F455031

General Info

Members Datasets Scaffolds Average Seq Length
497 229 994 226

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10655075|Ga0105248_106550752
Length 253
Sequence MAAATEEQKVSGPDPSAPPEPEERYFLEGPQKRSTELFRILRILGEFIRGFRVLHFVGPCVSVFGSARFARDHPYYELAREVGRGLGRMGFTVMTGGGPGIMEAASRGAREVGAPTVGCNIQLPSEQQPNPYLDIAYTFDHFYARKVCFVRPSEGFVIFPGGFGTLDELYESLTLIQTGKIKHFPVVLFDSDYWGKMVDWIREELLTDGMISPDDLELLRVTDDIDQAVDHVLECYDRRCADDPHAPHKEDAQ

Samples

Sample ID Description Type Environment
1 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
62 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
103 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
104 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
105 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
106 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
107 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
108 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
109 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
110 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
111 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
112 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
113 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
114 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
115 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
116 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
117 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
118 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
119 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
120 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
121 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
122 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
123 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
124 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
127 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
128 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
129 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
130 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
131 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
132 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
133 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
134 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
135 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
136 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
137 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
138 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
139 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
140 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
141 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
142 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
143 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
144 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
145 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
146 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
147 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
148 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
149 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
150 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
151 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
152 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
153 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
154 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
155 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
156 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
157 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
158 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
159 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
160 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
161 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
162 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
163 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
164 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
165 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
166 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
167 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
168 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
169 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
170 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
171 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
172 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
173 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
174 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
175 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
176 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
177 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
178 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
179 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
180 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
181 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
182 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
183 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
184 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
185 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
186 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
187 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
188 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
189 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
190 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
191 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
192 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
193 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
194 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
195 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
196 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
197 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
198 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
199 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
200 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
201 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
202 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
203 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
204 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
205 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
206 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
207 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
208 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
209 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
212 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
213 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
214 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
215 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
216 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
217 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
218 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
219 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
220 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
221 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
222 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
223 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
224 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
225 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
226 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
227 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
228 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
229 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.79
Metatranscriptomes 1.21
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.65
Rhizosphere 90.54
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105248_10655075 3300009177 Bacteria 1185
2 Ga0070658_10033874 3300005327 Bacteria 4110
3 Ga0070658_10051967 3300005327 Bacteria 3322
4 Ga0070683_100008896 3300005329 Bacteria 8555
5 Ga0070683_100024419 3300005329 Bacteria 5414
6 Ga0070683_100044350 3300005329 Bacteria 4100
7 Ga0070690_100023281 3300005330 Bacteria 3798
8 Ga0070680_100002720 3300005336 Bacteria 13110
9 Ga0070680_100036450 3300005336 Bacteria 3973
10 Ga0070680_100055028 3300005336 Bacteria 3251
11 Ga0070680_100086488 3300005336 Bacteria 2591
12 Ga0070680_100152598 3300005336 Bacteria 1939
13 Ga0070682_100248058 3300005337 Bacteria 1282
14 Ga0070682_100492846 3300005337 Bacteria 948
15 Ga0068868_100247654 3300005338 Bacteria 1499
16 Ga0070660_100001150 3300005339 Bacteria 17854
17 Ga0070660_100007158 3300005339 Bacteria 7757
18 Ga0070660_100042321 3300005339 Bacteria 3476
19 Ga0070660_100079335 3300005339 Bacteria 2575
20 Ga0070689_100369226 3300005340 Bacteria 1207
21 Ga0070661_100030430 3300005344 Bacteria 3900
22 Ga0070661_100081223 3300005344 Bacteria 2393
23 Ga0070661_100145178 3300005344 Bacteria 1791
24 Ga0070661_100536710 3300005344 Bacteria 940
25 Ga0070674_100593467 3300005356 Bacteria 935
26 Ga0070659_100045496 3300005366 Bacteria 3438
27 Ga0070659_100272059 3300005366 Bacteria 1408
28 Ga0070659_100315274 3300005366 Bacteria 1306
29 Ga0070659_100359695 3300005366 Bacteria 1223
30 Ga0070703_10027824 3300005406 Bacteria 1687
31 Ga0070713_100228336 3300005436 Bacteria 1691
32 Ga0070713_100430100 3300005436 Bacteria 1237
33 Ga0070713_100806945 3300005436 Bacteria 900
34 Ga0070705_100139688 3300005440 Bacteria 1592
35 Ga0070700_100229830 3300005441 Bacteria 1319
36 Ga0070662_100136114 3300005457 Bacteria 1899
37 Ga0070681_10030692 3300005458 Bacteria 5393
38 Ga0070681_10083756 3300005458 Bacteria 3142
39 Ga0070681_10174157 3300005458 Bacteria 2073
40 Ga0070681_10174185 3300005458 Bacteria 2073
41 Ga0070681_10174302 3300005458 Bacteria 2072
42 Ga0070681_10311848 3300005458 Bacteria 1482
43 Ga0070707_100470638 3300005468 Bacteria 1218
44 Ga0070679_100029417 3300005530 Bacteria 5420
45 Ga0070679_100060051 3300005530 Bacteria 3789
46 Ga0070679_100069277 3300005530 Bacteria 3519
47 Ga0070684_100014181 3300005535 Bacteria 6446
48 Ga0070684_100024442 3300005535 Bacteria 5069
49 Ga0070684_100026188 3300005535 Bacteria 4911
50 Ga0070684_100075231 3300005535 Bacteria 2978
51 Ga0070684_100185339 3300005535 Bacteria 1892
52 Ga0070684_100188647 3300005535 Bacteria 1875
53 Ga0070684_100217040 3300005535 Bacteria 1744
54 Ga0070684_100421462 3300005535 Bacteria 1232
55 Ga0070684_100877898 3300005535 Bacteria 840
56 Ga0070697_100759928 3300005536 Bacteria 857
57 Ga0068853_100140526 3300005539 Bacteria 2167
58 Ga0068853_100154856 3300005539 Bacteria 2065
59 Ga0070665_100015735 3300005548 Bacteria 7600
60 Ga0070704_100108306 3300005549 Bacteria 2109
61 Ga0068855_100017430 3300005563 Bacteria 8639
62 Ga0068855_100025215 3300005563 Bacteria 7119
63 Ga0068855_100071129 3300005563 Bacteria 4046
64 Ga0068855_100188935 3300005563 Bacteria 2325
65 Ga0068855_100303613 3300005563 Bacteria 1767
66 Ga0068857_100081947 3300005577 Bacteria 2881
67 Ga0068857_100230747 3300005577 Bacteria 1693
68 Ga0068854_100135772 3300005578 Bacteria 1883
69 Ga0070702_100361662 3300005615 Bacteria 1026
70 Ga0068852_100166685 3300005616 Bacteria 2062
71 Ga0068852_100301425 3300005616 Bacteria 1551
72 Ga0068852_100391632 3300005616 Bacteria 1365
73 Ga0068861_100907850 3300005719 Bacteria 835
74 Ga0081455_10067239 3300005937 Bacteria 2987
75 Ga0081540_1019583 3300005983 Bacteria 4105
76 Ga0081539_10014665 3300005985 Bacteria 5770
77 Ga0081539_10036490 3300005985 Bacteria 2941
78 Ga0070717_10192160 3300006028 Bacteria 1784
79 Ga0070717_10242787 3300006028 Bacteria 1589
80 Ga0070712_100031849 3300006175 Bacteria 3556
81 Ga0070712_100773032 3300006175 Bacteria 823
82 Ga0075429_100462384 3300006880 Bacteria 1112
83 Ga0068865_100127509 3300006881 Bacteria 1902
84 Ga0075435_100114520 3300007076 Bacteria 2245
85 Ga0105240_10050881 3300009093 Bacteria 5219
86 Ga0105240_10094239 3300009093 Bacteria 3653
87 Ga0105240_10226833 3300009093 Bacteria 2173
88 Ga0111539_10211172 3300009094 Bacteria 2262
89 Ga0105245_10040229 3300009098 Bacteria 4164
90 Ga0105245_10152854 3300009098 Bacteria 2184
91 Ga0105245_10438003 3300009098 Bacteria 1313
92 Ga0114129_11583967 3300009147 Bacteria 802
93 Ga0105243_10038812 3300009148 Bacteria 3710
94 Ga0105243_10047991 3300009148 Bacteria 3365
95 Ga0105243_10101085 3300009148 Bacteria 2394
96 Ga0105241_10064854 3300009174 Bacteria 2821
97 Ga0105242_10020262 3300009176 Bacteria 5214
98 Ga0105242_10240866 3300009176 Bacteria 1626
99 Ga0105237_10070034 3300009545 Bacteria 3503
100 Ga0105238_10013829 3300009551 Bacteria 8158
101 Ga0105238_10080991 3300009551 Bacteria 3236
102 Ga0105238_10222168 3300009551 Bacteria 1865
103 Ga0105238_10429053 3300009551 Bacteria 1317
104 Ga0105239_10282772 3300010375 Bacteria 1868
105 Ga0105239_10606112 3300010375 Bacteria 1249
106 Ga0157371_10289185 3300013102 Bacteria 1185
107 Ga0157370_10031447 3300013104 Bacteria 5191
108 Ga0157370_10033273 3300013104 Bacteria 5026
109 Ga0157370_10047125 3300013104 Bacteria 4132
110 Ga0157369_10001698 3300013105 Bacteria 26844
111 Ga0157369_10012915 3300013105 Bacteria 9465
112 Ga0157369_10015699 3300013105 Bacteria 8534
113 Ga0157369_10026871 3300013105 Bacteria 6382
114 Ga0157369_10587904 3300013105 Bacteria 1150
115 Ga0157374_10262859 3300013296 Bacteria 1700
116 Ga0157378_10475240 3300013297 Bacteria 1244
117 Ga0157372_10054897 3300013307 Bacteria 4447
118 Ga0157372_10081059 3300013307 Bacteria 3673
119 Ga0157375_10059229 3300013308 Bacteria 3793
120 Ga0163163_10843101 3300014325 Bacteria 980
121 Ga0206356_10240149 3300020070 Bacteria 5263
122 Ga0206356_10469898 3300020070 Bacteria 947
123 Ga0206356_11661934 3300020070 Bacteria 1435
124 Ga0206354_11302686 3300020081 Bacteria 1968
125 Ga0206354_11502204 3300020081 Bacteria 1063
126 Ga0206353_10147248 3300020082 Bacteria 4368
127 Ga0213874_10032321 3300021377 Bacteria 1519
128 Ga0207656_10048177 3300025321 Bacteria 1834
129 Ga0207653_10015839 3300025885 Bacteria 2367
130 Ga0207692_10388416 3300025898 Bacteria 868
131 Ga0207642_10117074 3300025899 Bacteria 1368
132 Ga0207685_10024007 3300025905 Bacteria 2084
133 Ga0207645_10114745 3300025907 Bacteria 1745
134 Ga0207705_10022025 3300025909 Bacteria 4547
135 Ga0207705_10077093 3300025909 Bacteria 2424
136 Ga0207705_10108170 3300025909 Bacteria 2052
137 Ga0207707_10009579 3300025912 Bacteria 8404
138 Ga0207707_10061475 3300025912 Bacteria 3268
139 Ga0207707_10065901 3300025912 Bacteria 3153
140 Ga0207707_10076503 3300025912 Bacteria 2921
141 Ga0207707_10118698 3300025912 Bacteria 2312
142 Ga0207695_10120127 3300025913 Bacteria 2597
143 Ga0207695_10232093 3300025913 Bacteria 1749
144 Ga0207671_10082264 3300025914 Bacteria 2416
145 Ga0207693_10060031 3300025915 Bacteria 2979
146 Ga0207693_10107738 3300025915 Bacteria 2186
147 Ga0207693_10592638 3300025915 Bacteria 863
148 Ga0207663_10706163 3300025916 Bacteria 799
149 Ga0207660_10027263 3300025917 Bacteria 3896
150 Ga0207660_10116911 3300025917 Bacteria 2015
151 Ga0207662_10093022 3300025918 Bacteria 1857
152 Ga0207657_10000073 3300025919 Bacteria 93299
153 Ga0207657_10007410 3300025919 Bacteria 11251
154 Ga0207657_10010451 3300025919 Bacteria 9260
155 Ga0207657_10011084 3300025919 Bacteria 8958
156 Ga0207657_10024156 3300025919 Bacteria 5641
157 Ga0207657_10139817 3300025919 Bacteria 1979
158 Ga0207657_10197902 3300025919 Bacteria 1618
159 Ga0207649_10007318 3300025920 Bacteria 6008
160 Ga0207649_10048607 3300025920 Bacteria 2617
161 Ga0207652_10066272 3300025921 Bacteria 3129
162 Ga0207652_10082082 3300025921 Bacteria 2820
163 Ga0207652_10095794 3300025921 Bacteria 2615
164 Ga0207652_10354124 3300025921 Bacteria 1325
165 Ga0207646_10152945 3300025922 Bacteria 2081
166 Ga0207646_10838388 3300025922 Bacteria 818
167 Ga0207694_10032386 3300025924 Bacteria 4001
168 Ga0207694_10387539 3300025924 Bacteria 1161
169 Ga0207687_10034808 3300025927 Bacteria 3423
170 Ga0207644_10081918 3300025931 Bacteria 2386
171 Ga0207644_10386594 3300025931 Bacteria 1142
172 Ga0207690_10017168 3300025932 Bacteria 4417
173 Ga0207690_10244638 3300025932 Bacteria 1383
174 Ga0207706_10348066 3300025933 Bacteria 1288
175 Ga0207686_10018205 3300025934 Bacteria 3973
176 Ga0207686_10341772 3300025934 Bacteria 1124
177 Ga0207686_10368178 3300025934 Bacteria 1087
178 Ga0207669_10394701 3300025937 Bacteria 1082
179 Ga0207711_10461272 3300025941 Bacteria 1183
180 Ga0207661_10025834 3300025944 Bacteria 4469
181 Ga0207661_10063063 3300025944 Bacteria 3001
182 Ga0207661_10077741 3300025944 Bacteria 2730
183 Ga0207661_10167357 3300025944 Bacteria 1911
184 Ga0207661_10248128 3300025944 Bacteria 1581
185 Ga0207667_10037086 3300025949 Bacteria 5214
186 Ga0207667_10078036 3300025949 Bacteria 3433
187 Ga0207667_10260951 3300025949 Bacteria 1772
188 Ga0207667_10435484 3300025949 Bacteria 1333
189 Ga0207712_10428943 3300025961 Bacteria 1117
190 Ga0207640_10084364 3300025981 Bacteria 2181
191 Ga0207640_10102809 3300025981 Bacteria 2007
192 Ga0207677_10012699 3300026023 Bacteria 4853
193 Ga0207678_10243931 3300026067 Bacteria 1539
194 Ga0207708_10036458 3300026075 Bacteria 3744
195 Ga0207702_10028039 3300026078 Bacteria 4679
196 Ga0207702_10195188 3300026078 Bacteria 1873
197 Ga0207648_10026983 3300026089 Bacteria 5100
198 Ga0207674_10008792 3300026116 Bacteria 11627
199 Ga0207674_10060324 3300026116 Bacteria 3836
200 Ga0207675_100089119 3300026118 Bacteria 2898
201 Ga0207683_10136256 3300026121 Bacteria 2210
202 Ga0207683_10698416 3300026121 Bacteria 940
203 Ga0207698_10073569 3300026142 Bacteria 2722
204 Ga0207698_10189844 3300026142 Bacteria 1829
205 Ga0207698_10517933 3300026142 Bacteria 1163
206 Ga0268266_10480358 3300028379 Bacteria 1184
207 Ga0265319_1015503 3300028563 Bacteria 2954
208 Ga0265322_10001265 3300028654 Bacteria 8532
209 Ga0265338_10015400 3300028800 Bacteria 8404
210 Ga0265338_10137256 3300028800 Bacteria 1921
211 Ga0265320_10088685 3300031240 Bacteria 1435
212 Ga0265339_10018728 3300031249 Bacteria 4077
213 Ga0265327_10010339 3300031251 Bacteria 6577
214 Ga0265327_10013725 3300031251 Bacteria 5358
215 Ga0265316_10261940 3300031344 Bacteria 1267
216 Ga0265316_10541297 3300031344 Bacteria 829
217 Ga0265313_10024153 3300031595 Bacteria 3254
218 Ga0307406_10240703 3300031901 Bacteria 1357
219 Ga0307412_10135275 3300031911 Bacteria 1797
220 Ga0307416_100055222 3300032002 Bacteria 3197
221 Ga0307415_100117580 3300032126 Bacteria 1986
222 Ga0373934_0038671 3300035086 Bacteria 1880
223 Ga0373936_0059139 3300035113 Bacteria 1561
224 Ga0373936_0105339 3300035113 Bacteria 1193
225 Ga0373945_0006091 3300035116 Bacteria 3881
226 Ga0373945_0035353 3300035116 Bacteria 1785
227 Ga0373943_0015618 3300035170 Bacteria 3452
228 Ga0373943_0019130 3300035170 Bacteria 3149
229 Ga0373946_0002218 3300035171 Bacteria 6848
230 Ga0373955_0022889 3300035172 Bacteria 3176
231 Ga0373935_0125004 3300035692 Bacteria 1722
232 Ga0373927_0027708 3300035695 Bacteria 3699
233 Ga0373933_0062011 3300035724 Bacteria 2257
234 Ga0373947_0006247 3300035725 Bacteria 6927
235 Ga0373947_0018447 3300035725 Bacteria 4015
236 Ga0373937_0052139 3300036401 Bacteria 3750
237 Ga0373937_0437269 3300036401 Bacteria 1242
238 Ga0373925_0011150 3300037068 Bacteria 6520
239 Ga0373925_0060908 3300037068 Bacteria 2834
240 Ga0373925_0176803 3300037068 Bacteria 1687
241 Ga0395899_0012890 3300037312 Bacteria 6400
242 Ga0395899_0021271 3300037312 Bacteria 4921
243 Ga0395899_0043877 3300037312 Bacteria 3333
244 Ga0395899_0053561 3300037312 Bacteria 2987
245 Ga0395899_0112630 3300037312 Bacteria 1955
246 Ga0395899_0209488 3300037312 Bacteria 1355
247 Ga0395900_0005641 3300037418 Bacteria 13092
248 Ga0395900_0027644 3300037418 Bacteria 5811
249 Ga0395900_0032949 3300037418 Bacteria 5331
250 Ga0395900_0033163 3300037418 Bacteria 5314
251 Ga0395900_0065560 3300037418 Bacteria 3731
252 Ga0395900_0078523 3300037418 Bacteria 3391
253 Ga0395900_0079523 3300037418 Bacteria 3369
254 Ga0395900_0080483 3300037418 Bacteria 3347
255 Ga0395900_0095584 3300037418 Bacteria 3053
256 Ga0395900_0103860 3300037418 Bacteria 2919
257 Ga0395900_0103933 3300037418 Bacteria 2918
258 Ga0395900_0118837 3300037418 Bacteria 2713
259 Ga0395900_0564896 3300037418 Bacteria 1081
260 Ga0395900_0811888 3300037418 Bacteria 863
261 Ga0395898_0008366 3300037466 Bacteria 10938
262 Ga0395898_0012333 3300037466 Bacteria 8839
263 Ga0395898_0014103 3300037466 Bacteria 8213
264 Ga0395898_0018929 3300037466 Bacteria 7015
265 Ga0395898_0021244 3300037466 Bacteria 6583
266 Ga0395898_0031338 3300037466 Bacteria 5314
267 Ga0395898_0039832 3300037466 Bacteria 4649
268 Ga0395898_0115839 3300037466 Bacteria 2568
269 Ga0395898_0187977 3300037466 Bacteria 1974
270 Ga0395898_0244213 3300037466 Bacteria 1712
271 Ga0395898_0374370 3300037466 Bacteria 1358
272 Ga0395905_0002820 3300037471 Bacteria 19050
273 Ga0395905_0021644 3300037471 Bacteria 6082
274 Ga0395905_0035585 3300037471 Bacteria 4676
275 Ga0395905_0119428 3300037471 Bacteria 2478
276 Ga0395905_0169590 3300037471 Bacteria 2050
277 Ga0395905_0254855 3300037471 Bacteria 1639
278 Ga0395905_0848859 3300037471 Bacteria 816
279 Ga0395901_0007137 3300038443 Bacteria 11279
280 Ga0395901_0010543 3300038443 Bacteria 9361
281 Ga0395901_0021008 3300038443 Bacteria 6687
282 Ga0395901_0025445 3300038443 Bacteria 6075
283 Ga0395901_0029269 3300038443 Bacteria 5669
284 Ga0395901_0037294 3300038443 Bacteria 5028
285 Ga0395901_0045463 3300038443 Bacteria 4556
286 Ga0395901_0056922 3300038443 Bacteria 4067
287 Ga0395901_0057607 3300038443 Bacteria 4041
288 Ga0395901_0064023 3300038443 Bacteria 3827
289 Ga0395901_0156371 3300038443 Bacteria 2395
290 Ga0395901_0365111 3300038443 Bacteria 1488
291 Ga0395901_0685513 3300038443 Bacteria 1024
292 Ga0436365_1893310 3300039437 Bacteria 4618
293 Ga0436363_0758376 3300039450 Bacteria 1964
294 Ga0436363_1227392 3300039450 Bacteria 1129
295 Ga0466965_0041555 3300044683 Bacteria 2266
296 Ga0466966_0033404 3300044684 Bacteria 3332
297 Ga0466966_0095656 3300044684 Bacteria 1840
298 Ga0466966_0211299 3300044684 Bacteria 1172
299 Ga0466961_0008817 3300044693 Bacteria 6432
300 Ga0466961_0040835 3300044693 Bacteria 2974
301 Ga0466961_0058243 3300044693 Bacteria 2458
302 Ga0466961_0109339 3300044693 Bacteria 1740
303 Ga0466961_0341512 3300044693 Bacteria 912
304 Ga0466963_0001493 3300044694 Bacteria 12641
305 Ga0466963_0006730 3300044694 Bacteria 6827
306 Ga0466963_0010940 3300044694 Bacteria 5513
307 Ga0466963_0014165 3300044694 Bacteria 4913
308 Ga0466963_0035726 3300044694 Bacteria 3238
309 Ga0466963_0064437 3300044694 Bacteria 2455
310 Ga0466963_0089469 3300044694 Bacteria 2094
311 Ga0466963_0172438 3300044694 Bacteria 1508
312 Ga0466963_0192253 3300044694 Bacteria 1426
313 Ga0466963_0251596 3300044694 Bacteria 1240
314 Ga0466964_0038250 3300044706 Bacteria 1929
315 Ga0466971_0035406 3300044719 Bacteria 2238
316 Ga0466968_0006069 3300044735 Bacteria 4537
317 Ga0466970_0083063 3300044765 Bacteria 1733
318 Ga0466957_0033559 3300044842 Bacteria 3079
319 Ga0466957_0125716 3300044842 Bacteria 1638
320 Ga0466959_0114643 3300045049 Bacteria 1920
321 Ga0466959_0224215 3300045049 Bacteria 1303
322 Ga0466959_0388756 3300045049 Bacteria 949
323 Ga0451576_0039365 3300045051 Bacteria 5004
324 Ga0451576_0176853 3300045051 Bacteria 2228
325 Ga0466958_0005466 3300045836 Bacteria 6844
326 Ga0466958_0014777 3300045836 Bacteria 4461
327 Ga0466958_0107662 3300045836 Bacteria 1739
328 Ga0466958_0326056 3300045836 Bacteria 987
329 Ga0466967_0000221 3300045976 Bacteria 24435
330 Ga0466967_0008547 3300045976 Bacteria 7517
331 Ga0466967_0010284 3300045976 Bacteria 7006
332 Ga0466967_0040836 3300045976 Bacteria 3996
333 Ga0466967_0045705 3300045976 Bacteria 3806
334 Ga0466967_0074387 3300045976 Bacteria 3051
335 Ga0466967_0091659 3300045976 Bacteria 2762
336 Ga0466967_0163332 3300045976 Bacteria 2092
337 Ga0466967_0170729 3300045976 Bacteria 2046
338 Ga0466967_0216457 3300045976 Bacteria 1818
339 Ga0466967_0224717 3300045976 Bacteria 1785
340 Ga0466967_0296934 3300045976 Bacteria 1553
341 Ga0466967_0581405 3300045976 Bacteria 1104
342 Ga0495592_0209140 3300046454 Bacteria 1311
343 Ga0495603_0021016 3300046455 Bacteria 3952
344 Ga0495629_0004153 3300046459 Bacteria 10868
345 Ga0495641_0000850 3300046461 Bacteria 26094
346 Ga0495641_0027481 3300046461 Bacteria 2767
347 Ga0495641_0078146 3300046461 Bacteria 1483
348 Ga0495641_0116822 3300046461 Bacteria 1190
349 Ga0495651_0013329 3300046462 Bacteria 6359
350 Ga0495651_0021532 3300046462 Bacteria 5011
351 Ga0495653_0044871 3300046463 Bacteria 3429
352 Ga0495653_0096292 3300046463 Bacteria 2152
353 Ga0495582_0000054 3300046473 Bacteria 57496
354 Ga0495582_0016503 3300046473 Bacteria 4045
355 Ga0495605_0158192 3300046474 Bacteria 1007
356 Ga0495639_0000608 3300046475 Bacteria 16665
357 Ga0495662_0007155 3300046476 Bacteria 5529
358 Ga0495662_0159396 3300046476 Bacteria 1111
359 Ga0495664_0055893 3300046477 Bacteria 2348
360 Ga0495664_0395983 3300046477 Bacteria 829
361 Ga0495596_0081905 3300046500 Bacteria 1253
362 Ga0495608_0029811 3300046511 Bacteria 3698
363 Ga0495618_0312207 3300046514 Bacteria 975
364 Ga0495628_0102161 3300046516 Bacteria 2212
365 Ga0495630_0006532 3300046517 Bacteria 8304
366 Ga0495630_0034154 3300046517 Bacteria 3796
367 Ga0495666_0063958 3300046526 Bacteria 1756
368 Ga0495642_0019097 3300046528 Bacteria 2685
369 Ga0495652_0206968 3300046529 Bacteria 1485
370 Ga0495665_0003084 3300046531 Bacteria 9019
371 Ga0495640_0163022 3300046533 Bacteria 1427
372 Ga0495640_0262834 3300046533 Bacteria 1078
373 Ga0495586_0109681 3300046535 Bacteria 1535
374 Ga0495587_0082340 3300046536 Bacteria 1865
375 Ga0495645_0073966 3300046543 Bacteria 2454
376 Ga0495667_0007496 3300046559 Bacteria 7402
377 Ga0495667_0051247 3300046559 Bacteria 2723
378 Ga0495667_0128201 3300046559 Bacteria 1637
379 Ga0495667_0316610 3300046559 Bacteria 987
380 Ga0495634_0058764 3300046642 Bacteria 2562
381 Ga0495635_0015770 3300046663 Bacteria 5278
382 Ga0495635_0037621 3300046663 Bacteria 3350
383 Ga0495659_0116697 3300046664 Bacteria 1047
384 Ga0495588_0014616 3300046674 Bacteria 3761
385 Ga0495588_0140131 3300046674 Bacteria 1277
386 Ga0495657_0098796 3300046675 Bacteria 1862
387 Ga0495657_0107014 3300046675 Bacteria 1775
388 Ga0495657_0116274 3300046675 Bacteria 1689
389 Ga0495623_0020005 3300046679 Bacteria 4327
390 Ga0495646_0128537 3300046680 Bacteria 1428
391 Ga0495646_0134610 3300046680 Bacteria 1388
392 Ga0495647_0003412 3300046681 Bacteria 5088
393 Ga0495647_0289634 3300046681 Bacteria 736
394 Ga0495658_0001151 3300046683 Bacteria 13968
395 Ga0495658_0079431 3300046683 Bacteria 1922
396 Ga0495658_0084845 3300046683 Bacteria 1866
397 Ga0495613_0015631 3300046689 Bacteria 5648
398 Ga0495670_0273159 3300046691 Bacteria 903
399 Ga0495581_0006194 3300047315 Bacteria 6938
400 Ga0495581_0015017 3300047315 Bacteria 4494
401 Ga0495604_0031809 3300047317 Bacteria 4184
402 Ga0495604_0332787 3300047317 Bacteria 1013
403 Ga0495674_0090224 3300047319 Bacteria 2619
404 Ga0495674_0109408 3300047319 Bacteria 2344
405 Ga0495674_0365409 3300047319 Bacteria 1169
406 Ga0495676_0001978 3300047321 Bacteria 18008
407 Ga0495676_0018960 3300047321 Bacteria 6060
408 Ga0495676_0038499 3300047321 Bacteria 3971
409 Ga0495680_0007171 3300047322 Bacteria 10267
410 Ga0495680_0007594 3300047322 Bacteria 9910
411 Ga0495680_0053126 3300047322 Bacteria 3155
412 Ga0495677_0087345 3300047445 Bacteria 1173
413 Ga0495684_0147025 3300047471 Bacteria 1764
414 Ga0495684_0204845 3300047471 Bacteria 1453
415 Ga0495593_0010033 3300047673 Bacteria 5488
416 Ga0495602_0079118 3300048088 Bacteria 2774
417 Ga0495614_0005102 3300048089 Bacteria 5926
418 Ga0495614_0095087 3300048089 Bacteria 1299
419 Ga0495626_0069528 3300048091 Bacteria 1586
420 Ga0496100_0024048 3300048903 Bacteria 3710
421 Ga0496100_0063629 3300048903 Bacteria 2438
422 Ga0496100_0079903 3300048903 Bacteria 2205
423 Ga0496101_0014724 3300048904 Bacteria 5262
424 Ga0496101_0027467 3300048904 Bacteria 3965
425 Ga0496102_0031120 3300048905 Bacteria 4784
426 Ga0496102_0032895 3300048905 Bacteria 4660
427 Ga0496102_0064977 3300048905 Bacteria 3343
428 Ga0496102_0235930 3300048905 Bacteria 1725
429 Ga0496103_0086379 3300048906 Bacteria 1977
430 Ga0496104_0005537 3300048907 Bacteria 11063
431 Ga0496104_0021669 3300048907 Bacteria 5902
432 Ga0496104_0108150 3300048907 Bacteria 2665
433 Ga0496104_0112553 3300048907 Bacteria 2610
434 Ga0496105_0000489 3300048908 Bacteria 26072
435 Ga0496105_0431542 3300048908 Bacteria 1042
436 Ga0496106_0051609 3300048909 Bacteria 3101
437 Ga0496107_0002143 3300048910 Bacteria 12664
438 Ga0496107_0003268 3300048910 Bacteria 10805
439 Ga0496107_0015907 3300048910 Bacteria 5277
440 Ga0496107_0052381 3300048910 Bacteria 2944
441 Ga0496107_0131912 3300048910 Bacteria 1845
442 Ga0496108_0007200 3300048911 Bacteria 9019
443 Ga0496108_0083912 3300048911 Bacteria 2703
444 Ga0496109_0005370 3300048912 Bacteria 10712
445 Ga0496109_0143019 3300048912 Bacteria 2237
446 Ga0496109_0636866 3300048912 Bacteria 1003
447 Ga0496110_0027675 3300048913 Bacteria 4861
448 Ga0496111_0108489 3300048914 Bacteria 2044
449 Ga0496112_0010589 3300048915 Bacteria 8377
450 Ga0496112_0076657 3300048915 Bacteria 3306
451 Ga0496112_0122522 3300048915 Bacteria 2571
452 Ga0496112_0231125 3300048915 Bacteria 1804
453 Ga0496113_0207459 3300048916 Bacteria 1559
454 Ga0496113_0563177 3300048916 Bacteria 914
455 Ga0496114_0004524 3300048917 Bacteria 10794
456 Ga0496114_0019844 3300048917 Bacteria 5450
457 Ga0496114_0274914 3300048917 Bacteria 1484
458 Ga0496114_0396312 3300048917 Bacteria 1223
459 Ga0496115_0014963 3300048918 Bacteria 5881
460 Ga0496115_0035761 3300048918 Bacteria 3931
461 Ga0496115_0048676 3300048918 Bacteria 3391
462 Ga0496115_0350973 3300048918 Bacteria 1203
463 Ga0501039_0258808 3300049575 Bacteria 1368
464 Ga0501047_0107372 3300049581 Bacteria 2673
465 Ga0501047_0146063 3300049581 Bacteria 2242
466 Ga0501067_0003911 3300049583 Bacteria 8228
467 Ga0501067_0049522 3300049583 Bacteria 2328
468 Ga0501068_0159454 3300049584 Bacteria 1422
469 Ga0501069_0004807 3300049585 Bacteria 6993
470 Ga0501069_0068618 3300049585 Bacteria 1984
471 Ga0501070_0156800 3300049586 Bacteria 1877
472 Ga0501070_0174358 3300049586 Bacteria 1771
473 Ga0501070_0232929 3300049586 Bacteria 1509
474 Ga0501074_0052612 3300049590 Bacteria 2939
475 Ga0501079_0072114 3300049741 Bacteria 2669
476 Ga0501080_0074210 3300049742 Bacteria 3164
477 Ga0501080_0152035 3300049742 Bacteria 2139
478 Ga0501080_0282055 3300049742 Bacteria 1510
479 Ga0501080_0295171 3300049742 Bacteria 1471
480 Ga0501044_0221202 3300049823 Bacteria 1844
481 nmdc:mga05p37_373876_c1 3300050507 Bacteria 1672
482 nmdc:mga05p37_593651_c1 3300050507 Bacteria 1251
483 nmdc:mga09592_466899_c1 3300050508 Bacteria 1088
484 Ga0495601_0010756 3300053077 Bacteria 5460
485 Ga0495601_0065784 3300053077 Bacteria 2307
486 Ga0495612_0060881 3300053078 Bacteria 1563
487 Ga0495655_0004731 3300053083 Bacteria 2353
488 Ga0495595_0004330 3300053084 Bacteria 5713
489 Ga0495595_0017603 3300053084 Bacteria 3076
490 Ga0495619_0096171 3300053085 Bacteria 2010
491 Ga0495619_0138535 3300053085 Bacteria 1674
492 Ga0495619_0210147 3300053085 Bacteria 1347
493 Ga0495619_0331054 3300053085 Bacteria 1054
494 Ga0501084_0239138 3300054114 Bacteria 1533
495 Ga0501082_0273106 3300060353 Bacteria 1471
496 Ga0466962_0006927 3300061719 Bacteria 5434
497 Ga0530510_0305012 3300061734 Bacteria 1192
498 Ga0105248_10655075
499 Ga0070658_10033874
500 Ga0070658_10051967
501 Ga0070683_100008896
502 Ga0070683_100024419
503 Ga0070683_100044350
504 Ga0070690_100023281
505 Ga0070680_100002720
506 Ga0070680_100036450
507 Ga0070680_100055028
508 Ga0070680_100086488
509 Ga0070680_100152598
510 Ga0070682_100248058
511 Ga0070682_100492846
512 Ga0068868_100247654
513 Ga0070660_100001150
514 Ga0070660_100007158
515 Ga0070660_100042321
516 Ga0070660_100079335
517 Ga0070689_100369226
518 Ga0070661_100030430
519 Ga0070661_100081223
520 Ga0070661_100145178
521 Ga0070661_100536710
522 Ga0070674_100593467
523 Ga0070659_100045496
524 Ga0070659_100272059
525 Ga0070659_100315274
526 Ga0070659_100359695
527 Ga0070703_10027824
528 Ga0070713_100228336
529 Ga0070713_100430100
530 Ga0070713_100806945
531 Ga0070705_100139688
532 Ga0070700_100229830
533 Ga0070662_100136114
534 Ga0070681_10030692
535 Ga0070681_10083756
536 Ga0070681_10174157
537 Ga0070681_10174185
538 Ga0070681_10174302
539 Ga0070681_10311848
540 Ga0070707_100470638
541 Ga0070679_100029417
542 Ga0070679_100060051
543 Ga0070679_100069277
544 Ga0070684_100014181
545 Ga0070684_100024442
546 Ga0070684_100026188
547 Ga0070684_100075231
548 Ga0070684_100185339
549 Ga0070684_100188647
550 Ga0070684_100217040
551 Ga0070684_100421462
552 Ga0070684_100877898
553 Ga0070697_100759928
554 Ga0068853_100140526
555 Ga0068853_100154856
556 Ga0070665_100015735
557 Ga0070704_100108306
558 Ga0068855_100017430
559 Ga0068855_100025215
560 Ga0068855_100071129
561 Ga0068855_100188935
562 Ga0068855_100303613
563 Ga0068857_100081947
564 Ga0068857_100230747
565 Ga0068854_100135772
566 Ga0070702_100361662
567 Ga0068852_100166685
568 Ga0068852_100301425
569 Ga0068852_100391632
570 Ga0068861_100907850
571 Ga0081455_10067239
572 Ga0081540_1019583
573 Ga0081539_10014665
574 Ga0081539_10036490
575 Ga0070717_10192160
576 Ga0070717_10242787
577 Ga0070712_100031849
578 Ga0070712_100773032
579 Ga0075429_100462384
580 Ga0068865_100127509
581 Ga0075435_100114520
582 Ga0105240_10050881
583 Ga0105240_10094239
584 Ga0105240_10226833
585 Ga0111539_10211172
586 Ga0105245_10040229
587 Ga0105245_10152854
588 Ga0105245_10438003
589 Ga0114129_11583967
590 Ga0105243_10038812
591 Ga0105243_10047991
592 Ga0105243_10101085
593 Ga0105241_10064854
594 Ga0105242_10020262
595 Ga0105242_10240866
596 Ga0105237_10070034
597 Ga0105238_10013829
598 Ga0105238_10080991
599 Ga0105238_10222168
600 Ga0105238_10429053
601 Ga0105239_10282772
602 Ga0105239_10606112
603 Ga0157371_10289185
604 Ga0157370_10031447
605 Ga0157370_10033273
606 Ga0157370_10047125
607 Ga0157369_10001698
608 Ga0157369_10012915
609 Ga0157369_10015699
610 Ga0157369_10026871
611 Ga0157369_10587904
612 Ga0157374_10262859
613 Ga0157378_10475240
614 Ga0157372_10054897
615 Ga0157372_10081059
616 Ga0157375_10059229
617 Ga0163163_10843101
618 Ga0206356_10240149
619 Ga0206356_10469898
620 Ga0206356_11661934
621 Ga0206354_11302686
622 Ga0206354_11502204
623 Ga0206353_10147248
624 Ga0213874_10032321
625 Ga0207656_10048177
626 Ga0207653_10015839
627 Ga0207692_10388416
628 Ga0207642_10117074
629 Ga0207685_10024007
630 Ga0207645_10114745
631 Ga0207705_10022025
632 Ga0207705_10077093
633 Ga0207705_10108170
634 Ga0207707_10009579
635 Ga0207707_10061475
636 Ga0207707_10065901
637 Ga0207707_10076503
638 Ga0207707_10118698
639 Ga0207695_10120127
640 Ga0207695_10232093
641 Ga0207671_10082264
642 Ga0207693_10060031
643 Ga0207693_10107738
644 Ga0207693_10592638
645 Ga0207663_10706163
646 Ga0207660_10027263
647 Ga0207660_10116911
648 Ga0207662_10093022
649 Ga0207657_10000073
650 Ga0207657_10007410
651 Ga0207657_10010451
652 Ga0207657_10011084
653 Ga0207657_10024156
654 Ga0207657_10139817
655 Ga0207657_10197902
656 Ga0207649_10007318
657 Ga0207649_10048607
658 Ga0207652_10066272
659 Ga0207652_10082082
660 Ga0207652_10095794
661 Ga0207652_10354124
662 Ga0207646_10152945
663 Ga0207646_10838388
664 Ga0207694_10032386
665 Ga0207694_10387539
666 Ga0207687_10034808
667 Ga0207644_10081918
668 Ga0207644_10386594
669 Ga0207690_10017168
670 Ga0207690_10244638
671 Ga0207706_10348066
672 Ga0207686_10018205
673 Ga0207686_10341772
674 Ga0207686_10368178
675 Ga0207669_10394701
676 Ga0207711_10461272
677 Ga0207661_10025834
678 Ga0207661_10063063
679 Ga0207661_10077741
680 Ga0207661_10167357
681 Ga0207661_10248128
682 Ga0207667_10037086
683 Ga0207667_10078036
684 Ga0207667_10260951
685 Ga0207667_10435484
686 Ga0207712_10428943
687 Ga0207640_10084364
688 Ga0207640_10102809
689 Ga0207677_10012699
690 Ga0207678_10243931
691 Ga0207708_10036458
692 Ga0207702_10028039
693 Ga0207702_10195188
694 Ga0207648_10026983
695 Ga0207674_10008792
696 Ga0207674_10060324
697 Ga0207675_100089119
698 Ga0207683_10136256
699 Ga0207683_10698416
700 Ga0207698_10073569
701 Ga0207698_10189844
702 Ga0207698_10517933
703 Ga0268266_10480358
704 Ga0265319_1015503
705 Ga0265322_10001265
706 Ga0265338_10015400
707 Ga0265338_10137256
708 Ga0265320_10088685
709 Ga0265339_10018728
710 Ga0265327_10010339
711 Ga0265327_10013725
712 Ga0265316_10261940
713 Ga0265316_10541297
714 Ga0265313_10024153
715 Ga0307406_10240703
716 Ga0307412_10135275
717 Ga0307416_100055222
718 Ga0307415_100117580
719 Ga0373934_0038671
720 Ga0373936_0059139
721 Ga0373936_0105339
722 Ga0373945_0006091
723 Ga0373945_0035353
724 Ga0373943_0015618
725 Ga0373943_0019130
726 Ga0373946_0002218
727 Ga0373955_0022889
728 Ga0373935_0125004
729 Ga0373927_0027708
730 Ga0373933_0062011
731 Ga0373947_0006247
732 Ga0373947_0018447
733 Ga0373937_0052139
734 Ga0373937_0437269
735 Ga0373925_0011150
736 Ga0373925_0060908
737 Ga0373925_0176803
738 Ga0395899_0012890
739 Ga0395899_0021271
740 Ga0395899_0043877
741 Ga0395899_0053561
742 Ga0395899_0112630
743 Ga0395899_0209488
744 Ga0395900_0005641
745 Ga0395900_0027644
746 Ga0395900_0032949
747 Ga0395900_0033163
748 Ga0395900_0065560
749 Ga0395900_0078523
750 Ga0395900_0079523
751 Ga0395900_0080483
752 Ga0395900_0095584
753 Ga0395900_0103860
754 Ga0395900_0103933
755 Ga0395900_0118837
756 Ga0395900_0564896
757 Ga0395900_0811888
758 Ga0395898_0008366
759 Ga0395898_0012333
760 Ga0395898_0014103
761 Ga0395898_0018929
762 Ga0395898_0021244
763 Ga0395898_0031338
764 Ga0395898_0039832
765 Ga0395898_0115839
766 Ga0395898_0187977
767 Ga0395898_0244213
768 Ga0395898_0374370
769 Ga0395905_0002820
770 Ga0395905_0021644
771 Ga0395905_0035585
772 Ga0395905_0119428
773 Ga0395905_0169590
774 Ga0395905_0254855
775 Ga0395905_0848859
776 Ga0395901_0007137
777 Ga0395901_0010543
778 Ga0395901_0021008
779 Ga0395901_0025445
780 Ga0395901_0029269
781 Ga0395901_0037294
782 Ga0395901_0045463
783 Ga0395901_0056922
784 Ga0395901_0057607
785 Ga0395901_0064023
786 Ga0395901_0156371
787 Ga0395901_0365111
788 Ga0395901_0685513
789 Ga0436365_1893310
790 Ga0436363_0758376
791 Ga0436363_1227392
792 Ga0466965_0041555
793 Ga0466966_0033404
794 Ga0466966_0095656
795 Ga0466966_0211299
796 Ga0466961_0008817
797 Ga0466961_0040835
798 Ga0466961_0058243
799 Ga0466961_0109339
800 Ga0466961_0341512
801 Ga0466963_0001493
802 Ga0466963_0006730
803 Ga0466963_0010940
804 Ga0466963_0014165
805 Ga0466963_0035726
806 Ga0466963_0064437
807 Ga0466963_0089469
808 Ga0466963_0172438
809 Ga0466963_0192253
810 Ga0466963_0251596
811 Ga0466964_0038250
812 Ga0466971_0035406
813 Ga0466968_0006069
814 Ga0466970_0083063
815 Ga0466957_0033559
816 Ga0466957_0125716
817 Ga0466959_0114643
818 Ga0466959_0224215
819 Ga0466959_0388756
820 Ga0451576_0039365
821 Ga0451576_0176853
822 Ga0466958_0005466
823 Ga0466958_0014777
824 Ga0466958_0107662
825 Ga0466958_0326056
826 Ga0466967_0000221
827 Ga0466967_0008547
828 Ga0466967_0010284
829 Ga0466967_0040836
830 Ga0466967_0045705
831 Ga0466967_0074387
832 Ga0466967_0091659
833 Ga0466967_0163332
834 Ga0466967_0170729
835 Ga0466967_0216457
836 Ga0466967_0224717
837 Ga0466967_0296934
838 Ga0466967_0581405
839 Ga0495592_0209140
840 Ga0495603_0021016
841 Ga0495629_0004153
842 Ga0495641_0000850
843 Ga0495641_0027481
844 Ga0495641_0078146
845 Ga0495641_0116822
846 Ga0495651_0013329
847 Ga0495651_0021532
848 Ga0495653_0044871
849 Ga0495653_0096292
850 Ga0495582_0000054
851 Ga0495582_0016503
852 Ga0495605_0158192
853 Ga0495639_0000608
854 Ga0495662_0007155
855 Ga0495662_0159396
856 Ga0495664_0055893
857 Ga0495664_0395983
858 Ga0495596_0081905
859 Ga0495608_0029811
860 Ga0495618_0312207
861 Ga0495628_0102161
862 Ga0495630_0006532
863 Ga0495630_0034154
864 Ga0495666_0063958
865 Ga0495642_0019097
866 Ga0495652_0206968
867 Ga0495665_0003084
868 Ga0495640_0163022
869 Ga0495640_0262834
870 Ga0495586_0109681
871 Ga0495587_0082340
872 Ga0495645_0073966
873 Ga0495667_0007496
874 Ga0495667_0051247
875 Ga0495667_0128201
876 Ga0495667_0316610
877 Ga0495634_0058764
878 Ga0495635_0015770
879 Ga0495635_0037621
880 Ga0495659_0116697
881 Ga0495588_0014616
882 Ga0495588_0140131
883 Ga0495657_0098796
884 Ga0495657_0107014
885 Ga0495657_0116274
886 Ga0495623_0020005
887 Ga0495646_0128537
888 Ga0495646_0134610
889 Ga0495647_0003412
890 Ga0495647_0289634
891 Ga0495658_0001151
892 Ga0495658_0079431
893 Ga0495658_0084845
894 Ga0495613_0015631
895 Ga0495670_0273159
896 Ga0495581_0006194
897 Ga0495581_0015017
898 Ga0495604_0031809
899 Ga0495604_0332787
900 Ga0495674_0090224
901 Ga0495674_0109408
902 Ga0495674_0365409
903 Ga0495676_0001978
904 Ga0495676_0018960
905 Ga0495676_0038499
906 Ga0495680_0007171
907 Ga0495680_0007594
908 Ga0495680_0053126
909 Ga0495677_0087345
910 Ga0495684_0147025
911 Ga0495684_0204845
912 Ga0495593_0010033
913 Ga0495602_0079118
914 Ga0495614_0005102
915 Ga0495614_0095087
916 Ga0495626_0069528
917 Ga0496100_0024048
918 Ga0496100_0063629
919 Ga0496100_0079903
920 Ga0496101_0014724
921 Ga0496101_0027467
922 Ga0496102_0031120
923 Ga0496102_0032895
924 Ga0496102_0064977
925 Ga0496102_0235930
926 Ga0496103_0086379
927 Ga0496104_0005537
928 Ga0496104_0021669
929 Ga0496104_0108150
930 Ga0496104_0112553
931 Ga0496105_0000489
932 Ga0496105_0431542
933 Ga0496106_0051609
934 Ga0496107_0002143
935 Ga0496107_0003268
936 Ga0496107_0015907
937 Ga0496107_0052381
938 Ga0496107_0131912
939 Ga0496108_0007200
940 Ga0496108_0083912
941 Ga0496109_0005370
942 Ga0496109_0143019
943 Ga0496109_0636866
944 Ga0496110_0027675
945 Ga0496111_0108489
946 Ga0496112_0010589
947 Ga0496112_0076657
948 Ga0496112_0122522
949 Ga0496112_0231125
950 Ga0496113_0207459
951 Ga0496113_0563177
952 Ga0496114_0004524
953 Ga0496114_0019844
954 Ga0496114_0274914
955 Ga0496114_0396312
956 Ga0496115_0014963
957 Ga0496115_0035761
958 Ga0496115_0048676
959 Ga0496115_0350973
960 Ga0501039_0258808
961 Ga0501047_0107372
962 Ga0501047_0146063
963 Ga0501067_0003911
964 Ga0501067_0049522
965 Ga0501068_0159454
966 Ga0501069_0004807
967 Ga0501069_0068618
968 Ga0501070_0156800
969 Ga0501070_0174358
970 Ga0501070_0232929
971 Ga0501074_0052612
972 Ga0501079_0072114
973 Ga0501080_0074210
974 Ga0501080_0152035
975 Ga0501080_0282055
976 Ga0501080_0295171
977 Ga0501044_0221202
978 nmdc:mga05p37_373876_c1
979 nmdc:mga05p37_593651_c1
980 nmdc:mga09592_466899_c1
981 Ga0495601_0010756
982 Ga0495601_0065784
983 Ga0495612_0060881
984 Ga0495655_0004731
985 Ga0495595_0004330
986 Ga0495595_0017603
987 Ga0495619_0096171
988 Ga0495619_0138535
989 Ga0495619_0210147
990 Ga0495619_0331054
991 Ga0501084_0239138
992 Ga0501082_0273106
993 Ga0466962_0006927
994 Ga0530510_0305012

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03641

Lysine_decarbox

Possible lysine decarboxylase

102

232

0.97

PF18306

LDcluster4

SLOG cluster4 family

59

196

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5wq3-assembly1.cif.gz_C-3 crystal structure of type-ii log from corynebacterium glutamicum 0.9342 17 200
5zi9-assembly1.cif.gz_A crystal structure of type-ii log from streptomyces coelicolor a3 0.9272 17 197
5wq3-assembly1.cif.gz_B-2 crystal structure of type-ii log from corynebacterium glutamicum 0.9272 19 202
1wek-assembly1.cif.gz_B crystal structure of the conserved hypothetical protein tt1465 from thermus thermophilus hb8 0.9197 14 197
1wek-assembly1.cif.gz_E crystal structure of the conserved hypothetical protein tt1465 from thermus thermophilus hb8 0.8921 11 200
ID Description Score Start End Superfamily
5wq3B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9272 19 202 3.40.50.450
1wekF01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8806 19 197 3.40.50.450
3sbxB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8642 39 196 3.40.50.450
af_Q9XH06_2_128_3.40.50.450 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8581 91 192 3.40.50.450
5wq3B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8512 19 202 3.40.50.450
ID Description Score Start End GO Terms
AF-A0A2V7XLY2-F1-model_v4 TIGR00730 family Rossman fold protein 0.9691 118 210 GO:0005829
AF-A0A538HAI6-F1-model_v4 TIGR00730 family Rossman fold protein 0.9518 4 206 GO:0005829
GO:0009691
GO:0016787
AF-A0A847KLB2-F1-model_v4 Cytokinin riboside 5'-monophosphate phosphoribohydrolase (EC 3.2.2.n1) 0.9487 55 210 GO:0005829
GO:0009691
GO:0016787
AF-A0A7Y6CF48-F1-model_v4 Cytokinin riboside 5'-monophosphate phosphoribohydrolase (EC 3.2.2.n1) 0.9465 1 206 GO:0005829
GO:0009691
GO:0016787
AF-A0A542FBL7-F1-model_v4 deleted 0.9457 4 210

Map