366 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
367 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
368 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
369 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
370 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
371 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
372 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
373 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
374 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
375 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
376 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
377 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
378 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
379 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 78.07
Metatranscriptomes 0.2
Isolates 21.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.49
Nodule 17.51
Rhizoplane 5.03
Rhizosphere 52.31
Stem 0
Stem Tuber 0
Unclassified 10.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1011926 3300003214 Bacteria 1228
2 JGI25153J46596_10004942 3300003215 Bacteria 7085
3 JGI25160J50197_1001994 3300003354 Bacteria 9742
4 Ga0055542_1003986 3300003762 Bacteria 3753
5 Ga0055531_10011335 3300003794 Bacteria 4315
6 Ga0055531_10017361 3300003794 Bacteria 3043
7 JGI25405J52794_10017454 3300003911 Bacteria 1425
8 Ga0055543_1001961 3300004625 Bacteria 7328
9 Ga0065165_1001623 3300005262 Bacteria 22903
10 Ga0065165_1010370 3300005262 Bacteria 4040
11 Ga0065165_1022952 3300005262 Bacteria 2126
12 Ga0070658_10160243 3300005327 Bacteria 1887
13 Ga0070671_101012969 3300005355 Bacteria 728
14 Ga0070709_10002626 3300005434 Bacteria 9703
15 Ga0070714_100012170 3300005435 Bacteria 6857
16 Ga0070713_100013925 3300005436 Bacteria 5954
17 Ga0070713_100238132 3300005436 Bacteria 1656
18 Ga0070713_100334507 3300005436 Bacteria 1402
19 Ga0070710_10001750 3300005437 Bacteria 10274
20 Ga0070710_10206926 3300005437 Bacteria 1242
21 Ga0070710_10735489 3300005437 Bacteria 699
22 Ga0070711_100004679 3300005439 Bacteria 8102
23 Ga0070708_100243735 3300005445 Bacteria 1688
24 Ga0070706_100387150 3300005467 Bacteria 1302
25 Ga0070706_100398546 3300005467 Unclassified 1281
26 Ga0070698_100560727 3300005471 Bacteria 1082
27 Ga0070699_100905768 3300005518 Bacteria 808
28 Ga0070684_100101115 3300005535 Bacteria 2575
29 Ga0070697_100108207 3300005536 Bacteria 2314
30 Ga0070697_100222758 3300005536 Bacteria 1608
31 Ga0068853_100136142 3300005539 Bacteria 2202
32 Ga0068853_100148325 3300005539 Bacteria 2110
33 Ga0068855_100713705 3300005563 Bacteria 1072
34 Ga0068857_100127826 3300005577 Bacteria 2290
35 Ga0068854_101124355 3300005578 Bacteria 701
36 Ga0068856_101008541 3300005614 Bacteria 851
37 Ga0068852_100120244 3300005616 Bacteria 2403
38 Ga0068852_101360931 3300005616 Bacteria 732
39 Ga0068859_100129767 3300005617 Bacteria 2592
40 Ga0068866_10231903 3300005718 Bacteria 1120
41 Ga0068863_100074152 3300005841 Bacteria 3219
42 Ga0068858_100558360 3300005842 Bacteria 1109
43 Ga0068860_100084760 3300005843 Bacteria 3014
44 Ga0081455_10026268 3300005937 Bacteria 5361
45 Ga0081540_1160280 3300005983 Bacteria 874
46 Ga0081540_1192803 3300005983 Bacteria 749
47 Ga0070717_11718919 3300006028 Bacteria 568
48 Ga0075365_10069838 3300006038 Bacteria 2361
49 Ga0075364_10226155 3300006051 Bacteria 1270
50 Ga0075432_10238115 3300006058 Bacteria 734
51 Ga0070715_10000266 3300006163 Bacteria 12656
52 Ga0070716_100003732 3300006173 Bacteria 7210
53 Ga0070716_100079385 3300006173 Bacteria 1954
54 Ga0070716_100114536 3300006173 Bacteria 1677
55 Ga0070716_100237628 3300006173 Bacteria 1234
56 Ga0070716_100364957 3300006173 Bacteria 1027
57 Ga0070712_100044663 3300006175 Bacteria 3056
58 Ga0070712_100061062 3300006175 Bacteria 2661
59 Ga0070712_100225413 3300006175 Bacteria 1486
60 Ga0075362_10244279 3300006177 Bacteria 882
61 Ga0075367_10414211 3300006178 Bacteria 853
62 Ga0075369_10058327 3300006186 Bacteria 1681
63 Ga0075369_10100118 3300006186 Bacteria 1300
64 Ga0075370_10249034 3300006353 Bacteria 1053
65 Ga0075370_10411725 3300006353 Bacteria 812
66 Ga0068871_100605711 3300006358 Bacteria 997
67 Ga0097620_100129761 3300006931 Bacteria 2592
68 Ga0099824_1018161 3300006942 Bacteria 5854
69 Ga0099794_10111793 3300007265 Bacteria 1369
70 Ga0099795_10075483 3300007788 Bacteria 1280
71 Ga0105240_10039339 3300009093 Bacteria 6057
72 Ga0105245_10596251 3300009098 Bacteria 1131
73 Ga0105247_10020110 3300009101 Bacteria 4013
74 Ga0105241_10519248 3300009174 Bacteria 1065
75 Ga0105237_10551823 3300009545 Bacteria 1159
76 Ga0099796_10016025 3300010159 Bacteria 2205
77 Ga0099796_10047165 3300010159 Bacteria 1482
78 Ga0105239_10204235 3300010375 Bacteria 2214
79 Ga0105239_10387766 3300010375 Bacteria 1580
80 Ga0105239_10782580 3300010375 Bacteria 1093
81 Ga0105239_11796806 3300010375 Bacteria 710
82 Ga0157371_10265721 3300013102 Bacteria 1237
83 Ga0157370_10120891 3300013104 Bacteria 2445
84 Ga0157370_10612567 3300013104 Bacteria 996
85 Ga0157369_11162095 3300013105 Bacteria 788
86 Ga0157378_11604432 3300013297 Bacteria 696
87 Ga0163162_10223195 3300013306 Bacteria 2014
88 Ga0157372_10037018 3300013307 Bacteria 5380
89 Ga0163163_12882054 3300014325 Bacteria 537
90 Ga0206350_10299931 3300020080 Bacteria 848
91 Ga0209148_1000493 3300025254 Bacteria 40546
92 Ga0209233_1008850 3300025261 Bacteria 3087
93 Ga0209233_1009635 3300025261 Bacteria 2932
94 Ga0209233_1023600 3300025261 Bacteria 1555
95 Ga0209564_1031054 3300025295 Bacteria 1641
96 Ga0209758_1000100 3300025297 Bacteria 227948
97 Ga0209758_1001732 3300025297 Bacteria 24300
98 Ga0209758_1002189 3300025297 Bacteria 20469
99 Ga0209758_1058778 3300025297 Bacteria 1283
100 Ga0209256_1002940 3300025299 Bacteria 12791
101 Ga0209256_1036264 3300025299 Bacteria 1295
102 Ga0207426_1000382 3300025302 Bacteria 76034
103 Ga0207426_1065160 3300025302 Bacteria 1034
104 Ga0209051_1078665 3300025303 Bacteria 960
105 Ga0209257_1001443 3300025304 Bacteria 28086
106 Ga0209257_1048923 3300025304 Bacteria 1207
107 Ga0207692_10158341 3300025898 Bacteria 1303
108 Ga0207692_10567348 3300025898 Bacteria 727
109 Ga0207642_10148801 3300025899 Bacteria 1244
110 Ga0207710_10019276 3300025900 Bacteria 2910
111 Ga0207647_10272812 3300025904 Bacteria 967
112 Ga0207699_10005962 3300025906 Bacteria 5865
113 Ga0207699_10109450 3300025906 Bacteria 1768
114 Ga0207705_10113969 3300025909 Bacteria 2000
115 Ga0207684_10117761 3300025910 Bacteria 2276
116 Ga0207684_10169978 3300025910 Bacteria 1879
117 Ga0207684_11261461 3300025910 Unclassified 610
118 Ga0207707_10663465 3300025912 Bacteria 878
119 Ga0207707_10682882 3300025912 Bacteria 863
120 Ga0207693_10001357 3300025915 Bacteria 21659
121 Ga0207693_10022673 3300025915 Bacteria 4988
122 Ga0207693_10047889 3300025915 Bacteria 3358
123 Ga0207663_10005723 3300025916 Bacteria 6288
124 Ga0207663_10408156 3300025916 Bacteria 1040
125 Ga0207663_10947603 3300025916 Bacteria 689
126 Ga0207657_10218263 3300025919 Bacteria 1529
127 Ga0207687_10136105 3300025927 Bacteria 1858
128 Ga0207700_10223629 3300025928 Bacteria 1597
129 Ga0207700_10274706 3300025928 Bacteria 1447
130 Ga0207700_10295245 3300025928 Bacteria 1398
131 Ga0207664_10216751 3300025929 Bacteria 1658
132 Ga0207664_10827719 3300025929 Bacteria 832
133 Ga0207644_10544581 3300025931 Bacteria 960
134 Ga0207704_10603806 3300025938 Bacteria 899
135 Ga0207665_10006211 3300025939 Bacteria 7935
136 Ga0207665_10018185 3300025939 Bacteria 4618
137 Ga0207665_10076546 3300025939 Bacteria 2295
138 Ga0207665_10133785 3300025939 Bacteria 1762
139 Ga0207665_10604348 3300025939 Bacteria 857
140 Ga0207665_11478167 3300025939 Bacteria 540
141 Ga0207661_10382615 3300025944 Bacteria 1274
142 Ga0207667_10410821 3300025949 Bacteria 1378
143 Ga0207667_10418204 3300025949 Bacteria 1364
144 Ga0207667_10458318 3300025949 Bacteria 1295
145 Ga0207667_11248007 3300025949 Bacteria 721
146 Ga0207640_10310611 3300025981 Bacteria 1251
147 Ga0207640_11211682 3300025981 Bacteria 671
148 Ga0207658_10503801 3300025986 Bacteria 1079
149 Ga0207639_10416798 3300026041 Bacteria 1213
150 Ga0207678_10180439 3300026067 Bacteria 1803
151 Ga0207678_10743036 3300026067 Bacteria 865
152 Ga0207678_10807494 3300026067 Bacteria 828
153 Ga0207702_10265697 3300026078 Bacteria 1617
154 Ga0207702_10595596 3300026078 Bacteria 1084
155 Ga0207641_10041261 3300026088 Bacteria 3867
156 Ga0207641_10251826 3300026088 Bacteria 1650
157 Ga0207648_10259200 3300026089 Bacteria 1551
158 Ga0207676_11142872 3300026095 Bacteria 771
159 Ga0207674_11077219 3300026116 Bacteria 773
160 Ga0207698_10044419 3300026142 Bacteria 3339
161 Ga0209389_1000068 3300027296 Bacteria 98954
162 Ga0209389_1000092 3300027296 Bacteria 82555
163 Ga0209589_1000115 3300027357 Bacteria 82537
164 Ga0209489_100340 3300027361 Bacteria 82555
165 Ga0209489_113471 3300027361 Bacteria 6562
166 Ga0209700_100117 3300027363 Bacteria 115595
167 Ga0268264_10000084 3300028381 Bacteria 242128
168 Ga0265334_10090155 3300028573 Bacteria 1119
169 Ga0265330_10153369 3300031235 Bacteria 979
170 Ga0265340_10080673 3300031247 Bacteria 1532
171 Ga0265339_10241466 3300031249 Bacteria 877
172 Ga0265316_11054934 3300031344 Bacteria 564
173 Ga0307508_10476238 3300031616 Bacteria 842
174 Ga0265314_10055914 3300031711 Bacteria 2720
175 Ga0265314_10075131 3300031711 Bacteria 2249
176 Ga0265342_10002241 3300031712 Bacteria 16904
177 Ga0265342_10268689 3300031712 Bacteria 905
178 Ga0307516_10042765 3300031730 Bacteria 4492
179 Ga0307516_10193479 3300031730 Bacteria 1758
180 Ga0315911_1000029 3300033442 Bacteria 82350
181 Ga0373923_0018900 3300035111 Bacteria 2660
182 Ga0373936_0074159 3300035113 Bacteria 1407
183 Ga0373953_0000640 3300035117 Bacteria 9722
184 Ga0373954_0000067 3300035118 Bacteria 37060
185 Ga0373956_0011308 3300035119 Bacteria 3676
186 Ga0373956_0292302 3300035119 Bacteria 776
187 Ga0373957_0099573 3300035120 Bacteria 1162
188 Ga0373957_0313304 3300035120 Bacteria 667
189 Ga0373955_0003543 3300035172 Bacteria 6870
190 Ga0373924_0079468 3300035410 Bacteria 1393
191 Ga0373931_0186689 3300035691 Bacteria 1231
192 Ga0373935_0671431 3300035692 Bacteria 761
193 Ga0373935_1043958 3300035692 Bacteria 608
194 Ga0373927_0015767 3300035695 Bacteria 4987
195 Ga0373927_0030629 3300035695 Bacteria 3510
196 Ga0373933_0004250 3300035724 Bacteria 7887
197 Ga0373933_0147723 3300035724 Bacteria 1487
198 Ga0373947_0042436 3300035725 Bacteria 2715
199 Ga0373947_0043170 3300035725 Bacteria 2693
200 Ga0373937_0014291 3300036401 Bacteria 7006
201 Ga0373925_0154139 3300037068 Bacteria 1806
202 Ga0395900_0496805 3300037418 Bacteria 1171
203 Ga0395905_0002179 3300037471 Bacteria 22137
204 Ga0436364_1334658 3300037853 Bacteria 1328
205 Ga0436364_1473104 3300037853 Bacteria 4659
206 Ga0395901_0038765 3300038443 Bacteria 4929
207 Ga0395901_0204896 3300038443 Bacteria 2067
208 Ga0436365_0261035 3300039437 Bacteria 1882
209 Ga0436365_0400373 3300039437 Bacteria 1950
210 Ga0436365_0746238 3300039437 Bacteria 576
211 Ga0436365_0949535 3300039437 Bacteria 1342
212 Ga0436365_1843246 3300039437 Bacteria 4333
213 Ga0451791_0682776 3300041451 Bacteria 1150
214 Ga0451797_1097118 3300041453 Bacteria 1020
215 Ga0451795_1528108 3300041456 Bacteria 711
216 Ga0451833_0045373 3300041491 Bacteria 1006
217 Ga0451835_0920193 3300041492 Bacteria 738
218 Ga0451841_1267291 3300041498 Bacteria 753
219 Ga0451853_0785409 3300041512 Bacteria 565
220 Ga0466961_0392386 3300044693 Bacteria 843
221 Ga0466964_0541209 3300044706 Bacteria 631
222 Ga0466964_0822891 3300044706 Bacteria 526
223 Ga0466968_0678949 3300044735 Bacteria 525
224 Ga0466957_1329646 3300044842 Bacteria 522
225 Ga0466959_0009099 3300045049 Bacteria 7051
226 Ga0466959_0063375 3300045049 Bacteria 2685
227 Ga0466967_0051109 3300045976 Bacteria 3621
228 Ga0466967_0170044 3300045976 Bacteria 2050
229 Ga0495592_0001030 3300046454 Bacteria 19355
230 Ga0495603_0036924 3300046455 Bacteria 2932
231 Ga0495629_0000398 3300046459 Bacteria 36605
232 Ga0495638_0296449 3300046460 Bacteria 873
233 Ga0495641_0154769 3300046461 Bacteria 1025
234 Ga0495651_0004166 3300046462 Bacteria 11071
235 Ga0495653_0000598 3300046463 Bacteria 27691
236 Ga0495580_0188870 3300046472 Bacteria 1421
237 Ga0495582_0270670 3300046473 Bacteria 975
238 Ga0495605_0307942 3300046474 Bacteria 669
239 Ga0495584_0443057 3300046491 Bacteria 660
240 Ga0495585_0099244 3300046492 Bacteria 1559
241 Ga0495608_0004383 3300046511 Bacteria 10114
242 Ga0495628_0030305 3300046516 Bacteria 4381
243 Ga0495630_1471932 3300046517 Bacteria 511
244 Ga0495648_0000552 3300046524 Bacteria 40192
245 Ga0495652_0009435 3300046529 Bacteria 8863
246 Ga0495640_0021304 3300046533 Bacteria 4759
247 Ga0495587_0018340 3300046536 Bacteria 4340
248 Ga0495645_0265239 3300046543 Bacteria 1135
249 Ga0495622_0298596 3300046557 Bacteria 702
250 Ga0495667_0000305 3300046559 Bacteria 31224
251 Ga0495656_0231953 3300046615 Bacteria 926
252 Ga0495634_0012910 3300046642 Bacteria 6045
253 Ga0495611_0415209 3300046648 Bacteria 614
254 Ga0495635_0000102 3300046663 Bacteria 50623
255 Ga0495659_0035265 3300046664 Bacteria 1762
256 Ga0495661_0561748 3300046665 Bacteria 539
257 Ga0495588_0090262 3300046674 Bacteria 1605
258 Ga0495657_0000677 3300046675 Bacteria 30671
259 Ga0495657_0639832 3300046675 Bacteria 614
260 Ga0495599_0001882 3300046678 Bacteria 12160
261 Ga0495623_0149011 3300046679 Bacteria 1384
262 Ga0495646_0005928 3300046680 Bacteria 7744
263 Ga0495613_0024285 3300046689 Bacteria 4516
264 Ga0495589_0097177 3300046794 Bacteria 1427
265 Ga0495600_0041727 3300046809 Bacteria 2990
266 Ga0495604_0001099 3300047317 Bacteria 22454
267 Ga0495674_0013937 3300047319 Bacteria 7542
268 Ga0495676_0092277 3300047321 Bacteria 2261
269 Ga0495680_0018405 3300047322 Bacteria 5932
270 Ga0495675_0024914 3300047444 Bacteria 3816
271 Ga0495684_0000088 3300047471 Bacteria 64704
272 Ga0495593_0009454 3300047673 Bacteria 5657
273 Ga0495602_0028311 3300048088 Bacteria 5364
274 Ga0496100_1495014 3300048903 Bacteria 533
275 Ga0496101_0041445 3300048904 Bacteria 3283
276 Ga0496101_0229452 3300048904 Bacteria 1443
277 Ga0496104_0079709 3300048907 Bacteria 3121
278 Ga0496107_0247583 3300048910 Bacteria 1326
279 Ga0496107_0680827 3300048910 Bacteria 757
280 Ga0496107_1173378 3300048910 Bacteria 553
281 Ga0496108_0195566 3300048911 Bacteria 1754
282 Ga0496108_0583812 3300048911 Bacteria 974
283 Ga0496109_0386912 3300048912 Bacteria 1321
284 Ga0496109_0526158 3300048912 Bacteria 1116
285 Ga0496110_0682535 3300048913 Bacteria 928
286 Ga0496110_0713931 3300048913 Bacteria 904
287 Ga0496110_1048522 3300048913 Bacteria 723
288 Ga0496111_0034791 3300048914 Bacteria 3598
289 Ga0496111_1129770 3300048914 Bacteria 557
290 Ga0496112_0089547 3300048915 Bacteria 3045
291 Ga0496113_0087190 3300048916 Bacteria 2399
292 Ga0496114_0123838 3300048917 Bacteria 2226
293 Ga0496115_0021991 3300048918 Bacteria 4933
294 Ga0496115_0033726 3300048918 Bacteria 4043
295 Ga0496115_1449740 3300048918 Bacteria 505
296 Ga0496118_0170454 3300048921 Bacteria 1331
297 Ga0496121_0023336 3300048924 Bacteria 5962
298 Ga0496121_0219095 3300048924 Bacteria 1342
299 Ga0496121_0382686 3300048924 Bacteria 927
300 Ga0496124_0107198 3300048927 Bacteria 2255
301 Ga0496125_0137981 3300048928 Bacteria 1702
302 Ga0496125_0193470 3300048928 Bacteria 1340
303 Ga0496126_0041919 3300048929 Bacteria 4232
304 Ga0496126_0069725 3300048929 Bacteria 3135
305 Ga0496126_0099408 3300048929 Bacteria 2548
306 Ga0496126_0255261 3300048929 Bacteria 1459
307 Ga0501031_0000620 3300049568 Bacteria 20973
308 Ga0501032_0003195 3300049569 Bacteria 12615
309 Ga0501032_0067877 3300049569 Bacteria 2381
310 Ga0501033_0000241 3300049570 Bacteria 52500
311 Ga0501033_0371109 3300049570 Bacteria 1000
312 Ga0501034_0000021 3300049571 Bacteria 266023
313 Ga0501034_0156939 3300049571 Bacteria 2249
314 Ga0501036_0000055 3300049572 Bacteria 73738
315 Ga0501037_0000398 3300049573 Bacteria 36170
316 Ga0501037_0054358 3300049573 Bacteria 2928
317 Ga0501038_0001235 3300049574 Bacteria 23202
318 Ga0501038_0022568 3300049574 Bacteria 5637
319 Ga0501039_0000293 3300049575 Bacteria 35520
320 Ga0501042_0156470 3300049578 Bacteria 1644
321 Ga0501043_0000033 3300049579 Bacteria 139500
322 Ga0501043_0197263 3300049579 Bacteria 1563
323 Ga0501046_0000452 3300049580 Bacteria 41240
324 Ga0501047_0000574 3300049581 Bacteria 39096
325 Ga0501047_0314850 3300049581 Bacteria 1405
326 Ga0501048_0000261 3300049582 Bacteria 35293
327 Ga0501067_0000045 3300049583 Bacteria 73394
328 Ga0501068_0003740 3300049584 Bacteria 8231
329 Ga0501069_0003820 3300049585 Bacteria 7754
330 Ga0501070_0002498 3300049586 Bacteria 16116
331 Ga0501070_0040157 3300049586 Bacteria 3902
332 Ga0501070_1060926 3300049586 Bacteria 626
333 Ga0501071_0057045 3300049587 Bacteria 2822
334 Ga0501072_0010633 3300049588 Bacteria 7009
335 Ga0501073_0000064 3300049589 Bacteria 65843
336 Ga0501074_0003795 3300049590 Bacteria 10738
337 Ga0501079_0002056 3300049741 Bacteria 14424
338 Ga0501080_0015417 3300049742 Bacteria 7044
339 Ga0501083_0000182 3300049744 Bacteria 40680
340 Ga0501035_0000241 3300049822 Bacteria 65546
341 Ga0501035_0078135 3300049822 Bacteria 2924
342 Ga0501035_0279464 3300049822 Bacteria 1411
343 Ga0501044_0000640 3300049823 Bacteria 42246
344 Ga0501044_0216597 3300049823 Bacteria 1867
345 Ga0501044_0369917 3300049823 Bacteria 1350
346 nmdc:mga0yw44_154923_c1 3300050492 Bacteria 1497
347 nmdc:mga0yw44_819436_c1 3300050492 Bacteria 632
348 nmdc:mga0k408_157786_c1 3300050493 Bacteria 1351
349 nmdc:mga0k408_399098_c1 3300050493 Bacteria 818
350 nmdc:mga07m45_463030_c1 3300050496 Bacteria 735
351 nmdc:mga0sz30_155795_c1 3300050516 Bacteria 1011
352 nmdc:mga0sz30_55549_c1 3300050516 Bacteria 1685
353 Ga0495601_0271054 3300053077 Bacteria 1107
354 Ga0500610_0204333 3300053079 Bacteria 949
355 Ga0495595_0003426 3300053084 Bacteria 6293
356 Ga0495619_0000166 3300053085 Bacteria 48296
357 Ga0495619_0260562 3300053085 Bacteria 1202
358 Ga0500647_0020921 3300053091 Bacteria 3049
359 Ga0500566_0000516 3300053094 Bacteria 21571
360 Ga0500640_015214 3300053095 Bacteria 3215
361 Ga0500557_000001 3300053105 Bacteria 241298
362 Ga0500569_002811 3300053109 Bacteria 3476
363 Ga0500572_000055 3300053111 Bacteria 34260
364 Ga0500595_006079 3300053119 Bacteria 5175
365 Ga0500595_035396 3300053119 Bacteria 1644
366 Ga0500608_024336 3300053122 Bacteria 2827
367 Ga0500608_267368 3300053122 Bacteria 656
368 Ga0500614_055157 3300053123 Bacteria 1055
369 Ga0500642_0000494 3300053130 Bacteria 12169
370 Ga0500559_0003497 3300053136 Bacteria 7705
371 Ga0500561_0135166 3300053137 Bacteria 760
372 Ga0500568_0214014 3300053139 Bacteria 704
373 Ga0500577_0149516 3300053142 Bacteria 990
374 Ga0500590_110998 3300053148 Bacteria 1301
375 Ga0500590_247257 3300053148 Bacteria 712
376 Ga0500590_333589 3300053148 Bacteria 551
377 Ga0500603_004001 3300053150 Bacteria 3153
378 Ga0500603_012467 3300053150 Bacteria 1954
379 Ga0500630_003623 3300053159 Bacteria 7478
380 Ga0500638_047245 3300053162 Bacteria 2084
381 Ga0500639_000004 3300053163 Bacteria 216921
382 Ga0500639_252059 3300053163 Bacteria 706
383 Ga0500637_0511472 3300053178 Bacteria 592
384 Ga0500625_000402 3300053729 Bacteria 11239
385 Ga0500609_014041 3300053731 Bacteria 1084
386 Ga0500596_000144 3300053735 Bacteria 10776
387 Ga0500601_019853 3300053737 Bacteria 774
388 Ga0501084_0002154 3300054114 Bacteria 15762
389 Ga0501082_0003212 3300060353 Bacteria 14245

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009174 Ga0105241_10519248 Ga0105241_105192481 127
2 3300035692 Ga0373935_1043958 Ga0373935_1043958_16_411 131
3 3300046461 Ga0495641_0154769 Ga0495641_0154769_602_997 131
4 3300046491 Ga0495584_0443057 Ga0495584_0443057_29_424 131
5 3300046557 Ga0495622_0298596 Ga0495622_0298596_26_421 131
6 3300046648 Ga0495611_0415209 Ga0495611_0415209_200_595 131
7 3300048910 Ga0496107_0680827 Ga0496107_0680827_26_421 131
8 3300048910 Ga0496107_1173378 Ga0496107_1173378_144_539 131
9 3300050492 nmdc:mga0yw44_819436_c1 nmdc:mga0yw44_819436_c1_206_601 131
10 3300050493 nmdc:mga0k408_399098_c1 nmdc:mga0k408_399098_c1_79_474 131
11 3300050516 nmdc:mga0sz30_155795_c1 nmdc:mga0sz30_155795_c1_501_896 131
12 3300053137 Ga0500561_0135166 Ga0500561_0135166_330_725 131
13 3300007788 Ga0099795_10075483 Ga0099795_100754832 137
14 3300044842 Ga0466957_1329646 Ga0466957_1329646_60_473 137
15 iso_pu_bacteria 2517093001 2517106592 139
16 iso_pu_bacteria 2824626560 2824630703 139
17 iso_pu_bacteria 2824671348 2824676235 139
18 iso_pu_bacteria 2824687955 2824692307 139
19 iso_pu_bacteria 2824696289 2824700644 139
20 iso_pu_bacteria 2824714736 2824718894 139
21 iso_pu_bacteria 2838122688 2838128690 139
22 iso_pu_bacteria 2841941048 2841948508 139
23 iso_pu_bacteria 2841949485 2841956377 139
24 iso_pu_bacteria 2841974524 2841979449 139
25 iso_pu_bacteria 2841983080 2841989929 139
26 iso_pu_bacteria 2842038055 2842039941 139
27 iso_pu_bacteria 2842045827 2842047114 139
28 iso_pu_bacteria 2847930680 2847935079 139
29 iso_pu_bacteria 2847939898 2847945641 139
30 iso_pu_bacteria 2874620515 2874626984 139
31 iso_pu_bacteria 2879083081 2879090808 139
32 iso_pu_bacteria 2885366525 2885373423 139
33 iso_pu_bacteria 2885409591 2885410324 139
34 iso_pu_bacteria 2904666416 2904669685 139
35 iso_pu_bacteria 2507262055 2507509530 140
36 iso_pu_bacteria 2508501009 2508543575 140
37 iso_pu_bacteria 2508501042 2508698637 140
38 iso_pu_bacteria 2935608549 2935611593 140
39 iso_pu_bacteria 2935648319 2935648968 140
40 iso_pu_bacteria 2935656913 2935656950 140
41 iso_pu_bacteria 2935819856 2935821070 140
42 iso_pu_bacteria 2935847175 2935850670 140
43 iso_pu_bacteria 2935908558 2935915453 140
44 iso_pu_bacteria 2935916978 2935921445 140
45 iso_pu_bacteria 2935926038 2935932949 140
46 iso_pu_bacteria 2935934488 2935941440 140
47 iso_pu_bacteria 2935942939 2935949723 140
48 iso_pu_bacteria 2935951376 2935958418 140
49 iso_pu_bacteria 2935967501 2935974412 140
50 iso_pu_bacteria 2935984226 2935989151 140
51 iso_pu_bacteria 2936011229 2936011878 140
52 iso_pu_bacteria 2936019824 2936020473 140
53 iso_pu_bacteria 2936028420 2936029167 140
54 iso_pu_bacteria 2936046547 2936047196 140
55 iso_pu_bacteria 2936055302 2936061424 140
56 iso_pu_bacteria 8019687851 8019688995 140
57 3300038443 Ga0395901_0038765 Ga0395901_0038765_2701_3141 141
58 3300049573 Ga0501037_0054358 Ga0501037_0054358_964_1404 141
59 3300049822 Ga0501035_0078135 Ga0501035_0078135_429_869 141
60 iso_pu_bacteria 2511231028 2511398577 141
61 iso_pu_bacteria 2513237096 2513659591 141
62 iso_pu_bacteria 2513237137 2513859644 141
63 iso_pu_bacteria 2513237145 2513921689 141
64 iso_pu_bacteria 2517572143 2517893272 141
65 iso_pu_bacteria 2857509624 2857510432 141
66 iso_pu_bacteria 2874628541 2874636445 141
67 iso_pu_bacteria 2885374607 2885374866 141
68 iso_pu_bacteria 2906635258 2906636175 141
69 iso_pu_bacteria 2906660503 2906667978 141
70 3300005434 Ga0070709_10002626 Ga0070709_100026264 142
71 3300005435 Ga0070714_100012170 Ga0070714_1000121703 142
72 3300005436 Ga0070713_100013925 Ga0070713_1000139252 142
73 3300005437 Ga0070710_10001750 Ga0070710_100017505 142
74 3300005439 Ga0070711_100004679 Ga0070711_1000046793 142
75 3300005445 Ga0070708_100243735 Ga0070708_1002437352 142
76 3300005536 Ga0070697_100108207 Ga0070697_1001082072 142
77 3300005578 Ga0068854_101124355 Ga0068854_1011243552 142
78 3300005616 Ga0068852_100120244 Ga0068852_1001202442 142
79 3300006163 Ga0070715_10000266 Ga0070715_100002668 142
80 3300006173 Ga0070716_100003732 Ga0070716_1000037323 142
81 3300006175 Ga0070712_100044663 Ga0070712_1000446632 142
82 3300007265 Ga0099794_10111793 Ga0099794_101117932 142
83 3300009093 Ga0105240_10039339 Ga0105240_100393393 142
84 3300010159 Ga0099796_10016025 Ga0099796_100160252 142
85 3300014325 Ga0163163_12882054 Ga0163163_128820541 142
86 3300025898 Ga0207692_10158341 Ga0207692_101583412 142
87 3300025906 Ga0207699_10005962 Ga0207699_100059623 142
88 3300025915 Ga0207693_10001357 Ga0207693_1000135718 142
89 3300025916 Ga0207663_10005723 Ga0207663_100057235 142
90 3300025928 Ga0207700_10223629 Ga0207700_102236291 142
91 3300025929 Ga0207664_10216751 Ga0207664_102167512 142
92 3300025939 Ga0207665_10006211 Ga0207665_100062119 142
93 3300025939 Ga0207665_11478167 Ga0207665_114781672 142
94 3300028573 Ga0265334_10090155 Ga0265334_100901552 142
95 3300031235 Ga0265330_10153369 Ga0265330_101533692 142
96 3300031247 Ga0265340_10080673 Ga0265340_100806732 142
97 3300031249 Ga0265339_10241466 Ga0265339_102414662 142
98 3300031344 Ga0265316_11054934 Ga0265316_110549341 142
99 3300031616 Ga0307508_10476238 Ga0307508_104762381 142
100 3300031711 Ga0265314_10055914 Ga0265314_100559142 142
101 3300031712 Ga0265342_10002241 Ga0265342_1000224118 142
102 3300031712 Ga0265342_10268689 Ga0265342_102686892 142
103 3300035111 Ga0373923_0018900 Ga0373923_0018900_1797_2225 142
104 3300035117 Ga0373953_0000640 Ga0373953_0000640_5895_6323 142
105 3300035118 Ga0373954_0000067 Ga0373954_0000067_10161_10589 142
106 3300035119 Ga0373956_0011308 Ga0373956_0011308_987_1415 142
107 3300035119 Ga0373956_0292302 Ga0373956_0292302_50_478 142
108 3300035120 Ga0373957_0099573 Ga0373957_0099573_32_460 142
109 3300035120 Ga0373957_0313304 Ga0373957_0313304_170_598 142
110 3300035172 Ga0373955_0003543 Ga0373955_0003543_1457_1885 142
111 3300035410 Ga0373924_0079468 Ga0373924_0079468_912_1340 142
112 3300035691 Ga0373931_0186689 Ga0373931_0186689_669_1097 142
113 3300035724 Ga0373933_0004250 Ga0373933_0004250_49_477 142
114 3300035724 Ga0373933_0147723 Ga0373933_0147723_781_1209 142
115 3300036401 Ga0373937_0014291 Ga0373937_0014291_50_478 142
116 3300045049 Ga0466959_0063375 Ga0466959_0063375_98_526 142
117 3300046454 Ga0495592_0001030 Ga0495592_0001030_12399_12827 142
118 3300046459 Ga0495629_0000398 Ga0495629_0000398_8801_9229 142
119 3300046462 Ga0495651_0004166 Ga0495651_0004166_3821_4249 142
120 3300046463 Ga0495653_0000598 Ga0495653_0000598_24298_24726 142
121 3300046511 Ga0495608_0004383 Ga0495608_0004383_8581_9009 142
122 3300046516 Ga0495628_0030305 Ga0495628_0030305_344_772 142
123 3300046517 Ga0495630_1471932 Ga0495630_1471932_55_483 142
124 3300046524 Ga0495648_0000552 Ga0495648_0000552_33465_33896 142
125 3300046529 Ga0495652_0009435 Ga0495652_0009435_980_1408 142
126 3300046533 Ga0495640_0021304 Ga0495640_0021304_2121_2549 142
127 3300046536 Ga0495587_0018340 Ga0495587_0018340_980_1408 142
128 3300046543 Ga0495645_0265239 Ga0495645_0265239_648_1076 142
129 3300046559 Ga0495667_0000305 Ga0495667_0000305_24268_24696 142
130 3300046642 Ga0495634_0012910 Ga0495634_0012910_4398_4826 142
131 3300046663 Ga0495635_0000102 Ga0495635_0000102_25928_26356 142
132 3300046675 Ga0495657_0000677 Ga0495657_0000677_27278_27706 142
133 3300046675 Ga0495657_0639832 Ga0495657_0639832_148_591 142
134 3300046678 Ga0495599_0001882 Ga0495599_0001882_9910_10338 142
135 3300046679 Ga0495623_0149011 Ga0495623_0149011_303_731 142
136 3300046680 Ga0495646_0005928 Ga0495646_0005928_1591_2019 142
137 3300046689 Ga0495613_0024285 Ga0495613_0024285_2007_2435 142
138 3300046809 Ga0495600_0041727 Ga0495600_0041727_2219_2647 142
139 3300047317 Ga0495604_0001099 Ga0495604_0001099_2318_2746 142
140 3300047319 Ga0495674_0013937 Ga0495674_0013937_5163_5591 142
141 3300047322 Ga0495680_0018405 Ga0495680_0018405_5481_5909 142
142 3300047444 Ga0495675_0024914 Ga0495675_0024914_2966_3394 142
143 3300047471 Ga0495684_0000088 Ga0495684_0000088_24440_24868 142
144 3300047673 Ga0495593_0009454 Ga0495593_0009454_1822_2250 142
145 3300048088 Ga0495602_0028311 Ga0495602_0028311_1695_2123 142
146 3300048907 Ga0496104_0079709 Ga0496104_0079709_2496_2924 142
147 3300048911 Ga0496108_0583812 Ga0496108_0583812_30_458 142
148 3300048912 Ga0496109_0386912 Ga0496109_0386912_355_783 142
149 3300048913 Ga0496110_0713931 Ga0496110_0713931_411_839 142
150 3300048914 Ga0496111_0034791 Ga0496111_0034791_588_1016 142
151 3300048915 Ga0496112_0089547 Ga0496112_0089547_2204_2632 142
152 3300048916 Ga0496113_0087190 Ga0496113_0087190_172_600 142
153 3300048918 Ga0496115_0033726 Ga0496115_0033726_1577_2005 142
154 3300049569 Ga0501032_0067877 Ga0501032_0067877_419_862 142
155 3300049570 Ga0501033_0371109 Ga0501033_0371109_504_947 142
156 3300049571 Ga0501034_0156939 Ga0501034_0156939_1617_2060 142
157 3300049574 Ga0501038_0022568 Ga0501038_0022568_2654_3097 142
158 3300049579 Ga0501043_0197263 Ga0501043_0197263_103_546 142
159 3300049581 Ga0501047_0314850 Ga0501047_0314850_373_816 142
160 3300049586 Ga0501070_1060926 Ga0501070_1060926_38_478 142
161 3300049822 Ga0501035_0279464 Ga0501035_0279464_509_952 142
162 3300049823 Ga0501044_0216597 Ga0501044_0216597_532_972 142
163 3300049823 Ga0501044_0369917 Ga0501044_0369917_451_894 142
164 3300053077 Ga0495601_0271054 Ga0495601_0271054_445_873 142
165 3300053084 Ga0495595_0003426 Ga0495595_0003426_3018_3446 142
166 3300053085 Ga0495619_0000166 Ga0495619_0000166_8709_9137 142
167 3300053085 Ga0495619_0260562 Ga0495619_0260562_111_542 142
168 3300053150 Ga0500603_012467 Ga0500603_012467_499_927 142
169 iso_pu_bacteria 2513237094 2513638094 142
170 iso_pu_bacteria 2513237102 2513705179 142
171 iso_pu_bacteria 2513237139 2513879371 142
172 iso_pu_bacteria 2513237161 2514016678 142
173 iso_pu_bacteria 2515154112 2515631235 142
174 iso_pu_bacteria 2617270735 2617354034 142
175 iso_pu_bacteria 2791355196 2793064714 142
176 iso_pu_bacteria 2802429603 2805920269 142
177 iso_pu_bacteria 2824600985 2824606591 142
178 iso_pu_bacteria 2824609381 2824613093 142
179 iso_pu_bacteria 2824617872 2824624550 142
180 iso_pu_bacteria 2824635225 2824640361 142
181 iso_pu_bacteria 2824644064 2824647844 142
182 iso_pu_bacteria 2824653114 2824655814 142
183 iso_pu_bacteria 2824723954 2824730570 142
184 iso_pu_bacteria 2841966195 2841967151 142
185 iso_pu_bacteria 2849076700 2849080184 142
186 iso_pu_bacteria 2874612657 2874613307 142
187 iso_pu_bacteria 2874645413 2874651200 142
188 iso_pu_bacteria 2879127579 2879134681 142
189 iso_pu_bacteria 2879142872 2879143164 142
190 iso_pu_bacteria 2881665667 2881673080 142
191 iso_pu_bacteria 2888419890 2888423523 142
192 iso_pu_bacteria 2904690495 2904696684 142
193 iso_pu_bacteria 2908756301 2908761304 142
194 iso_pu_bacteria 2935694250 2935698881 142
195 iso_pu_bacteria 2935769743 2935775825 142
196 iso_pu_bacteria 2935777560 2935780748 142
197 iso_pu_bacteria 2935785616 2935791438 142
198 iso_pu_bacteria 2935793552 2935799686 142
199 iso_pu_bacteria 2935975950 2935980784 142
200 iso_pu_bacteria 3005506211 3005511705 142
201 iso_pu_bacteria 3005594810 3005598276 142
202 iso_pu_bacteria 3005710791 3005713992 142
203 iso_pu_bacteria 8016522445 8016530567 142
204 iso_pu_bacteria 8016530956 8016535849 142
205 iso_pu_bacteria 8016539877 8016540127 142
206 iso_pu_bacteria 8016548790 8016553103 142
207 iso_pu_bacteria 8016557553 8016561485 142
208 iso_pu_bacteria 8016566248 8016574194 142
209 iso_pu_bacteria 8016575299 8016578296 142
210 iso_pu_bacteria 8016595262 8016599331 142
211 iso_pu_bacteria 8016603502 8016611705 142
212 iso_pu_bacteria 8016622563 8016627757 142
213 iso_pu_bacteria 8019530166 8019535576 142
214 iso_pu_bacteria 8019538911 8019543908 142
215 iso_pu_bacteria 8019547302 8019554861 142
216 iso_pu_bacteria 8019619141 8019627115 142
217 iso_pu_bacteria 8019629233 8019635433 142
218 iso_pu_bacteria 8019638758 8019644268 142
219 iso_pu_bacteria 8019648815 8019657327 142
220 iso_pu_bacteria 8019659431 8019663243 142
221 iso_pu_bacteria 8019668869 8019672856 142
222 iso_pu_bacteria 8019678201 8019683287 142
223 iso_pu_bacteria 8056689827 8056695775 142
224 iso_pu_bacteria 8056967851 8056972565 142
225 3300003215 JGI25153J46596_10004942 JGI25153J46596_100049424 143
226 3300003354 JGI25160J50197_1001994 JGI25160J50197_10019943 143
227 3300005262 Ga0065165_1022952 Ga0065165_10229522 143
228 3300005467 Ga0070706_100387150 Ga0070706_1003871502 143
229 3300005518 Ga0070699_100905768 Ga0070699_1009057682 143
230 3300006051 Ga0075364_10226155 Ga0075364_102261552 143
231 3300006177 Ga0075362_10244279 Ga0075362_102442792 143
232 3300006178 Ga0075367_10414211 Ga0075367_104142111 143
233 3300025297 Ga0209758_1002189 Ga0209758_10021896 143
234 3300025302 Ga0207426_1000382 Ga0207426_100038240 143
235 3300025303 Ga0209051_1078665 Ga0209051_10786652 143
236 3300025304 Ga0209257_1048923 Ga0209257_10489232 143
237 3300025910 Ga0207684_10169978 Ga0207684_101699782 143
238 3300025912 Ga0207707_10663465 Ga0207707_106634652 143
239 3300026116 Ga0207674_11077219 Ga0207674_110772192 143
240 3300035692 Ga0373935_0671431 Ga0373935_0671431_66_497 143
241 3300035695 Ga0373927_0015767 Ga0373927_0015767_956_1387 143
242 3300035725 Ga0373947_0043170 Ga0373947_0043170_1693_2124 143
243 3300037418 Ga0395900_0496805 Ga0395900_0496805_725_1156 143
244 3300039437 Ga0436365_1843246 Ga0436365_1843246_3126_3557 143
245 3300045976 Ga0466967_0170044 Ga0466967_0170044_414_845 143
246 3300046472 Ga0495580_0188870 Ga0495580_0188870_556_987 143
247 3300047321 Ga0495676_0092277 Ga0495676_0092277_1468_1899 143
248 3300048928 Ga0496125_0193470 Ga0496125_0193470_734_1165 143
249 3300050496 nmdc:mga07m45_463030_c1 nmdc:mga07m45_463030_c1_211_642 143
250 3300003911 JGI25405J52794_10017454 JGI25405J52794_100174542 144
251 3300005327 Ga0070658_10160243 Ga0070658_101602432 144
252 3300005539 Ga0068853_100136142 Ga0068853_1001361422 144
253 3300005937 Ga0081455_10026268 Ga0081455_100262683 144
254 3300006038 Ga0075365_10069838 Ga0075365_100698383 144
255 3300006173 Ga0070716_100364957 Ga0070716_1003649572 144
256 3300006186 Ga0075369_10058327 Ga0075369_100583272 144
257 3300006353 Ga0075370_10411725 Ga0075370_104117252 144
258 3300013104 Ga0157370_10612567 Ga0157370_106125672 144
259 3300025909 Ga0207705_10113969 Ga0207705_101139692 144
260 3300025939 Ga0207665_10604348 Ga0207665_106043482 144
261 3300025949 Ga0207667_11248007 Ga0207667_112480072 144
262 3300025981 Ga0207640_11211682 Ga0207640_112116822 144
263 3300026078 Ga0207702_10595596 Ga0207702_105955962 144
264 3300026142 Ga0207698_10044419 Ga0207698_100444191 144
265 3300041451 Ga0451791_0682776 Ga0451791_0682776_292_726 144
266 3300041453 Ga0451797_1097118 Ga0451797_1097118_323_757 144
267 3300041491 Ga0451833_0045373 Ga0451833_0045373_369_803 144
268 3300041492 Ga0451835_0920193 Ga0451835_0920193_159_593 144
269 3300041498 Ga0451841_1267291 Ga0451841_1267291_99_533 144
270 3300046674 Ga0495588_0090262 Ga0495588_0090262_265_699 144
271 3300050492 nmdc:mga0yw44_154923_c1 nmdc:mga0yw44_154923_c1_719_1153 144
272 3300050516 nmdc:mga0sz30_55549_c1 nmdc:mga0sz30_55549_c1_640_1074 144
273 3300053139 Ga0500568_0214014 Ga0500568_0214014_51_485 144
274 3300053148 Ga0500590_333589 Ga0500590_333589_37_471 144
275 3300005467 Ga0070706_100398546 Ga0070706_1003985461 145
276 3300005614 Ga0068856_101008541 Ga0068856_1010085412 145
277 3300005616 Ga0068852_101360931 Ga0068852_1013609312 145
278 3300006186 Ga0075369_10100118 Ga0075369_101001182 145
279 3300010375 Ga0105239_11796806 Ga0105239_117968062 145
280 3300013102 Ga0157371_10265721 Ga0157371_102657212 145
281 3300013104 Ga0157370_10120891 Ga0157370_101208912 145
282 3300013307 Ga0157372_10037018 Ga0157372_100370182 145
283 3300025297 Ga0209758_1058778 Ga0209758_10587781 145
284 3300025299 Ga0209256_1036264 Ga0209256_10362642 145
285 3300025904 Ga0207647_10272812 Ga0207647_102728122 145
286 3300025910 Ga0207684_11261461 Ga0207684_112614611 145
287 3300025949 Ga0207667_10418204 Ga0207667_104182042 145
288 3300025981 Ga0207640_10310611 Ga0207640_103106112 145
289 3300026078 Ga0207702_10265697 Ga0207702_102656972 145
290 3300033442 Ga0315911_1000029 Ga0315911_100002917 145
291 3300041512 Ga0451853_0785409 Ga0451853_0785409_36_473 145
292 3300046474 Ga0495605_0307942 Ga0495605_0307942_179_616 145
293 3300048924 Ga0496121_0219095 Ga0496121_0219095_265_702 145
294 3300048927 Ga0496124_0107198 Ga0496124_0107198_1331_1768 145
295 3300048928 Ga0496125_0137981 Ga0496125_0137981_282_719 145
296 3300048929 Ga0496126_0069725 Ga0496126_0069725_1420_1857 145
297 3300049568 Ga0501031_0000620 Ga0501031_0000620_15428_15877 145
298 3300049569 Ga0501032_0003195 Ga0501032_0003195_9825_10274 145
299 3300049570 Ga0501033_0000241 Ga0501033_0000241_17347_17796 145
300 3300049571 Ga0501034_0000021 Ga0501034_0000021_119364_119813 145
301 3300049572 Ga0501036_0000055 Ga0501036_0000055_10105_10554 145
302 3300049573 Ga0501037_0000398 Ga0501037_0000398_9469_9918 145
303 3300049574 Ga0501038_0001235 Ga0501038_0001235_12649_13098 145
304 3300049575 Ga0501039_0000293 Ga0501039_0000293_31747_32196 145
305 3300049578 Ga0501042_0156470 Ga0501042_0156470_793_1242 145
306 3300049579 Ga0501043_0000033 Ga0501043_0000033_38487_38936 145
307 3300049580 Ga0501046_0000452 Ga0501046_0000452_21741_22190 145
308 3300049581 Ga0501047_0000574 Ga0501047_0000574_25016_25465 145
309 3300049582 Ga0501048_0000261 Ga0501048_0000261_12559_13008 145
310 3300049583 Ga0501067_0000045 Ga0501067_0000045_23873_24322 145
311 3300049584 Ga0501068_0003740 Ga0501068_0003740_3325_3774 145
312 3300049585 Ga0501069_0003820 Ga0501069_0003820_1112_1561 145
313 3300049586 Ga0501070_0002498 Ga0501070_0002498_2261_2710 145
314 3300049586 Ga0501070_0040157 Ga0501070_0040157_3234_3683 145
315 3300049587 Ga0501071_0057045 Ga0501071_0057045_2336_2785 145
316 3300049588 Ga0501072_0010633 Ga0501072_0010633_4585_5034 145
317 3300049589 Ga0501073_0000064 Ga0501073_0000064_63842_64291 145
318 3300049590 Ga0501074_0003795 Ga0501074_0003795_5994_6443 145
319 3300049741 Ga0501079_0002056 Ga0501079_0002056_1795_2244 145
320 3300049742 Ga0501080_0015417 Ga0501080_0015417_4402_4851 145
321 3300049744 Ga0501083_0000182 Ga0501083_0000182_35188_35637 145
322 3300049822 Ga0501035_0000241 Ga0501035_0000241_25015_25464 145
323 3300049823 Ga0501044_0000640 Ga0501044_0000640_22411_22860 145
324 3300053079 Ga0500610_0204333 Ga0500610_0204333_64_501 145
325 3300053109 Ga0500569_002811 Ga0500569_002811_2332_2769 145
326 3300053119 Ga0500595_035396 Ga0500595_035396_482_919 145
327 3300053142 Ga0500577_0149516 Ga0500577_0149516_246_683 145
328 3300053731 Ga0500609_014041 Ga0500609_014041_279_716 145
329 3300054114 Ga0501084_0002154 Ga0501084_0002154_14400_14849 145
330 3300060353 Ga0501082_0003212 Ga0501082_0003212_12294_12743 145
331 3300003214 JGI25165J46597_1011926 JGI25165J46597_10119262 146
332 3300003762 Ga0055542_1003986 Ga0055542_10039862 146
333 3300003794 Ga0055531_10011335 Ga0055531_100113352 146
334 3300003794 Ga0055531_10017361 Ga0055531_100173613 146
335 3300004625 Ga0055543_1001961 Ga0055543_10019616 146
336 3300005262 Ga0065165_1001623 Ga0065165_10016233 146
337 3300005262 Ga0065165_1010370 Ga0065165_10103702 146
338 3300005355 Ga0070671_101012969 Ga0070671_1010129691 146
339 3300005436 Ga0070713_100238132 Ga0070713_1002381322 146
340 3300005436 Ga0070713_100334507 Ga0070713_1003345072 146
341 3300005437 Ga0070710_10206926 Ga0070710_102069262 146
342 3300005437 Ga0070710_10735489 Ga0070710_107354892 146
343 3300005471 Ga0070698_100560727 Ga0070698_1005607271 146
344 3300005535 Ga0070684_100101115 Ga0070684_1001011152 146
345 3300005536 Ga0070697_100222758 Ga0070697_1002227582 146
346 3300005539 Ga0068853_100148325 Ga0068853_1001483253 146
347 3300005563 Ga0068855_100713705 Ga0068855_1007137052 146
348 3300005577 Ga0068857_100127826 Ga0068857_1001278261 146
349 3300005617 Ga0068859_100129767 Ga0068859_1001297673 146
350 3300005718 Ga0068866_10231903 Ga0068866_102319031 146
351 3300005841 Ga0068863_100074152 Ga0068863_1000741522 146
352 3300005842 Ga0068858_100558360 Ga0068858_1005583602 146
353 3300005843 Ga0068860_100084760 Ga0068860_1000847602 146
354 3300005983 Ga0081540_1160280 Ga0081540_11602802 146
355 3300005983 Ga0081540_1192803 Ga0081540_11928032 146
356 3300006028 Ga0070717_11718919 Ga0070717_117189191 146
357 3300006058 Ga0075432_10238115 Ga0075432_102381152 146
358 3300006173 Ga0070716_100079385 Ga0070716_1000793852 146
359 3300006173 Ga0070716_100114536 Ga0070716_1001145362 146
360 3300006173 Ga0070716_100237628 Ga0070716_1002376281 146
361 3300006175 Ga0070712_100061062 Ga0070712_1000610622 146
362 3300006175 Ga0070712_100225413 Ga0070712_1002254132 146
363 3300006353 Ga0075370_10249034 Ga0075370_102490342 146
364 3300006358 Ga0068871_100605711 Ga0068871_1006057112 146
365 3300006931 Ga0097620_100129761 Ga0097620_1001297613 146
366 3300006942 Ga0099824_1018161 Ga0099824_10181613 146
367 3300009098 Ga0105245_10596251 Ga0105245_105962512 146
368 3300009101 Ga0105247_10020110 Ga0105247_100201104 146
369 3300009545 Ga0105237_10551823 Ga0105237_105518232 146
370 3300010159 Ga0099796_10047165 Ga0099796_100471652 146
371 3300010375 Ga0105239_10204235 Ga0105239_102042352 146
372 3300010375 Ga0105239_10387766 Ga0105239_103877662 146
373 3300010375 Ga0105239_10782580 Ga0105239_107825802 146
374 3300013105 Ga0157369_11162095 Ga0157369_111620951 146
375 3300013297 Ga0157378_11604432 Ga0157378_116044322 146
376 3300013306 Ga0163162_10223195 Ga0163162_102231953 146
377 3300020080 Ga0206350_10299931 Ga0206350_102999312 146
378 3300025254 Ga0209148_1000493 Ga0209148_100049331 146
379 3300025261 Ga0209233_1008850 Ga0209233_10088504 146
380 3300025261 Ga0209233_1009635 Ga0209233_10096352 146
381 3300025261 Ga0209233_1023600 Ga0209233_10236001 146
382 3300025295 Ga0209564_1031054 Ga0209564_10310542 146
383 3300025297 Ga0209758_1000100 Ga0209758_1000100161 146
384 3300025297 Ga0209758_1001732 Ga0209758_100173221 146
385 3300025299 Ga0209256_1002940 Ga0209256_10029402 146
386 3300025302 Ga0207426_1065160 Ga0207426_10651602 146
387 3300025304 Ga0209257_1001443 Ga0209257_100144321 146
388 3300025898 Ga0207692_10567348 Ga0207692_105673481 146
389 3300025899 Ga0207642_10148801 Ga0207642_101488012 146
390 3300025900 Ga0207710_10019276 Ga0207710_100192763 146
391 3300025906 Ga0207699_10109450 Ga0207699_101094502 146
392 3300025910 Ga0207684_10117761 Ga0207684_101177612 146
393 3300025912 Ga0207707_10682882 Ga0207707_106828822 146
394 3300025915 Ga0207693_10022673 Ga0207693_100226732 146
395 3300025915 Ga0207693_10047889 Ga0207693_100478893 146
396 3300025916 Ga0207663_10408156 Ga0207663_104081562 146
397 3300025916 Ga0207663_10947603 Ga0207663_109476031 146
398 3300025919 Ga0207657_10218263 Ga0207657_102182632 146
399 3300025927 Ga0207687_10136105 Ga0207687_101361052 146
400 3300025928 Ga0207700_10274706 Ga0207700_102747062 146
401 3300025928 Ga0207700_10295245 Ga0207700_102952452 146
402 3300025929 Ga0207664_10827719 Ga0207664_108277192 146
403 3300025931 Ga0207644_10544581 Ga0207644_105445812 146
404 3300025938 Ga0207704_10603806 Ga0207704_106038062 146
405 3300025939 Ga0207665_10018185 Ga0207665_100181853 146
406 3300025939 Ga0207665_10076546 Ga0207665_100765462 146
407 3300025939 Ga0207665_10133785 Ga0207665_101337852 146
408 3300025944 Ga0207661_10382615 Ga0207661_103826152 146
409 3300025949 Ga0207667_10410821 Ga0207667_104108212 146
410 3300025949 Ga0207667_10458318 Ga0207667_104583182 146
411 3300025986 Ga0207658_10503801 Ga0207658_105038012 146
412 3300026041 Ga0207639_10416798 Ga0207639_104167982 146
413 3300026067 Ga0207678_10180439 Ga0207678_101804392 146
414 3300026067 Ga0207678_10743036 Ga0207678_107430362 146
415 3300026067 Ga0207678_10807494 Ga0207678_108074942 146
416 3300026088 Ga0207641_10041261 Ga0207641_100412612 146
417 3300026088 Ga0207641_10251826 Ga0207641_102518262 146
418 3300026089 Ga0207648_10259200 Ga0207648_102592002 146
419 3300026095 Ga0207676_11142872 Ga0207676_111428722 146
420 3300027296 Ga0209389_1000068 Ga0209389_100006834 146
421 3300027296 Ga0209389_1000092 Ga0209389_100009251 146
422 3300027357 Ga0209589_1000115 Ga0209589_100011551 146
423 3300027361 Ga0209489_100340 Ga0209489_10034051 146
424 3300027361 Ga0209489_113471 Ga0209489_1134714 146
425 3300027363 Ga0209700_100117 Ga0209700_10011769 146
426 3300028381 Ga0268264_10000084 Ga0268264_10000084162 146
427 3300031711 Ga0265314_10075131 Ga0265314_100751312 146
428 3300031730 Ga0307516_10042765 Ga0307516_100427652 146
429 3300031730 Ga0307516_10193479 Ga0307516_101934792 146
430 3300035113 Ga0373936_0074159 Ga0373936_0074159_471_911 146
431 3300035695 Ga0373927_0030629 Ga0373927_0030629_2372_2812 146
432 3300035725 Ga0373947_0042436 Ga0373947_0042436_46_486 146
433 3300037068 Ga0373925_0154139 Ga0373925_0154139_857_1297 146
434 3300037471 Ga0395905_0002179 Ga0395905_0002179_15638_16078 146
435 3300037853 Ga0436364_1334658 Ga0436364_1334658_540_992 146
436 3300037853 Ga0436364_1473104 Ga0436364_1473104_4123_4563 146
437 3300038443 Ga0395901_0204896 Ga0395901_0204896_1488_1928 146
438 3300039437 Ga0436365_0261035 Ga0436365_0261035_1342_1782 146
439 3300039437 Ga0436365_0400373 Ga0436365_0400373_1113_1565 146
440 3300039437 Ga0436365_0746238 Ga0436365_0746238_61_513 146
441 3300039437 Ga0436365_0949535 Ga0436365_0949535_775_1227 146
442 3300041456 Ga0451795_1528108 Ga0451795_1528108_134_574 146
443 3300044693 Ga0466961_0392386 Ga0466961_0392386_388_828 146
444 3300044706 Ga0466964_0541209 Ga0466964_0541209_100_540 146
445 3300044706 Ga0466964_0822891 Ga0466964_0822891_20_460 146
446 3300044735 Ga0466968_0678949 Ga0466968_0678949_20_460 146
447 3300045049 Ga0466959_0009099 Ga0466959_0009099_5322_5762 146
448 3300045976 Ga0466967_0051109 Ga0466967_0051109_2030_2470 146
449 3300046455 Ga0495603_0036924 Ga0495603_0036924_56_496 146
450 3300046460 Ga0495638_0296449 Ga0495638_0296449_371_811 146
451 3300046473 Ga0495582_0270670 Ga0495582_0270670_28_468 146
452 3300046492 Ga0495585_0099244 Ga0495585_0099244_658_1098 146
453 3300046615 Ga0495656_0231953 Ga0495656_0231953_51_491 146
454 3300046664 Ga0495659_0035265 Ga0495659_0035265_282_722 146
455 3300046665 Ga0495661_0561748 Ga0495661_0561748_86_526 146
456 3300046794 Ga0495589_0097177 Ga0495589_0097177_219_659 146
457 3300048903 Ga0496100_1495014 Ga0496100_1495014_59_499 146
458 3300048904 Ga0496101_0041445 Ga0496101_0041445_335_775 146
459 3300048904 Ga0496101_0229452 Ga0496101_0229452_346_786 146
460 3300048910 Ga0496107_0247583 Ga0496107_0247583_839_1279 146
461 3300048911 Ga0496108_0195566 Ga0496108_0195566_667_1107 146
462 3300048912 Ga0496109_0526158 Ga0496109_0526158_258_698 146
463 3300048913 Ga0496110_0682535 Ga0496110_0682535_94_534 146
464 3300048913 Ga0496110_1048522 Ga0496110_1048522_241_681 146
465 3300048914 Ga0496111_1129770 Ga0496111_1129770_22_462 146
466 3300048917 Ga0496114_0123838 Ga0496114_0123838_1623_2063 146
467 3300048918 Ga0496115_0021991 Ga0496115_0021991_625_1065 146
468 3300048918 Ga0496115_1449740 Ga0496115_1449740_50_490 146
469 3300048921 Ga0496118_0170454 Ga0496118_0170454_329_844 146
470 3300048924 Ga0496121_0023336 Ga0496121_0023336_3109_3624 146
471 3300048924 Ga0496121_0382686 Ga0496121_0382686_252_692 146
472 3300048929 Ga0496126_0041919 Ga0496126_0041919_2895_3335 146
473 3300048929 Ga0496126_0099408 Ga0496126_0099408_681_1121 146
474 3300048929 Ga0496126_0255261 Ga0496126_0255261_805_1314 146
475 3300050493 nmdc:mga0k408_157786_c1 nmdc:mga0k408_157786_c1_50_490 146
476 3300053091 Ga0500647_0020921 Ga0500647_0020921_832_1272 146
477 3300053094 Ga0500566_0000516 Ga0500566_0000516_16286_16726 146
478 3300053095 Ga0500640_015214 Ga0500640_015214_1268_1708 146
479 3300053105 Ga0500557_000001 Ga0500557_000001_133413_133853 146
480 3300053111 Ga0500572_000055 Ga0500572_000055_16286_16726 146
481 3300053119 Ga0500595_006079 Ga0500595_006079_1957_2469 146
482 3300053122 Ga0500608_024336 Ga0500608_024336_1804_2244 146
483 3300053122 Ga0500608_267368 Ga0500608_267368_188_628 146
484 3300053123 Ga0500614_055157 Ga0500614_055157_411_926 146
485 3300053130 Ga0500642_0000494 Ga0500642_0000494_5389_5829 146
486 3300053136 Ga0500559_0003497 Ga0500559_0003497_2339_2779 146
487 3300053148 Ga0500590_110998 Ga0500590_110998_201_641 146
488 3300053148 Ga0500590_247257 Ga0500590_247257_164_604 146
489 3300053150 Ga0500603_004001 Ga0500603_004001_1136_1576 146
490 3300053159 Ga0500630_003623 Ga0500630_003623_4706_5146 146
491 3300053162 Ga0500638_047245 Ga0500638_047245_1133_1573 146
492 3300053163 Ga0500639_000004 Ga0500639_000004_135112_135552 146
493 3300053163 Ga0500639_252059 Ga0500639_252059_79_519 146
494 3300053178 Ga0500637_0511472 Ga0500637_0511472_79_519 146
495 3300053729 Ga0500625_000402 Ga0500625_000402_10436_10876 146
496 3300053735 Ga0500596_000144 Ga0500596_000144_6596_7036 146
497 3300053737 Ga0500601_019853 Ga0500601_019853_258_698 146

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06170

DUF983

Protein of unknown function (DUF983)

44

126

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End Superfamily
af_Q9VEF6_1_169_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.4956 86 146 1.20.140.150
af_I1K0K7_497_567_1.10.260.100 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain); 0.3339 61 124 1.10.260.100
af_Q9W0H3_1_305_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.3337 77 131 3.40.50.1820
af_Q9ZUV9_60_465_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.3272 62 132 1.20.1530.20
af_I1K0K7_497_567_1.10.260.100 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain); 0.2917 61 124 1.10.260.100
ID Description Score Start End GO Terms
AF-A0A4Y9EPG5-F1-model_v4 DUF983 domain-containing protein 0.8656 26 133 GO:0016020
AF-A0A059FNV1-F1-model_v4 DUF983 domain-containing protein 0.8546 23 133 GO:0016020
AF-A0A4Q4CX04-F1-model_v4 DUF983 domain-containing protein 0.8493 26 134 GO:0016020
AF-A0A521GY24-F1-model_v4 DUF983 domain-containing protein 0.8486 25 133 GO:0016020
AF-A0A3L7J9N3-F1-model_v4 DUF983 domain-containing protein 0.8479 22 133 GO:0016020

Feature Viewer

pLDDT pTM Quality
70.73 0.58 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map