F454991

General Info

Members Datasets Scaffolds Average Seq Length
497 233 994 73

Family's Representative Sequence

Representative Sequence 3300005328|Ga0070676_10002319|Ga0070676_100023194
Length 82
Sequence VPGPFGRDDMNAMKLLGIVLLVGGILGLMYGGFTYTKETHEAKIGPIVLSVKDKETINVPIWAGVGAIVIGGLLLVSGIKRG

Samples

Sample ID Description Type Environment
1 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
80 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
152 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
153 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
154 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
155 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
156 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
157 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
158 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
159 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
160 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
161 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
162 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
163 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
164 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
165 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
166 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
167 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
168 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
169 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
170 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
171 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
172 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
173 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
174 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
175 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
177 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
178 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
179 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
180 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
181 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
182 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
183 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
184 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
185 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
186 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
187 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
188 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
189 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
190 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
191 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
192 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
193 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
194 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
195 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
196 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
197 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
198 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
199 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
200 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
201 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
202 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
203 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
204 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
205 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
206 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
207 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
208 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
209 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
210 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
211 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
212 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
213 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
214 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
215 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
216 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
217 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
218 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
224 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
225 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
226 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
227 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
228 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
229 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
230 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
231 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
232 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
233 2643221654 Rhizobacter sp. Root404 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.8
Metatranscriptomes 0
Isolates 0.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.01
Nodule 0
Rhizoplane 3.22
Rhizosphere 93.16
Stem 0
Stem Tuber 0
Unclassified 17.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10002319 3300005328 Bacteria 9733
2 MBSR1b_contig_1622354 2162886012 Bacteria 1123
3 rootL2_10017173 3300003322 Bacteria 2716
4 rootH1_10189800 3300003323 Bacteria 2110
5 Ga0065712_10207408 3300005290 Unclassified 1085
6 Ga0065715_10105005 3300005293 Bacteria 2860
7 Ga0065707_10633107 3300005295 Bacteria 672
8 Ga0070683_101911272 3300005329 Unclassified 570
9 Ga0070683_101945282 3300005329 Bacteria 565
10 Ga0070690_100084415 3300005330 Bacteria 2082
11 Ga0070670_100016569 3300005331 Bacteria 6326
12 Ga0070670_100056263 3300005331 Bacteria 3375
13 Ga0070670_100142537 3300005331 Bacteria 2072
14 Ga0070677_10069559 3300005333 Bacteria 1477
15 Ga0070677_10491375 3300005333 Bacteria 664
16 Ga0068869_100005395 3300005334 Bacteria 8035
17 Ga0068869_102107884 3300005334 Bacteria 507
18 Ga0070666_10000321 3300005335 Bacteria 30616
19 Ga0070666_10001808 3300005335 Bacteria 13020
20 Ga0070666_10004041 3300005335 Bacteria 8902
21 Ga0070666_10025630 3300005335 Bacteria 3846
22 Ga0070680_100218088 3300005336 Bacteria 1610
23 Ga0070682_100803056 3300005337 Unclassified 765
24 Ga0068868_100010341 3300005338 Bacteria 6748
25 Ga0070660_101480242 3300005339 Bacteria 577
26 Ga0070689_100048857 3300005340 Bacteria 3264
27 Ga0070661_100096771 3300005344 Bacteria 2191
28 Ga0070668_100011763 3300005347 Bacteria 6516
29 Ga0070668_100106230 3300005347 Bacteria 2230
30 Ga0070668_100133425 3300005347 Bacteria 1995
31 Ga0070668_100173651 3300005347 Bacteria 1756
32 Ga0070669_100004910 3300005353 Bacteria 9655
33 Ga0070669_100103084 3300005353 Bacteria 2155
34 Ga0070669_100290785 3300005353 Bacteria 1312
35 Ga0070675_100021458 3300005354 Bacteria 5161
36 Ga0070675_100088318 3300005354 Bacteria 2594
37 Ga0070675_101041781 3300005354 Bacteria 752
38 Ga0070675_101483048 3300005354 Bacteria 626
39 Ga0070671_100069914 3300005355 Bacteria 2928
40 Ga0070671_100159610 3300005355 Bacteria 1906
41 Ga0070671_101871341 3300005355 Unclassified 533
42 Ga0070674_100095388 3300005356 Bacteria 2156
43 Ga0070674_100237640 3300005356 Bacteria 1425
44 Ga0070674_100710106 3300005356 Bacteria 860
45 Ga0070674_101199396 3300005356 Bacteria 674
46 Ga0070674_101420332 3300005356 Bacteria 622
47 Ga0070673_100024710 3300005364 Bacteria 4410
48 Ga0070673_100027441 3300005364 Bacteria 4222
49 Ga0070659_101644308 3300005366 Unclassified 574
50 Ga0070667_100015313 3300005367 Bacteria 6338
51 Ga0070667_100025422 3300005367 Bacteria 4923
52 Ga0070667_100271827 3300005367 Bacteria 1520
53 Ga0070667_100615049 3300005367 Bacteria 1001
54 Ga0070667_101414106 3300005367 Bacteria 653
55 Ga0070667_101935397 3300005367 Bacteria 555
56 Ga0070711_100220123 3300005439 Bacteria 1475
57 Ga0070705_101935736 3300005440 Unclassified 502
58 Ga0070663_100009825 3300005455 Bacteria 5943
59 Ga0070678_100002020 3300005456 Bacteria 10975
60 Ga0070678_100017442 3300005456 Bacteria 4623
61 Ga0070678_100023743 3300005456 Bacteria 4092
62 Ga0070678_100217449 3300005456 Bacteria 1586
63 Ga0070678_101592827 3300005456 Bacteria 613
64 Ga0070662_100010382 3300005457 Bacteria 6107
65 Ga0070662_100295732 3300005457 Bacteria 1314
66 Ga0070662_101403198 3300005457 Bacteria 602
67 Ga0070662_101418912 3300005457 Bacteria 598
68 Ga0070662_101513456 3300005457 Bacteria 579
69 Ga0068867_100008082 3300005459 Bacteria 7433
70 Ga0068867_100098388 3300005459 Bacteria 2231
71 Ga0068867_101402227 3300005459 Bacteria 648
72 Ga0070685_10055677 3300005466 Bacteria 2298
73 Ga0070685_10520196 3300005466 Bacteria 845
74 Ga0070685_10753889 3300005466 Unclassified 714
75 Ga0070706_101076922 3300005467 Bacteria 740
76 Ga0070679_100116288 3300005530 Bacteria 2659
77 Ga0070684_100868413 3300005535 Bacteria 845
78 Ga0070697_100231337 3300005536 Bacteria 1577
79 Ga0070697_101040696 3300005536 Unclassified 728
80 Ga0068853_100105438 3300005539 Bacteria 2497
81 Ga0068853_100134630 3300005539 Bacteria 2214
82 Ga0068853_100174395 3300005539 Bacteria 1947
83 Ga0068853_100285547 3300005539 Bacteria 1522
84 Ga0068853_100622817 3300005539 Unclassified 1026
85 Ga0070672_100008716 3300005543 Bacteria 6960
86 Ga0070686_100213491 3300005544 Bacteria 1390
87 Ga0070665_100000414 3300005548 Bacteria 62478
88 Ga0070665_100007240 3300005548 Bacteria 11274
89 Ga0070665_100228721 3300005548 Bacteria 1860
90 Ga0070704_101023021 3300005549 Bacteria 748
91 Ga0068855_101323920 3300005563 Bacteria 745
92 Ga0068855_101377816 3300005563 Unclassified 728
93 Ga0068855_102537984 3300005563 Unclassified 509
94 Ga0068854_100088187 3300005578 Unclassified 2303
95 Ga0068856_100183736 3300005614 Bacteria 2104
96 Ga0068856_100669397 3300005614 Unclassified 1058
97 Ga0068856_101164933 3300005614 Bacteria 787
98 Ga0070702_101135469 3300005615 Bacteria 626
99 Ga0068852_100042226 3300005616 Bacteria 3859
100 Ga0068852_100141726 3300005616 Bacteria 2225
101 Ga0068859_100082448 3300005617 Bacteria 3259
102 Ga0068859_100683411 3300005617 Bacteria 1118
103 Ga0068859_101404449 3300005617 Unclassified 770
104 Ga0068859_101490125 3300005617 Bacteria 747
105 Ga0068864_100189260 3300005618 Bacteria 1886
106 Ga0068864_100318345 3300005618 Bacteria 1460
107 Ga0068864_100675061 3300005618 Bacteria 1007
108 Ga0068864_101387843 3300005618 Bacteria 704
109 Ga0068866_10120028 3300005718 Bacteria 1480
110 Ga0068866_11050562 3300005718 Bacteria 581
111 Ga0068861_100077426 3300005719 Bacteria 2594
112 Ga0068861_100840256 3300005719 Bacteria 865
113 Ga0068861_101541286 3300005719 Bacteria 653
114 Ga0068851_10000410 3300005834 Bacteria 19327
115 Ga0068851_10419861 3300005834 Unclassified 790
116 Ga0068851_10996762 3300005834 Bacteria 528
117 Ga0068863_100036072 3300005841 Bacteria 4708
118 Ga0068863_100148499 3300005841 Bacteria 2242
119 Ga0068863_100242576 3300005841 Bacteria 1739
120 Ga0068863_100470904 3300005841 Bacteria 1234
121 Ga0068863_101639420 3300005841 Bacteria 652
122 Ga0068858_100000101 3300005842 Bacteria 89093
123 Ga0068858_100015488 3300005842 Bacteria 7170
124 Ga0068858_100371361 3300005842 Bacteria 1372
125 Ga0068860_100052062 3300005843 Bacteria 3894
126 Ga0068860_100153383 3300005843 Bacteria 2219
127 Ga0068860_102540338 3300005843 Bacteria 532
128 Ga0068862_100056239 3300005844 Bacteria 3371
129 Ga0068862_100078440 3300005844 Bacteria 2862
130 Ga0068862_100284351 3300005844 Bacteria 1517
131 Ga0068862_101028213 3300005844 Bacteria 816
132 Ga0075363_100028591 3300006048 Bacteria 2870
133 Ga0070715_10337505 3300006163 Bacteria 819
134 Ga0070715_10779465 3300006163 Bacteria 578
135 Ga0070716_100422128 3300006173 Unclassified 965
136 Ga0097621_100003850 3300006237 Bacteria 10392
137 Ga0097621_100006928 3300006237 Bacteria 8069
138 Ga0097621_100037349 3300006237 Bacteria 3891
139 Ga0097621_100096137 3300006237 Bacteria 2486
140 Ga0097621_100184110 3300006237 Unclassified 1806
141 Ga0097621_100631210 3300006237 Bacteria 981
142 Ga0097621_101021189 3300006237 Bacteria 774
143 Ga0097621_101937212 3300006237 Unclassified 563
144 Ga0097621_102168508 3300006237 Unclassified 531
145 Ga0068871_100021596 3300006358 Bacteria 4950
146 Ga0068871_100022154 3300006358 Bacteria 4897
147 Ga0068871_100040222 3300006358 Bacteria 3744
148 Ga0068871_100531202 3300006358 Bacteria 1063
149 Ga0068871_100541789 3300006358 Bacteria 1053
150 Ga0068871_100575440 3300006358 Bacteria 1022
151 Ga0068871_100711453 3300006358 Unclassified 921
152 Ga0075428_100002659 3300006844 Bacteria 19407
153 Ga0075434_101033417 3300006871 Unclassified 835
154 Ga0075434_102099315 3300006871 Bacteria 570
155 Ga0075429_100249329 3300006880 Bacteria 1555
156 Ga0068865_100009314 3300006881 Bacteria 6083
157 Ga0068865_100206259 3300006881 Bacteria 1529
158 Ga0068865_100700721 3300006881 Bacteria 865
159 Ga0097620_100082450 3300006931 Bacteria 3259
160 Ga0097620_100683331 3300006931 Bacteria 1118
161 Ga0097620_101404337 3300006931 Unclassified 770
162 Ga0097620_101490082 3300006931 Bacteria 747
163 Ga0105240_10400727 3300009093 Bacteria 1545
164 Ga0105240_10955725 3300009093 Bacteria 919
165 Ga0105240_11126621 3300009093 Bacteria 834
166 Ga0111539_10802111 3300009094 Bacteria 1096
167 Ga0105245_10332754 3300009098 Bacteria 1499
168 Ga0105243_10028374 3300009148 Bacteria 4296
169 Ga0105243_10080882 3300009148 Bacteria 2651
170 Ga0105243_10988177 3300009148 Bacteria 843
171 Ga0105243_11248257 3300009148 Bacteria 758
172 Ga0105243_12205818 3300009148 Unclassified 587
173 Ga0105241_10019570 3300009174 Bacteria 4993
174 Ga0105241_10038099 3300009174 Bacteria 3625
175 Ga0105241_10355816 3300009174 Unclassified 1273
176 Ga0105242_10221722 3300009176 Bacteria 1690
177 Ga0105242_11005194 3300009176 Bacteria 842
178 Ga0105242_11325491 3300009176 Bacteria 744
179 Ga0105242_11695835 3300009176 Bacteria 668
180 Ga0105242_11897125 3300009176 Bacteria 636
181 Ga0105248_10004485 3300009177 Bacteria 15448
182 Ga0105248_10011910 3300009177 Bacteria 9592
183 Ga0105248_10044833 3300009177 Bacteria 4960
184 Ga0105248_10214647 3300009177 Bacteria 2167
185 Ga0105248_11459909 3300009177 Bacteria 774
186 Ga0105237_10638293 3300009545 Bacteria 1072
187 Ga0105237_10881524 3300009545 Bacteria 902
188 Ga0105238_10008762 3300009551 Bacteria 10119
189 Ga0105238_10197627 3300009551 Bacteria 1986
190 Ga0105238_10747298 3300009551 Bacteria 992
191 Ga0105249_10091850 3300009553 Plasmid 2841
192 Ga0105249_10778777 3300009553 Bacteria 1020
193 Ga0105249_11376971 3300009553 Bacteria 777
194 Ga0105239_10007582 3300010375 Bacteria 12436
195 Ga0105239_11044025 3300010375 Bacteria 940
196 Ga0105239_11521840 3300010375 Bacteria 773
197 Ga0105239_11840392 3300010375 Unclassified 702
198 Ga0157339_1004073 3300012505 Bacteria 1090
199 Ga0157324_1024068 3300012506 Unclassified 643
200 Ga0157371_10824810 3300013102 Bacteria 700
201 Ga0157370_10007668 3300013104 Bacteria 11710
202 Ga0157370_10204457 3300013104 Bacteria 1831
203 Ga0157370_10269928 3300013104 Bacteria 1572
204 Ga0157369_10037184 3300013105 Bacteria 5330
205 Ga0157369_10805802 3300013105 Bacteria 965
206 Ga0157374_10007452 3300013296 Bacteria 9332
207 Ga0157374_10118758 3300013296 Bacteria 2550
208 Ga0157374_10515935 3300013296 Bacteria 1201
209 Ga0157378_10030895 3300013297 Bacteria 4729
210 Ga0157378_10035145 3300013297 Bacteria 4432
211 Ga0157378_10512095 3300013297 Unclassified 1200
212 Ga0157378_10776803 3300013297 Bacteria 982
213 Ga0157378_12556823 3300013297 Bacteria 563
214 Ga0163162_10023895 3300013306 Bacteria 6031
215 Ga0163162_10071206 3300013306 Bacteria 3529
216 Ga0163162_10077835 3300013306 Bacteria 3381
217 Ga0163162_10082317 3300013306 Bacteria 3290
218 Ga0163162_10109866 3300013306 Bacteria 2854
219 Ga0163162_10491878 3300013306 Bacteria 1358
220 Ga0163162_10493474 3300013306 Bacteria 1355
221 Ga0163162_11004624 3300013306 Bacteria 943
222 Ga0157372_10159615 3300013307 Bacteria 2605
223 Ga0157372_11643360 3300013307 Bacteria 739
224 Ga0157372_12078027 3300013307 Unclassified 653
225 Ga0157375_10009472 3300013308 Bacteria 8551
226 Ga0157375_10107384 3300013308 Bacteria 2884
227 Ga0157375_10355335 3300013308 Bacteria 1631
228 Ga0157375_11893834 3300013308 Unclassified 708
229 Ga0157375_12043779 3300013308 Bacteria 681
230 Ga0163163_10000163 3300014325 Bacteria 69522
231 Ga0163163_10086426 3300014325 Bacteria 3145
232 Ga0163163_10447460 3300014325 Bacteria 1352
233 Ga0163163_10757744 3300014325 Bacteria 1034
234 Ga0163163_10944617 3300014325 Unclassified 926
235 Ga0157380_10070559 3300014326 Bacteria 2823
236 Ga0157380_12158660 3300014326 Bacteria 620
237 Ga0157379_10006777 3300014968 Bacteria 9904
238 Ga0157379_10068303 3300014968 Bacteria 3178
239 Ga0157379_10476502 3300014968 Bacteria 1155
240 Ga0157379_11662170 3300014968 Bacteria 625
241 Ga0157376_10010986 3300014969 Bacteria 6653
242 Ga0157376_10072718 3300014969 Bacteria 2926
243 Ga0157376_10119571 3300014969 Bacteria 2333
244 Ga0157376_10151253 3300014969 Bacteria 2093
245 Ga0157376_10182945 3300014969 Bacteria 1917
246 Ga0157376_10464836 3300014969 Unclassified 1237
247 Ga0157376_10742928 3300014969 Bacteria 990
248 Ga0157376_10792942 3300014969 Unclassified 959
249 Ga0157376_10979892 3300014969 Bacteria 867
250 Ga0157376_11154809 3300014969 Bacteria 801
251 Ga0157376_11489539 3300014969 Bacteria 709
252 Ga0157376_11590813 3300014969 Bacteria 688
253 Ga0182005_1115785 3300015265 Bacteria 760
254 Ga0163161_10030295 3300017792 Bacteria 3849
255 Ga0163161_10037371 3300017792 Bacteria 3481
256 Ga0163161_10237833 3300017792 Bacteria 1415
257 Ga0209051_1005225 3300025303 Bacteria 7666
258 Ga0209257_1067913 3300025304 Bacteria 949
259 Ga0207697_10020141 3300025315 Bacteria 2732
260 Ga0207697_10062856 3300025315 Bacteria 1547
261 Ga0207656_10000590 3300025321 Bacteria 12010
262 Ga0207682_10026646 3300025893 Unclassified 2299
263 Ga0207682_10114973 3300025893 Bacteria 1188
264 Ga0207642_10265943 3300025899 Unclassified 980
265 Ga0207642_10271915 3300025899 Bacteria 971
266 Ga0207680_10001916 3300025903 Bacteria 9755
267 Ga0207680_10010121 3300025903 Bacteria 4706
268 Ga0207680_10093392 3300025903 Bacteria 1919
269 Ga0207647_10000075 3300025904 Bacteria 76289
270 Ga0207685_10095610 3300025905 Bacteria 1260
271 Ga0207645_10000259 3300025907 Bacteria 43634
272 Ga0207643_10380866 3300025908 Bacteria 889
273 Ga0207654_10265928 3300025911 Unclassified 1155
274 Ga0207695_10149527 3300025913 Bacteria 2275
275 Ga0207695_10368355 3300025913 Bacteria 1323
276 Ga0207695_10631083 3300025913 Bacteria 953
277 Ga0207695_10801017 3300025913 Bacteria 822
278 Ga0207671_10066520 3300025914 Bacteria 2683
279 Ga0207671_10397082 3300025914 Unclassified 1097
280 Ga0207657_10811161 3300025919 Unclassified 723
281 Ga0207649_10127813 3300025920 Unclassified 1722
282 Ga0207649_10986716 3300025920 Bacteria 662
283 Ga0207681_10194398 3300025923 Unclassified 1554
284 Ga0207681_11326704 3300025923 Bacteria 604
285 Ga0207694_10000566 3300025924 Bacteria 33540
286 Ga0207650_10028111 3300025925 Bacteria 4030
287 Ga0207650_10029867 3300025925 Bacteria 3922
288 Ga0207659_10020032 3300025926 Bacteria 4414
289 Ga0207659_10538114 3300025926 Bacteria 992
290 Ga0207687_10098054 3300025927 Bacteria 2151
291 Ga0207687_10237134 3300025927 Bacteria 1444
292 Ga0207644_10021790 3300025931 Bacteria 4369
293 Ga0207644_10022566 3300025931 Bacteria 4302
294 Ga0207690_11190769 3300025932 Bacteria 636
295 Ga0207706_10002400 3300025933 Bacteria 18269
296 Ga0207706_10024352 3300025933 Bacteria 5427
297 Ga0207706_10585931 3300025933 Bacteria 959
298 Ga0207706_10646969 3300025933 Bacteria 906
299 Ga0207686_10007121 3300025934 Bacteria 6016
300 Ga0207686_10099891 3300025934 Unclassified 1935
301 Ga0207709_10003904 3300025935 Bacteria 8707
302 Ga0207709_11089179 3300025935 Unclassified 656
303 Ga0207670_10033816 3300025936 Bacteria 3298
304 Ga0207670_11061525 3300025936 Bacteria 683
305 Ga0207669_10054969 3300025937 Bacteria 2408
306 Ga0207669_10063182 3300025937 Bacteria 2284
307 Ga0207669_10137481 3300025937 Bacteria 1690
308 Ga0207669_11408602 3300025937 Unclassified 593
309 Ga0207704_10041264 3300025938 Bacteria 2704
310 Ga0207704_10654928 3300025938 Bacteria 865
311 Ga0207704_10962451 3300025938 Bacteria 720
312 Ga0207704_11221889 3300025938 Bacteria 641
313 Ga0207665_10068671 3300025939 Bacteria 2415
314 Ga0207665_11612543 3300025939 Bacteria 514
315 Ga0207691_10007481 3300025940 Bacteria 10515
316 Ga0207691_10036885 3300025940 Bacteria 4528
317 Ga0207711_10037230 3300025941 Bacteria 4131
318 Ga0207711_10148579 3300025941 Bacteria 2113
319 Ga0207711_11051637 3300025941 Unclassified 754
320 Ga0207689_10004118 3300025942 Bacteria 13223
321 Ga0207689_10193254 3300025942 Bacteria 1679
322 Ga0207661_10440447 3300025944 Unclassified 1186
323 Ga0207661_11452204 3300025944 Unclassified 629
324 Ga0207667_10173259 3300025949 Unclassified 2218
325 Ga0207667_10495690 3300025949 Bacteria 1239
326 Ga0207667_10703240 3300025949 Bacteria 1013
327 Ga0207651_10024636 3300025960 Bacteria 3726
328 Ga0207712_10000211 3300025961 Bacteria 58110
329 Ga0207712_10230979 3300025961 Bacteria 1485
330 Ga0207712_11044921 3300025961 Unclassified 726
331 Ga0207712_11059351 3300025961 Bacteria 721
332 Ga0207668_10002683 3300025972 Bacteria 10414
333 Ga0207668_10038062 3300025972 Bacteria 3225
334 Ga0207668_10128471 3300025972 Bacteria 1931
335 Ga0207668_11053429 3300025972 Bacteria 728
336 Ga0207640_10549341 3300025981 Unclassified 970
337 Ga0207658_10008683 3300025986 Bacteria 6901
338 Ga0207658_10147356 3300025986 Bacteria 1913
339 Ga0207658_10158059 3300025986 Unclassified 1855
340 Ga0207658_10992767 3300025986 Bacteria 766
341 Ga0207658_11340104 3300025986 Unclassified 654
342 Ga0207677_10008856 3300026023 Bacteria 5641
343 Ga0207703_10000180 3300026035 Bacteria 73584
344 Ga0207703_10069774 3300026035 Bacteria 2899
345 Ga0207703_10295660 3300026035 Bacteria 1475
346 Ga0207639_10000367 3300026041 Bacteria 31306
347 Ga0207639_10221861 3300026041 Bacteria 1633
348 Ga0207639_10694234 3300026041 Unclassified 944
349 Ga0207639_11433242 3300026041 Bacteria 648
350 Ga0207678_10052348 3300026067 Plasmid 3523
351 Ga0207708_10308379 3300026075 Bacteria 1289
352 Ga0207708_10311044 3300026075 Unclassified 1284
353 Ga0207708_10410788 3300026075 Unclassified 1121
354 Ga0207708_11094743 3300026075 Unclassified 694
355 Ga0207702_10163203 3300026078 Unclassified 2036
356 Ga0207702_10244600 3300026078 Bacteria 1682
357 Ga0207702_10575838 3300026078 Bacteria 1103
358 Ga0207641_10022156 3300026088 Bacteria 5228
359 Ga0207641_10120895 3300026088 Bacteria 2337
360 Ga0207641_10248442 3300026088 Bacteria 1660
361 Ga0207641_11240814 3300026088 Bacteria 745
362 Ga0207648_10004007 3300026089 Bacteria 15285
363 Ga0207648_10600409 3300026089 Bacteria 1014
364 Ga0207648_10611905 3300026089 Bacteria 1005
365 Ga0207676_10037820 3300026095 Bacteria 3680
366 Ga0207676_10749635 3300026095 Bacteria 949
367 Ga0207675_100110308 3300026118 Bacteria 2596
368 Ga0207675_100373194 3300026118 Bacteria 1402
369 Ga0207675_100855734 3300026118 Bacteria 924
370 Ga0207683_10000724 3300026121 Bacteria 30029
371 Ga0207683_10004544 3300026121 Bacteria 11963
372 Ga0207683_10041438 3300026121 Bacteria 4020
373 Ga0207698_10030653 3300026142 Bacteria 3871
374 Ga0207698_10414918 3300026142 Bacteria 1290
375 Ga0207698_11216012 3300026142 Bacteria 767
376 Ga0207698_11933248 3300026142 Bacteria 605
377 Ga0207428_11057294 3300027907 Bacteria 569
378 Ga0268266_10000008 3300028379 Bacteria 1161875
379 Ga0268266_10027884 3300028379 Bacteria 4802
380 Ga0268266_10226504 3300028379 Bacteria 1720
381 Ga0268266_12006440 3300028379 Bacteria 552
382 Ga0268265_10037199 3300028380 Bacteria 3571
383 Ga0268265_10098878 3300028380 Bacteria 2351
384 Ga0268265_10447927 3300028380 Bacteria 1205
385 Ga0268265_11454660 3300028380 Bacteria 688
386 Ga0268264_10023740 3300028381 Bacteria 5001
387 Ga0268264_10077085 3300028381 Bacteria 2838
388 Ga0268264_12092659 3300028381 Bacteria 575
389 Ga0307517_10218487 3300028786 Bacteria 1162
390 Ga0307515_10000006 3300028794 Bacteria 725810
391 Ga0307515_10669776 3300028794 Bacteria 651
392 Ga0307509_10182119 3300031507 Bacteria 1964
393 Ga0307509_10313664 3300031507 Bacteria 1309
394 Ga0307508_10316738 3300031616 Unclassified 1152
395 Ga0316579_10600599 3300031691 Bacteria 533
396 Ga0307414_11187867 3300032004 Bacteria 706
397 Ga0307414_12141548 3300032004 Unclassified 522
398 Ga0373930_0045934 3300034816 Bacteria 942
399 Ga0373928_0108323 3300035084 Bacteria 732
400 Ga0373929_0102761 3300035085 Bacteria 722
401 Ga0373944_0087715 3300035089 Bacteria 1036
402 Ga0373952_0292298 3300035092 Bacteria 505
403 Ga0373923_0480952 3300035111 Bacteria 604
404 Ga0373945_0060695 3300035116 Bacteria 1411
405 Ga0373953_0031798 3300035117 Unclassified 2055
406 Ga0373953_0287344 3300035117 Bacteria 717
407 Ga0373954_0002570 3300035118 Bacteria 7627
408 Ga0373956_0255986 3300035119 Unclassified 832
409 Ga0373943_0161499 3300035170 Bacteria 1220
410 Ga0373946_0104346 3300035171 Unclassified 1275
411 Ga0373946_0176887 3300035171 Bacteria 1011
412 Ga0373946_0214670 3300035171 Unclassified 927
413 Ga0373946_0243476 3300035171 Bacteria 875
414 Ga0373955_0230966 3300035172 Bacteria 1107
415 Ga0373955_0747310 3300035172 Unclassified 601
416 Ga0373962_0164617 3300035242 Bacteria 733
417 Ga0373924_0069699 3300035410 Bacteria 1482
418 Ga0373931_0007490 3300035691 Bacteria 5140
419 Ga0373933_0212183 3300035724 Bacteria 1241
420 Ga0373947_0728164 3300035725 Bacteria 677
421 Ga0373947_1205779 3300035725 Unclassified 515
422 Ga0373937_0034320 3300036401 Bacteria 4615
423 Ga0373937_1436859 3300036401 Unclassified 637
424 Ga0373937_1811027 3300036401 Unclassified 557
425 Ga0373937_2037736 3300036401 Unclassified 520
426 Ga0373925_0033454 3300037068 Bacteria 3788
427 Ga0373925_0721320 3300037068 Bacteria 822
428 Ga0395900_0121908 3300037418 Bacteria 2675
429 Ga0395905_0129680 3300037471 Bacteria 2371
430 Ga0395905_0240985 3300037471 Unclassified 1690
431 Ga0395901_0165861 3300038443 Bacteria 2319
432 Ga0451795_0412165 3300041456 Bacteria 825
433 Ga0451798_0914838 3300041458 Unclassified 520
434 Ga0451839_0395494 3300041496 Bacteria 857
435 Ga0451853_2056693 3300041512 Unclassified 514
436 Ga0451853_2614255 3300041512 Bacteria 822
437 Ga0466960_0022583 3300044901 Bacteria 2815
438 Ga0495580_0090223 3300046472 Bacteria 2134
439 Ga0495664_0465698 3300046477 Bacteria 756
440 Ga0495585_0043007 3300046492 Bacteria 2528
441 Ga0495606_0132845 3300046507 Bacteria 1478
442 Ga0495628_0705531 3300046516 Unclassified 712
443 Ga0495630_0070078 3300046517 Bacteria 2638
444 Ga0495586_0836691 3300046535 Unclassified 531
445 Ga0495587_0121243 3300046536 Unclassified 1498
446 Ga0495598_0169426 3300046537 Bacteria 773
447 Ga0495621_0339297 3300046539 Unclassified 629
448 Ga0495667_0005797 3300046559 Bacteria 8369
449 Ga0495668_0368297 3300046616 Bacteria 789
450 Ga0495657_0626208 3300046675 Unclassified 621
451 Ga0495657_0724413 3300046675 Unclassified 571
452 Ga0495647_0180678 3300046681 Bacteria 918
453 Ga0495647_0364998 3300046681 Bacteria 659
454 Ga0495658_0019408 3300046683 Bacteria 3548
455 Ga0495658_0450253 3300046683 Bacteria 822
456 Ga0495658_0978813 3300046683 Unclassified 540
457 Ga0495613_0680707 3300046689 Unclassified 678
458 Ga0495624_0026142 3300046690 Bacteria 3826
459 Ga0495624_0815497 3300046690 Unclassified 551
460 Ga0495670_0284142 3300046691 Bacteria 885
461 Ga0495670_0367342 3300046691 Unclassified 775
462 Ga0495636_0016991 3300047318 Bacteria 2910
463 Ga0495674_0781567 3300047319 Unclassified 744
464 Ga0495680_0136260 3300047322 Unclassified 1800
465 Ga0495675_0807141 3300047444 Unclassified 519
466 Ga0495684_0476674 3300047471 Unclassified 862
467 Ga0496101_0312483 3300048904 Bacteria 1232
468 Ga0496101_0394371 3300048904 Bacteria 1090
469 Ga0496104_0293826 3300048907 Bacteria 1537
470 Ga0496105_0050593 3300048908 Bacteria 3432
471 Ga0496107_0242575 3300048910 Bacteria 1341
472 Ga0496107_1194578 3300048910 Bacteria 547
473 Ga0496108_0077862 3300048911 Bacteria 2806
474 Ga0496109_0202167 3300048912 Bacteria 1868
475 Ga0496110_0157476 3300048913 Bacteria 2058
476 Ga0496110_0658788 3300048913 Unclassified 947
477 Ga0496114_0157919 3300048917 Bacteria 1970
478 Ga0496114_0457212 3300048917 Bacteria 1130
479 Ga0496114_0894739 3300048917 Bacteria 769
480 Ga0496115_0765523 3300048918 Bacteria 754
481 Ga0496121_0041770 3300048924 Bacteria 4003
482 Ga0501043_0000002 3300049579 Bacteria 351081
483 Ga0501046_0000008 3300049580 Bacteria 351167
484 Ga0501047_0000003 3300049581 Bacteria 508375
485 Ga0501048_0002955 3300049582 Bacteria 12985
486 Ga0501044_0074343 3300049823 Bacteria 3453
487 Ga0501045_0012230 3300049824 Bacteria 6046
488 nmdc:mga03n38_63431_c1 3300050490 Bacteria 1688
489 nmdc:mga09592_112164_c1 3300050508 Unclassified 2339
490 nmdc:mga08y16_1627632_c1 3300050511 Bacteria 603
491 nmdc:mga0n895_1768746_c1 3300050512 Bacteria 579
492 nmdc:mga08x19_233843_c1 3300050514 Bacteria 1265
493 nmdc:mga0a205_819317_c1 3300050515 Bacteria 778
494 Ga0495601_0444416 3300053077 Unclassified 839
495 Ga0495619_0349285 3300053085 Bacteria 1023
496 Ga0500651_0476922 3300053093 Unclassified 691
497 2644303778 2643221654 Bacteria 5273570
498 Ga0070676_10002319
499 MBSR1b_contig_1622354
500 rootL2_10017173
501 rootH1_10189800
502 Ga0065712_10207408
503 Ga0065715_10105005
504 Ga0065707_10633107
505 Ga0070683_101911272
506 Ga0070683_101945282
507 Ga0070690_100084415
508 Ga0070670_100016569
509 Ga0070670_100056263
510 Ga0070670_100142537
511 Ga0070677_10069559
512 Ga0070677_10491375
513 Ga0068869_100005395
514 Ga0068869_102107884
515 Ga0070666_10000321
516 Ga0070666_10001808
517 Ga0070666_10004041
518 Ga0070666_10025630
519 Ga0070680_100218088
520 Ga0070682_100803056
521 Ga0068868_100010341
522 Ga0070660_101480242
523 Ga0070689_100048857
524 Ga0070661_100096771
525 Ga0070668_100011763
526 Ga0070668_100106230
527 Ga0070668_100133425
528 Ga0070668_100173651
529 Ga0070669_100004910
530 Ga0070669_100103084
531 Ga0070669_100290785
532 Ga0070675_100021458
533 Ga0070675_100088318
534 Ga0070675_101041781
535 Ga0070675_101483048
536 Ga0070671_100069914
537 Ga0070671_100159610
538 Ga0070671_101871341
539 Ga0070674_100095388
540 Ga0070674_100237640
541 Ga0070674_100710106
542 Ga0070674_101199396
543 Ga0070674_101420332
544 Ga0070673_100024710
545 Ga0070673_100027441
546 Ga0070659_101644308
547 Ga0070667_100015313
548 Ga0070667_100025422
549 Ga0070667_100271827
550 Ga0070667_100615049
551 Ga0070667_101414106
552 Ga0070667_101935397
553 Ga0070711_100220123
554 Ga0070705_101935736
555 Ga0070663_100009825
556 Ga0070678_100002020
557 Ga0070678_100017442
558 Ga0070678_100023743
559 Ga0070678_100217449
560 Ga0070678_101592827
561 Ga0070662_100010382
562 Ga0070662_100295732
563 Ga0070662_101403198
564 Ga0070662_101418912
565 Ga0070662_101513456
566 Ga0068867_100008082
567 Ga0068867_100098388
568 Ga0068867_101402227
569 Ga0070685_10055677
570 Ga0070685_10520196
571 Ga0070685_10753889
572 Ga0070706_101076922
573 Ga0070679_100116288
574 Ga0070684_100868413
575 Ga0070697_100231337
576 Ga0070697_101040696
577 Ga0068853_100105438
578 Ga0068853_100134630
579 Ga0068853_100174395
580 Ga0068853_100285547
581 Ga0068853_100622817
582 Ga0070672_100008716
583 Ga0070686_100213491
584 Ga0070665_100000414
585 Ga0070665_100007240
586 Ga0070665_100228721
587 Ga0070704_101023021
588 Ga0068855_101323920
589 Ga0068855_101377816
590 Ga0068855_102537984
591 Ga0068854_100088187
592 Ga0068856_100183736
593 Ga0068856_100669397
594 Ga0068856_101164933
595 Ga0070702_101135469
596 Ga0068852_100042226
597 Ga0068852_100141726
598 Ga0068859_100082448
599 Ga0068859_100683411
600 Ga0068859_101404449
601 Ga0068859_101490125
602 Ga0068864_100189260
603 Ga0068864_100318345
604 Ga0068864_100675061
605 Ga0068864_101387843
606 Ga0068866_10120028
607 Ga0068866_11050562
608 Ga0068861_100077426
609 Ga0068861_100840256
610 Ga0068861_101541286
611 Ga0068851_10000410
612 Ga0068851_10419861
613 Ga0068851_10996762
614 Ga0068863_100036072
615 Ga0068863_100148499
616 Ga0068863_100242576
617 Ga0068863_100470904
618 Ga0068863_101639420
619 Ga0068858_100000101
620 Ga0068858_100015488
621 Ga0068858_100371361
622 Ga0068860_100052062
623 Ga0068860_100153383
624 Ga0068860_102540338
625 Ga0068862_100056239
626 Ga0068862_100078440
627 Ga0068862_100284351
628 Ga0068862_101028213
629 Ga0075363_100028591
630 Ga0070715_10337505
631 Ga0070715_10779465
632 Ga0070716_100422128
633 Ga0097621_100003850
634 Ga0097621_100006928
635 Ga0097621_100037349
636 Ga0097621_100096137
637 Ga0097621_100184110
638 Ga0097621_100631210
639 Ga0097621_101021189
640 Ga0097621_101937212
641 Ga0097621_102168508
642 Ga0068871_100021596
643 Ga0068871_100022154
644 Ga0068871_100040222
645 Ga0068871_100531202
646 Ga0068871_100541789
647 Ga0068871_100575440
648 Ga0068871_100711453
649 Ga0075428_100002659
650 Ga0075434_101033417
651 Ga0075434_102099315
652 Ga0075429_100249329
653 Ga0068865_100009314
654 Ga0068865_100206259
655 Ga0068865_100700721
656 Ga0097620_100082450
657 Ga0097620_100683331
658 Ga0097620_101404337
659 Ga0097620_101490082
660 Ga0105240_10400727
661 Ga0105240_10955725
662 Ga0105240_11126621
663 Ga0111539_10802111
664 Ga0105245_10332754
665 Ga0105243_10028374
666 Ga0105243_10080882
667 Ga0105243_10988177
668 Ga0105243_11248257
669 Ga0105243_12205818
670 Ga0105241_10019570
671 Ga0105241_10038099
672 Ga0105241_10355816
673 Ga0105242_10221722
674 Ga0105242_11005194
675 Ga0105242_11325491
676 Ga0105242_11695835
677 Ga0105242_11897125
678 Ga0105248_10004485
679 Ga0105248_10011910
680 Ga0105248_10044833
681 Ga0105248_10214647
682 Ga0105248_11459909
683 Ga0105237_10638293
684 Ga0105237_10881524
685 Ga0105238_10008762
686 Ga0105238_10197627
687 Ga0105238_10747298
688 Ga0105249_10091850
689 Ga0105249_10778777
690 Ga0105249_11376971
691 Ga0105239_10007582
692 Ga0105239_11044025
693 Ga0105239_11521840
694 Ga0105239_11840392
695 Ga0157339_1004073
696 Ga0157324_1024068
697 Ga0157371_10824810
698 Ga0157370_10007668
699 Ga0157370_10204457
700 Ga0157370_10269928
701 Ga0157369_10037184
702 Ga0157369_10805802
703 Ga0157374_10007452
704 Ga0157374_10118758
705 Ga0157374_10515935
706 Ga0157378_10030895
707 Ga0157378_10035145
708 Ga0157378_10512095
709 Ga0157378_10776803
710 Ga0157378_12556823
711 Ga0163162_10023895
712 Ga0163162_10071206
713 Ga0163162_10077835
714 Ga0163162_10082317
715 Ga0163162_10109866
716 Ga0163162_10491878
717 Ga0163162_10493474
718 Ga0163162_11004624
719 Ga0157372_10159615
720 Ga0157372_11643360
721 Ga0157372_12078027
722 Ga0157375_10009472
723 Ga0157375_10107384
724 Ga0157375_10355335
725 Ga0157375_11893834
726 Ga0157375_12043779
727 Ga0163163_10000163
728 Ga0163163_10086426
729 Ga0163163_10447460
730 Ga0163163_10757744
731 Ga0163163_10944617
732 Ga0157380_10070559
733 Ga0157380_12158660
734 Ga0157379_10006777
735 Ga0157379_10068303
736 Ga0157379_10476502
737 Ga0157379_11662170
738 Ga0157376_10010986
739 Ga0157376_10072718
740 Ga0157376_10119571
741 Ga0157376_10151253
742 Ga0157376_10182945
743 Ga0157376_10464836
744 Ga0157376_10742928
745 Ga0157376_10792942
746 Ga0157376_10979892
747 Ga0157376_11154809
748 Ga0157376_11489539
749 Ga0157376_11590813
750 Ga0182005_1115785
751 Ga0163161_10030295
752 Ga0163161_10037371
753 Ga0163161_10237833
754 Ga0209051_1005225
755 Ga0209257_1067913
756 Ga0207697_10020141
757 Ga0207697_10062856
758 Ga0207656_10000590
759 Ga0207682_10026646
760 Ga0207682_10114973
761 Ga0207642_10265943
762 Ga0207642_10271915
763 Ga0207680_10001916
764 Ga0207680_10010121
765 Ga0207680_10093392
766 Ga0207647_10000075
767 Ga0207685_10095610
768 Ga0207645_10000259
769 Ga0207643_10380866
770 Ga0207654_10265928
771 Ga0207695_10149527
772 Ga0207695_10368355
773 Ga0207695_10631083
774 Ga0207695_10801017
775 Ga0207671_10066520
776 Ga0207671_10397082
777 Ga0207657_10811161
778 Ga0207649_10127813
779 Ga0207649_10986716
780 Ga0207681_10194398
781 Ga0207681_11326704
782 Ga0207694_10000566
783 Ga0207650_10028111
784 Ga0207650_10029867
785 Ga0207659_10020032
786 Ga0207659_10538114
787 Ga0207687_10098054
788 Ga0207687_10237134
789 Ga0207644_10021790
790 Ga0207644_10022566
791 Ga0207690_11190769
792 Ga0207706_10002400
793 Ga0207706_10024352
794 Ga0207706_10585931
795 Ga0207706_10646969
796 Ga0207686_10007121
797 Ga0207686_10099891
798 Ga0207709_10003904
799 Ga0207709_11089179
800 Ga0207670_10033816
801 Ga0207670_11061525
802 Ga0207669_10054969
803 Ga0207669_10063182
804 Ga0207669_10137481
805 Ga0207669_11408602
806 Ga0207704_10041264
807 Ga0207704_10654928
808 Ga0207704_10962451
809 Ga0207704_11221889
810 Ga0207665_10068671
811 Ga0207665_11612543
812 Ga0207691_10007481
813 Ga0207691_10036885
814 Ga0207711_10037230
815 Ga0207711_10148579
816 Ga0207711_11051637
817 Ga0207689_10004118
818 Ga0207689_10193254
819 Ga0207661_10440447
820 Ga0207661_11452204
821 Ga0207667_10173259
822 Ga0207667_10495690
823 Ga0207667_10703240
824 Ga0207651_10024636
825 Ga0207712_10000211
826 Ga0207712_10230979
827 Ga0207712_11044921
828 Ga0207712_11059351
829 Ga0207668_10002683
830 Ga0207668_10038062
831 Ga0207668_10128471
832 Ga0207668_11053429
833 Ga0207640_10549341
834 Ga0207658_10008683
835 Ga0207658_10147356
836 Ga0207658_10158059
837 Ga0207658_10992767
838 Ga0207658_11340104
839 Ga0207677_10008856
840 Ga0207703_10000180
841 Ga0207703_10069774
842 Ga0207703_10295660
843 Ga0207639_10000367
844 Ga0207639_10221861
845 Ga0207639_10694234
846 Ga0207639_11433242
847 Ga0207678_10052348
848 Ga0207708_10308379
849 Ga0207708_10311044
850 Ga0207708_10410788
851 Ga0207708_11094743
852 Ga0207702_10163203
853 Ga0207702_10244600
854 Ga0207702_10575838
855 Ga0207641_10022156
856 Ga0207641_10120895
857 Ga0207641_10248442
858 Ga0207641_11240814
859 Ga0207648_10004007
860 Ga0207648_10600409
861 Ga0207648_10611905
862 Ga0207676_10037820
863 Ga0207676_10749635
864 Ga0207675_100110308
865 Ga0207675_100373194
866 Ga0207675_100855734
867 Ga0207683_10000724
868 Ga0207683_10004544
869 Ga0207683_10041438
870 Ga0207698_10030653
871 Ga0207698_10414918
872 Ga0207698_11216012
873 Ga0207698_11933248
874 Ga0207428_11057294
875 Ga0268266_10000008
876 Ga0268266_10027884
877 Ga0268266_10226504
878 Ga0268266_12006440
879 Ga0268265_10037199
880 Ga0268265_10098878
881 Ga0268265_10447927
882 Ga0268265_11454660
883 Ga0268264_10023740
884 Ga0268264_10077085
885 Ga0268264_12092659
886 Ga0307517_10218487
887 Ga0307515_10000006
888 Ga0307515_10669776
889 Ga0307509_10182119
890 Ga0307509_10313664
891 Ga0307508_10316738
892 Ga0316579_10600599
893 Ga0307414_11187867
894 Ga0307414_12141548
895 Ga0373930_0045934
896 Ga0373928_0108323
897 Ga0373929_0102761
898 Ga0373944_0087715
899 Ga0373952_0292298
900 Ga0373923_0480952
901 Ga0373945_0060695
902 Ga0373953_0031798
903 Ga0373953_0287344
904 Ga0373954_0002570
905 Ga0373956_0255986
906 Ga0373943_0161499
907 Ga0373946_0104346
908 Ga0373946_0176887
909 Ga0373946_0214670
910 Ga0373946_0243476
911 Ga0373955_0230966
912 Ga0373955_0747310
913 Ga0373962_0164617
914 Ga0373924_0069699
915 Ga0373931_0007490
916 Ga0373933_0212183
917 Ga0373947_0728164
918 Ga0373947_1205779
919 Ga0373937_0034320
920 Ga0373937_1436859
921 Ga0373937_1811027
922 Ga0373937_2037736
923 Ga0373925_0033454
924 Ga0373925_0721320
925 Ga0395900_0121908
926 Ga0395905_0129680
927 Ga0395905_0240985
928 Ga0395901_0165861
929 Ga0451795_0412165
930 Ga0451798_0914838
931 Ga0451839_0395494
932 Ga0451853_2056693
933 Ga0451853_2614255
934 Ga0466960_0022583
935 Ga0495580_0090223
936 Ga0495664_0465698
937 Ga0495585_0043007
938 Ga0495606_0132845
939 Ga0495628_0705531
940 Ga0495630_0070078
941 Ga0495586_0836691
942 Ga0495587_0121243
943 Ga0495598_0169426
944 Ga0495621_0339297
945 Ga0495667_0005797
946 Ga0495668_0368297
947 Ga0495657_0626208
948 Ga0495657_0724413
949 Ga0495647_0180678
950 Ga0495647_0364998
951 Ga0495658_0019408
952 Ga0495658_0450253
953 Ga0495658_0978813
954 Ga0495613_0680707
955 Ga0495624_0026142
956 Ga0495624_0815497
957 Ga0495670_0284142
958 Ga0495670_0367342
959 Ga0495636_0016991
960 Ga0495674_0781567
961 Ga0495680_0136260
962 Ga0495675_0807141
963 Ga0495684_0476674
964 Ga0496101_0312483
965 Ga0496101_0394371
966 Ga0496104_0293826
967 Ga0496105_0050593
968 Ga0496107_0242575
969 Ga0496107_1194578
970 Ga0496108_0077862
971 Ga0496109_0202167
972 Ga0496110_0157476
973 Ga0496110_0658788
974 Ga0496114_0157919
975 Ga0496114_0457212
976 Ga0496114_0894739
977 Ga0496115_0765523
978 Ga0496121_0041770
979 Ga0501043_0000002
980 Ga0501046_0000008
981 Ga0501047_0000003
982 Ga0501048_0002955
983 Ga0501044_0074343
984 Ga0501045_0012230
985 nmdc:mga03n38_63431_c1
986 nmdc:mga09592_112164_c1
987 nmdc:mga08y16_1627632_c1
988 nmdc:mga0n895_1768746_c1
989 nmdc:mga08x19_233843_c1
990 nmdc:mga0a205_819317_c1
991 Ga0495601_0444416
992 Ga0495619_0349285
993 Ga0500651_0476922
994 2644303778

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map