F454974

General Info

Members Datasets Scaffolds Average Seq Length
496 297 992 183

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2932801729|2932801882
Length 179
Sequence IAIAITASVFGALSGVVGYQKTRPLTVGGDARDWQEVAWPYPRDGWPVGRAFRCDGCAEPIELYVRPKIGFCNSDSGVADDDEVDRVADLDLISQRFAPLEPGRVIRVADMPGRVRTYDLAMPDGSRRTAVGIAVSRRSDLLVAVAQGKGTASQVQRAALDYLASPDIAHWMVAAMEGK

Samples

Sample ID Description Type Environment
1 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
56 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
72 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
73 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
103 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
104 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
162 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
163 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
164 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
165 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
166 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
167 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
168 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
169 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
170 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
171 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
172 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
173 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
174 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
175 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
176 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
177 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
178 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
179 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
180 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
181 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
182 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
183 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
184 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
185 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
186 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
187 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
188 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
189 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
190 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
191 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
192 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
193 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
194 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
195 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
196 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
197 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
198 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
199 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
200 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
201 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
202 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
203 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
204 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
205 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
206 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
207 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
208 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
209 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
210 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
211 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
212 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
213 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
214 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
215 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
216 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
217 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
218 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
219 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
220 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
221 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
222 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
223 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
224 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
225 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
226 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
227 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
228 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
229 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
230 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
231 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
232 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
233 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
234 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
235 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
236 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
237 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
238 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
239 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
240 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
241 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
242 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
243 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
244 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
245 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
246 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
247 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
248 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
249 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
250 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
251 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
252 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
253 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
254 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
255 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
256 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
257 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
258 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
259 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
260 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
261 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
262 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
263 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
264 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
265 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
266 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
267 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
268 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
269 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
270 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
271 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
272 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
273 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
274 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
275 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
276 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
277 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
278 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
279 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
280 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
281 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
282 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
283 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
284 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
285 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
286 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
287 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
288 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
289 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
290 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
291 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
292 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
293 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
294 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
295 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
296 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
297 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.59
Metatranscriptomes 0.2
Isolates 1.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.29
Nodule 1.21
Rhizoplane 6.05
Rhizosphere 75.81
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10001416 3300003215 Bacteria 14364
2 Ga0070658_10519053 3300005327 Bacteria 1030
3 Ga0070676_10033104 3300005328 Bacteria 2964
4 Ga0070683_100484063 3300005329 Bacteria 1182
5 Ga0070683_100713103 3300005329 Bacteria 961
6 Ga0070670_100413440 3300005331 Bacteria 1192
7 Ga0070670_101012771 3300005331 Bacteria 756
8 Ga0068869_100028973 3300005334 Bacteria 3874
9 Ga0068869_100147243 3300005334 Bacteria 1823
10 Ga0068869_100280985 3300005334 Bacteria 1339
11 Ga0068869_100622519 3300005334 Bacteria 914
12 Ga0070680_100186521 3300005336 Bacteria 1747
13 Ga0070680_100303241 3300005336 Bacteria 1355
14 Ga0070682_100687879 3300005337 Bacteria 819
15 Ga0068868_100637501 3300005338 Bacteria 948
16 Ga0068868_100665212 3300005338 Bacteria 929
17 Ga0070660_100068275 3300005339 Bacteria 2770
18 Ga0070660_100076622 3300005339 Bacteria 2619
19 Ga0070661_100219312 3300005344 Bacteria 1458
20 Ga0070661_100512146 3300005344 Bacteria 962
21 Ga0070668_100035749 3300005347 Bacteria 3789
22 Ga0070668_100547945 3300005347 Bacteria 1006
23 Ga0070669_100459463 3300005353 Bacteria 1051
24 Ga0070675_101157150 3300005354 Bacteria 712
25 Ga0070671_100105113 3300005355 Bacteria 2370
26 Ga0070671_100127417 3300005355 Bacteria 2143
27 Ga0070674_100060347 3300005356 Bacteria 2643
28 Ga0070674_100454645 3300005356 Bacteria 1058
29 Ga0070674_101202956 3300005356 Bacteria 673
30 Ga0070659_101162719 3300005366 Bacteria 681
31 Ga0070667_100150984 3300005367 Bacteria 2041
32 Ga0070709_10000542 3300005434 Bacteria 22119
33 Ga0070709_10192443 3300005434 Bacteria 1440
34 Ga0070713_100012220 3300005436 Bacteria 6290
35 Ga0070713_100105722 3300005436 Bacteria 2446
36 Ga0070713_101029227 3300005436 Bacteria 795
37 Ga0070710_10076409 3300005437 Bacteria 1944
38 Ga0070701_10055938 3300005438 Bacteria 2063
39 Ga0070701_10350662 3300005438 Bacteria 922
40 Ga0070711_100001693 3300005439 Bacteria 12214
41 Ga0070711_100102170 3300005439 Bacteria 2088
42 Ga0070700_100039031 3300005441 Bacteria 2898
43 Ga0070663_100018140 3300005455 Bacteria 4607
44 Ga0070663_100133980 3300005455 Bacteria 1885
45 Ga0070663_100256131 3300005455 Bacteria 1387
46 Ga0070663_100452336 3300005455 Bacteria 1059
47 Ga0070663_100573893 3300005455 Bacteria 945
48 Ga0070663_100722103 3300005455 Bacteria 848
49 Ga0070678_100043585 3300005456 Bacteria 3197
50 Ga0070662_100114783 3300005457 Bacteria 2056
51 Ga0070662_100129997 3300005457 Bacteria 1940
52 Ga0068867_100207547 3300005459 Bacteria 1571
53 Ga0068867_100879477 3300005459 Bacteria 805
54 Ga0070706_101082647 3300005467 Bacteria 738
55 Ga0070679_100415642 3300005530 Bacteria 1290
56 Ga0070684_100199039 3300005535 Bacteria 1824
57 Ga0068853_100538974 3300005539 Bacteria 1105
58 Ga0068853_100689534 3300005539 Bacteria 974
59 Ga0068853_100863021 3300005539 Bacteria 868
60 Ga0070672_100063202 3300005543 Bacteria 2923
61 Ga0070695_100308271 3300005545 Bacteria 1173
62 Ga0070693_100260269 3300005547 Bacteria 1154
63 Ga0070665_100002394 3300005548 Bacteria 20689
64 Ga0070665_100005213 3300005548 Bacteria 13447
65 Ga0070665_100159586 3300005548 Bacteria 2257
66 Ga0070665_100204222 3300005548 Bacteria 1976
67 Ga0070665_100311991 3300005548 Bacteria 1577
68 Ga0070665_100557035 3300005548 Bacteria 1159
69 Ga0068855_100026149 3300005563 Bacteria 6982
70 Ga0068855_100749346 3300005563 Bacteria 1041
71 Ga0068857_100507204 3300005577 Bacteria 1133
72 Ga0068856_100006229 3300005614 Bacteria 11707
73 Ga0068856_100023428 3300005614 Bacteria 6002
74 Ga0068856_101054806 3300005614 Bacteria 831
75 Ga0070702_100083336 3300005615 Bacteria 1920
76 Ga0068852_100060857 3300005616 Bacteria 3279
77 Ga0068852_100205445 3300005616 Bacteria 1866
78 Ga0068859_100233103 3300005617 Bacteria 1929
79 Ga0068859_100306859 3300005617 Bacteria 1680
80 Ga0068859_101054025 3300005617 Bacteria 894
81 Ga0068866_10109809 3300005718 Bacteria 1536
82 Ga0068861_100560651 3300005719 Bacteria 1042
83 Ga0068861_100585758 3300005719 Bacteria 1022
84 Ga0068851_10096941 3300005834 Bacteria 1560
85 Ga0068863_100277633 3300005841 Bacteria 1623
86 Ga0068858_100116128 3300005842 Bacteria 2501
87 Ga0068858_101084505 3300005842 Bacteria 786
88 Ga0068860_100292318 3300005843 Bacteria 1595
89 Ga0068860_100579058 3300005843 Bacteria 1126
90 Ga0068862_100010352 3300005844 Bacteria 7696
91 Ga0068862_100026649 3300005844 Bacteria 4859
92 Ga0068862_100052503 3300005844 Bacteria 3488
93 Ga0068862_100565422 3300005844 Bacteria 1087
94 Ga0068862_101522768 3300005844 Bacteria 674
95 Ga0081455_10025270 3300005937 Bacteria 5486
96 Ga0081540_1014734 3300005983 Bacteria 4991
97 Ga0081539_10009079 3300005985 Bacteria 8424
98 Ga0070717_10013721 3300006028 Bacteria 6218
99 Ga0070717_10198897 3300006028 Bacteria 1755
100 Ga0075365_10118488 3300006038 Bacteria 1824
101 Ga0075365_11028313 3300006038 Bacteria 580
102 Ga0075368_10018742 3300006042 Bacteria 2605
103 Ga0075368_10056392 3300006042 Bacteria 1568
104 Ga0075363_100062994 3300006048 Bacteria 2000
105 Ga0075364_10074151 3300006051 Bacteria 2243
106 Ga0075364_10082233 3300006051 Bacteria 2131
107 Ga0075364_10736186 3300006051 Bacteria 673
108 Ga0070715_10013984 3300006163 Bacteria 2960
109 Ga0070716_100014423 3300006173 Bacteria 4047
110 Ga0070716_100023117 3300006173 Bacteria 3293
111 Ga0070712_100015526 3300006175 Bacteria 4909
112 Ga0075362_10160442 3300006177 Bacteria 1082
113 Ga0075367_10071753 3300006178 Bacteria 2084
114 Ga0075367_10104051 3300006178 Bacteria 1738
115 Ga0075367_10109865 3300006178 Bacteria 1691
116 Ga0075367_10165459 3300006178 Bacteria 1376
117 Ga0075369_10039845 3300006186 Bacteria 2007
118 Ga0075369_10079874 3300006186 Bacteria 1449
119 Ga0075366_10105246 3300006195 Bacteria 1696
120 Ga0075366_10208086 3300006195 Bacteria 1190
121 Ga0097621_100374028 3300006237 Bacteria 1271
122 Ga0097621_100976316 3300006237 Bacteria 792
123 Ga0075370_10175968 3300006353 Bacteria 1259
124 Ga0075428_100082832 3300006844 Bacteria 3500
125 Ga0075434_100127180 3300006871 Bacteria 2565
126 Ga0075434_100299752 3300006871 Bacteria 1628
127 Ga0075429_101261051 3300006880 Bacteria 645
128 Ga0097620_100233131 3300006931 Bacteria 1929
129 Ga0097620_100306880 3300006931 Bacteria 1680
130 Ga0097620_101054073 3300006931 Bacteria 894
131 Ga0099794_10057955 3300007265 Bacteria 1877
132 Ga0099794_10379802 3300007265 Bacteria 737
133 Ga0099795_10050225 3300007788 Bacteria 1516
134 Ga0099795_10139487 3300007788 Bacteria 985
135 Ga0099795_10224239 3300007788 Bacteria 801
136 Ga0105250_10083447 3300009092 Bacteria 1296
137 Ga0105240_10689991 3300009093 Bacteria 1115
138 Ga0111539_10724559 3300009094 Bacteria 1158
139 Ga0111539_10958817 3300009094 Bacteria 995
140 Ga0105245_10065056 3300009098 Bacteria 3297
141 Ga0105245_10297102 3300009098 Bacteria 1583
142 Ga0105247_10141071 3300009101 Bacteria 1579
143 Ga0114129_10100717 3300009147 Bacteria 3997
144 Ga0114129_11730380 3300009147 Bacteria 762
145 Ga0105243_11461930 3300009148 Bacteria 706
146 Ga0105241_10007922 3300009174 Bacteria 7811
147 Ga0105242_10034037 3300009176 Bacteria 4083
148 Ga0105248_10260333 3300009177 Bacteria 1953
149 Ga0105248_10690160 3300009177 Bacteria 1152
150 Ga0105237_10014182 3300009545 Bacteria 8344
151 Ga0105238_10337717 3300009551 Bacteria 1494
152 Ga0105238_11561636 3300009551 Bacteria 689
153 Ga0105249_10016863 3300009553 Bacteria 6482
154 Ga0105249_10880967 3300009553 Bacteria 962
155 Ga0099796_10176943 3300010159 Bacteria 854
156 Ga0105239_10034860 3300010375 Bacteria 5528
157 Ga0105239_10361499 3300010375 Bacteria 1639
158 Ga0105239_10675310 3300010375 Bacteria 1180
159 Ga0105239_10736547 3300010375 Bacteria 1128
160 Ga0105246_10052887 3300011119 Bacteria 2793
161 Ga0105246_10181586 3300011119 Bacteria 1620
162 Ga0157369_10538357 3300013105 Bacteria 1207
163 Ga0157369_11341169 3300013105 Bacteria 729
164 Ga0157374_10354625 3300013296 Bacteria 1458
165 Ga0157374_10935999 3300013296 Bacteria 885
166 Ga0157378_10166800 3300013297 Bacteria 2063
167 Ga0163162_10024208 3300013306 Bacteria 5991
168 Ga0157372_10526179 3300013307 Bacteria 1378
169 Ga0157375_10079107 3300013308 Bacteria 3323
170 Ga0157375_10082021 3300013308 Bacteria 3266
171 Ga0157375_10567180 3300013308 Bacteria 1296
172 Ga0157375_11228539 3300013308 Bacteria 880
173 Ga0163163_10183298 3300014325 Bacteria 2141
174 Ga0163163_11570733 3300014325 Bacteria 719
175 Ga0157380_10228862 3300014326 Bacteria 1668
176 Ga0157377_10465898 3300014745 Bacteria 876
177 Ga0157379_10162321 3300014968 Bacteria 2017
178 Ga0157379_10374646 3300014968 Bacteria 1306
179 Ga0157379_10970331 3300014968 Bacteria 809
180 Ga0157379_11103501 3300014968 Bacteria 760
181 Ga0157376_10288261 3300014969 Bacteria 1549
182 Ga0157376_10330412 3300014969 Bacteria 1452
183 Ga0157376_10791653 3300014969 Bacteria 960
184 Ga0163161_10006317 3300017792 Bacteria 8202
185 Ga0206356_11862996 3300020070 Bacteria 905
186 Ga0213876_10004130 3300021384 Bacteria 8156
187 Ga0209758_1009647 3300025297 Bacteria 5949
188 Ga0209758_1015925 3300025297 Bacteria 3856
189 Ga0207697_10043318 3300025315 Bacteria 1851
190 Ga0207692_10062873 3300025898 Bacteria 1928
191 Ga0207642_10068587 3300025899 Bacteria 1678
192 Ga0207642_10216125 3300025899 Bacteria 1068
193 Ga0207688_10124868 3300025901 Bacteria 1504
194 Ga0207688_10125717 3300025901 Bacteria 1499
195 Ga0207688_10359676 3300025901 Bacteria 898
196 Ga0207680_10348532 3300025903 Bacteria 1040
197 Ga0207685_10015942 3300025905 Bacteria 2393
198 Ga0207699_10002461 3300025906 Bacteria 8738
199 Ga0207699_10019652 3300025906 Bacteria 3607
200 Ga0207699_10638382 3300025906 Bacteria 777
201 Ga0207645_10038963 3300025907 Bacteria 3046
202 Ga0207643_10127261 3300025908 Bacteria 1513
203 Ga0207684_10200522 3300025910 Bacteria 1721
204 Ga0207684_10353363 3300025910 Bacteria 1265
205 Ga0207684_10753939 3300025910 Bacteria 825
206 Ga0207654_10078232 3300025911 Bacteria 1984
207 Ga0207707_10020814 3300025912 Bacteria 5730
208 Ga0207671_10108395 3300025914 Bacteria 2111
209 Ga0207671_10174995 3300025914 Bacteria 1668
210 Ga0207693_10002055 3300025915 Bacteria 17603
211 Ga0207663_10006117 3300025916 Bacteria 6125
212 Ga0207663_10059054 3300025916 Bacteria 2424
213 Ga0207660_10132534 3300025917 Bacteria 1898
214 Ga0207660_10301600 3300025917 Bacteria 1275
215 Ga0207657_10021413 3300025919 Bacteria 6084
216 Ga0207657_10051937 3300025919 Bacteria 3561
217 Ga0207657_10530777 3300025919 Bacteria 921
218 Ga0207649_10048682 3300025920 Bacteria 2615
219 Ga0207649_10466536 3300025920 Bacteria 955
220 Ga0207652_10682511 3300025921 Bacteria 917
221 Ga0207681_10857823 3300025923 Bacteria 760
222 Ga0207694_10241210 3300025924 Bacteria 1477
223 Ga0207650_10088708 3300025925 Bacteria 2359
224 Ga0207650_10441494 3300025925 Bacteria 1082
225 Ga0207659_10327585 3300025926 Bacteria 1265
226 Ga0207659_10559135 3300025926 Bacteria 973
227 Ga0207700_10029573 3300025928 Bacteria 3868
228 Ga0207700_10615368 3300025928 Bacteria 967
229 Ga0207664_10102951 3300025929 Bacteria 2362
230 Ga0207664_10309366 3300025929 Bacteria 1392
231 Ga0207644_10097441 3300025931 Bacteria 2203
232 Ga0207644_10744767 3300025931 Bacteria 818
233 Ga0207690_10251131 3300025932 Bacteria 1366
234 Ga0207690_10287283 3300025932 Bacteria 1283
235 Ga0207690_10382646 3300025932 Bacteria 1119
236 Ga0207706_10250593 3300025933 Bacteria 1547
237 Ga0207706_10260617 3300025933 Bacteria 1514
238 Ga0207709_10021512 3300025935 Bacteria 3652
239 Ga0207709_11055809 3300025935 Bacteria 666
240 Ga0207669_10842236 3300025937 Bacteria 763
241 Ga0207704_10197837 3300025938 Bacteria 1468
242 Ga0207665_10023354 3300025939 Bacteria 4074
243 Ga0207665_10023387 3300025939 Bacteria 4071
244 Ga0207665_10057894 3300025939 Bacteria 2618
245 Ga0207691_10053838 3300025940 Bacteria 3672
246 Ga0207691_10551719 3300025940 Bacteria 977
247 Ga0207689_10015283 3300025942 Bacteria 6497
248 Ga0207689_10536492 3300025942 Bacteria 982
249 Ga0207661_10100232 3300025944 Bacteria 2431
250 Ga0207679_10958774 3300025945 Bacteria 783
251 Ga0207667_10047898 3300025949 Bacteria 4521
252 Ga0207667_10215761 3300025949 Bacteria 1966
253 Ga0207712_10616986 3300025961 Bacteria 940
254 Ga0207668_10113387 3300025972 Bacteria 2038
255 Ga0207668_10132137 3300025972 Bacteria 1907
256 Ga0207668_10618283 3300025972 Bacteria 945
257 Ga0207668_10643585 3300025972 Bacteria 927
258 Ga0207658_10110404 3300025986 Bacteria 2173
259 Ga0207658_10802623 3300025986 Bacteria 854
260 Ga0207677_10006386 3300026023 Bacteria 6465
261 Ga0207677_11052485 3300026023 Bacteria 740
262 Ga0207703_10509784 3300026035 Bacteria 1130
263 Ga0207703_11030315 3300026035 Bacteria 790
264 Ga0207639_10096552 3300026041 Bacteria 2378
265 Ga0207639_10142722 3300026041 Bacteria 1997
266 Ga0207678_10012752 3300026067 Bacteria 7382
267 Ga0207678_10066250 3300026067 Bacteria 3102
268 Ga0207678_10103696 3300026067 Bacteria 2428
269 Ga0207678_10113075 3300026067 Bacteria 2316
270 Ga0207678_10114338 3300026067 Bacteria 2303
271 Ga0207678_10505562 3300026067 Bacteria 1054
272 Ga0207702_10004851 3300026078 Bacteria 11844
273 Ga0207702_10712329 3300026078 Bacteria 989
274 Ga0207702_11382906 3300026078 Bacteria 698
275 Ga0207641_10936926 3300026088 Bacteria 861
276 Ga0207648_10055076 3300026089 Bacteria 3472
277 Ga0207648_10899691 3300026089 Bacteria 827
278 Ga0207676_10129395 3300026095 Bacteria 2144
279 Ga0207674_10201742 3300026116 Bacteria 1938
280 Ga0207674_10693422 3300026116 Bacteria 983
281 Ga0207675_100027594 3300026118 Bacteria 5288
282 Ga0207675_100055763 3300026118 Bacteria 3687
283 Ga0207675_100083004 3300026118 Bacteria 3005
284 Ga0207675_100242837 3300026118 Bacteria 1741
285 Ga0207683_10005742 3300026121 Bacteria 10643
286 Ga0207683_10018090 3300026121 Bacteria 6009
287 Ga0207698_10179454 3300026142 Bacteria 1874
288 Ga0207698_10233214 3300026142 Bacteria 1672
289 Ga0207698_10501185 3300026142 Bacteria 1182
290 Ga0209588_1001521 3300027671 Bacteria 6116
291 Ga0209813_10055765 3300027866 Bacteria 1249
292 Ga0268266_10001169 3300028379 Bacteria 32459
293 Ga0268266_10002165 3300028379 Bacteria 21557
294 Ga0268266_10058190 3300028379 Bacteria 3327
295 Ga0268266_10330126 3300028379 Bacteria 1429
296 Ga0268265_10087215 3300028380 Bacteria 2482
297 Ga0268265_10380451 3300028380 Bacteria 1298
298 Ga0268265_10569866 3300028380 Bacteria 1077
299 Ga0268265_10823741 3300028380 Bacteria 906
300 Ga0268264_10000458 3300028381 Bacteria 55551
301 Ga0268264_10281348 3300028381 Bacteria 1558
302 Ga0307515_10018157 3300028794 Bacteria 12759
303 Ga0307515_10153455 3300028794 Bacteria 2393
304 Ga0307515_10497586 3300028794 Bacteria 830
305 Ga0307511_10117269 3300030521 Bacteria 1664
306 Ga0307512_10340563 3300030522 Bacteria 668
307 Ga0265330_10097804 3300031235 Bacteria 1257
308 Ga0265330_10175112 3300031235 Bacteria 909
309 Ga0265332_10013847 3300031238 Bacteria 3571
310 Ga0265339_10049967 3300031249 Bacteria 2288
311 Ga0265331_10032855 3300031250 Bacteria 2568
312 Ga0265331_10101047 3300031250 Bacteria 1327
313 Ga0265316_10142248 3300031344 Bacteria 1801
314 Ga0265316_10377138 3300031344 Bacteria 1024
315 Ga0307509_10110235 3300031507 Bacteria 2759
316 Ga0307509_10447016 3300031507 Bacteria 987
317 Ga0265313_10223293 3300031595 Bacteria 776
318 Ga0307508_10000541 3300031616 Bacteria 44822
319 Ga0265342_10022338 3300031712 Bacteria 4024
320 Ga0265342_10296291 3300031712 Bacteria 853
321 Ga0307516_10304458 3300031730 Bacteria 1269
322 Ga0307516_10432612 3300031730 Bacteria 973
323 Ga0307406_10536420 3300031901 Bacteria 955
324 Ga0307415_100473888 3300032126 Bacteria 1088
325 Ga0307510_10022577 3300033180 Bacteria 7305
326 Ga0373923_0019959 3300035111 Bacteria 2599
327 Ga0373953_0019565 3300035117 Bacteria 2520
328 Ga0373954_0005528 3300035118 Bacteria 5468
329 Ga0373956_0001286 3300035119 Bacteria 10388
330 Ga0373957_0010442 3300035120 Bacteria 3070
331 Ga0373935_0470176 3300035692 Bacteria 910
332 Ga0373927_0020281 3300035695 Bacteria 4359
333 Ga0373933_0000127 3300035724 Bacteria 48988
334 Ga0373933_0069436 3300035724 Bacteria 2141
335 Ga0373937_0395804 3300036401 Bacteria 1310
336 Ga0395900_0193482 3300037418 Bacteria 2062
337 Ga0436365_0232459 3300039437 Bacteria 11864
338 Ga0436360_0744142 3300039438 Bacteria 883
339 Ga0436362_0394184 3300039453 Bacteria 3497
340 Ga0451795_0879068 3300041456 Bacteria 1363
341 Ga0451853_1159821 3300041512 Bacteria 2048
342 Ga0495617_016677 3300046452 Bacteria 2484
343 Ga0495592_0137784 3300046454 Bacteria 1700
344 Ga0495603_0093771 3300046455 Bacteria 1754
345 Ga0495603_0309882 3300046455 Bacteria 907
346 Ga0495590_0083461 3300046457 Bacteria 1126
347 Ga0495629_0028607 3300046459 Bacteria 3955
348 Ga0495638_0302337 3300046460 Bacteria 861
349 Ga0495653_0035922 3300046463 Bacteria 3907
350 Ga0495662_0043471 3300046476 Bacteria 2168
351 Ga0495584_0187205 3300046491 Bacteria 1052
352 Ga0495585_0163476 3300046492 Bacteria 1154
353 Ga0495585_0177032 3300046492 Bacteria 1098
354 Ga0495594_0120577 3300046499 Bacteria 1482
355 Ga0495594_0432389 3300046499 Bacteria 748
356 Ga0495606_0001556 3300046507 Bacteria 30139
357 Ga0495606_0232941 3300046507 Bacteria 1031
358 Ga0495608_0227136 3300046511 Bacteria 1169
359 Ga0495616_0110602 3300046513 Bacteria 1277
360 Ga0495618_0313149 3300046514 Bacteria 973
361 Ga0495620_0208744 3300046515 Bacteria 750
362 Ga0495628_0720666 3300046516 Bacteria 703
363 Ga0495643_0203305 3300046522 Bacteria 950
364 Ga0495644_0063819 3300046523 Bacteria 1384
365 Ga0495644_0118495 3300046523 Bacteria 1006
366 Ga0495652_0396262 3300046529 Bacteria 978
367 Ga0495587_0208262 3300046536 Bacteria 1104
368 Ga0495598_0022534 3300046537 Bacteria 1687
369 Ga0495609_0216045 3300046538 Bacteria 797
370 Ga0495621_0052538 3300046539 Bacteria 1461
371 Ga0495621_0260446 3300046539 Bacteria 710
372 Ga0495621_0296340 3300046539 Bacteria 669
373 Ga0495597_0176000 3300046542 Bacteria 867
374 Ga0495622_0176366 3300046557 Bacteria 960
375 Ga0495656_0113362 3300046615 Bacteria 1271
376 Ga0495668_0071118 3300046616 Bacteria 1912
377 Ga0495611_0199220 3300046648 Bacteria 934
378 Ga0495625_0165741 3300046660 Bacteria 1477
379 Ga0495635_0003655 3300046663 Bacteria 10669
380 Ga0495659_0067919 3300046664 Bacteria 1330
381 Ga0495588_0012237 3300046674 Bacteria 4049
382 Ga0495599_0004038 3300046678 Bacteria 8639
383 Ga0495623_0032867 3300046679 Bacteria 3332
384 Ga0495669_0004725 3300046684 Bacteria 5648
385 Ga0495670_0058844 3300046691 Bacteria 1929
386 Ga0495670_0337697 3300046691 Bacteria 810
387 Ga0495671_0207683 3300046692 Bacteria 949
388 Ga0495671_0270628 3300046692 Bacteria 819
389 Ga0495671_0347858 3300046692 Bacteria 711
390 Ga0495649_0240337 3300046694 Bacteria 933
391 Ga0495589_0210384 3300046794 Bacteria 916
392 Ga0495589_0309454 3300046794 Bacteria 731
393 Ga0495600_0232851 3300046809 Bacteria 1175
394 Ga0495636_0418261 3300047318 Bacteria 640
395 Ga0495674_0479834 3300047319 Bacteria 996
396 Ga0495672_0288550 3300047320 Bacteria 781
397 Ga0495676_0637705 3300047321 Bacteria 692
398 Ga0495680_0287397 3300047322 Bacteria 1157
399 Ga0495680_0515801 3300047322 Bacteria 809
400 Ga0495683_0061092 3300047323 Bacteria 1866
401 Ga0495683_0288584 3300047323 Bacteria 708
402 Ga0495675_0019629 3300047444 Bacteria 4293
403 Ga0495673_0248553 3300047469 Bacteria 650
404 Ga0495684_0009528 3300047471 Bacteria 7487
405 Ga0495593_0195022 3300047673 Bacteria 1018
406 Ga0496100_0155209 3300048903 Bacteria 1636
407 Ga0496101_0032337 3300048904 Bacteria 3682
408 Ga0496102_0010822 3300048905 Bacteria 7854
409 Ga0496104_0080689 3300048907 Bacteria 3102
410 Ga0496104_0171311 3300048907 Bacteria 2082
411 Ga0496104_0263075 3300048907 Bacteria 1637
412 Ga0496105_0281242 3300048908 Bacteria 1341
413 Ga0496105_0418019 3300048908 Bacteria 1062
414 Ga0496105_0752832 3300048908 Bacteria 744
415 Ga0496107_0021351 3300048910 Bacteria 4576
416 Ga0496108_0070106 3300048911 Bacteria 2958
417 Ga0496108_0999428 3300048911 Bacteria 714
418 Ga0496109_0381068 3300048912 Bacteria 1332
419 Ga0496110_0235335 3300048913 Bacteria 1666
420 Ga0496110_0423929 3300048913 Bacteria 1213
421 Ga0496110_0537080 3300048913 Bacteria 1063
422 Ga0496110_0678340 3300048913 Bacteria 931
423 Ga0496111_0012746 3300048914 Bacteria 5700
424 Ga0496111_0155533 3300048914 Bacteria 1697
425 Ga0496111_0308868 3300048914 Bacteria 1172
426 Ga0496111_0752501 3300048914 Bacteria 707
427 Ga0496112_0000054 3300048915 Bacteria 79516
428 Ga0496113_0022651 3300048916 Bacteria 4448
429 Ga0496113_0369102 3300048916 Bacteria 1152
430 Ga0496114_0593292 3300048917 Bacteria 977
431 Ga0496115_0006885 3300048918 Bacteria 8350
432 Ga0496115_0140467 3300048918 Bacteria 1993
433 Ga0496115_0247515 3300048918 Bacteria 1468
434 Ga0496115_0841314 3300048918 Bacteria 711
435 Ga0496119_0142271 3300048922 Bacteria 1294
436 Ga0496121_0003205 3300048924 Bacteria 23550
437 Ga0496121_0229746 3300048924 Bacteria 1300
438 Ga0496121_0327374 3300048924 Bacteria 1029
439 Ga0496121_0410728 3300048924 Bacteria 884
440 Ga0496124_0347646 3300048927 Bacteria 1050
441 Ga0496124_0749053 3300048927 Bacteria 612
442 Ga0496126_0012961 3300048929 Bacteria 8511
443 Ga0496126_0029121 3300048929 Bacteria 5249
444 Ga0496126_0029959 3300048929 Bacteria 5164
445 Ga0496126_0065580 3300048929 Bacteria 3249
446 Ga0496126_0374440 3300048929 Bacteria 1160
447 Ga0496126_0390558 3300048929 Bacteria 1131
448 Ga0496126_0563364 3300048929 Bacteria 902
449 nmdc:mga03683_134335_c1 3300050489 Bacteria 1109
450 nmdc:mga00v17_397106_c1 3300050491 Bacteria 896
451 nmdc:mga00v17_471163_c1 3300050491 Bacteria 815
452 nmdc:mga00v17_54226_c1 3300050491 Bacteria 2445
453 nmdc:mga0yw44_297277_c1 3300050492 Bacteria 1081
454 nmdc:mga0yw44_431319_c1 3300050492 Bacteria 893
455 nmdc:mga0yw44_467999_c1 3300050492 Bacteria 855
456 nmdc:mga0yw44_92377_c1 3300050492 Bacteria 1915
457 nmdc:mga0k408_234566_c1 3300050493 Bacteria 1095
458 nmdc:mga0k408_67307_c2 3300050493 Bacteria 1628
459 nmdc:mga06z11_12821_c1 3300050494 Bacteria 3657
460 nmdc:mga06z11_202759_c1 3300050494 Bacteria 1153
461 nmdc:mga04h51_63472_c1 3300050495 Bacteria 1272
462 nmdc:mga07m45_14722_c1 3300050496 Bacteria 4174
463 nmdc:mga05p37_120142_c1 3300050507 Bacteria 3228
464 nmdc:mga09592_237333_c1 3300050508 Bacteria 1579
465 nmdc:mga08y16_847046_c1 3300050511 Bacteria 904
466 nmdc:mga0n895_63276_c1 3300050512 Bacteria 3658
467 nmdc:mga0n895_714595_c1 3300050512 Bacteria 997
468 nmdc:mga0sz30_213531_c1 3300050516 Bacteria 857
469 nmdc:mga0sz30_28845_c1 3300050516 Bacteria 2285
470 Ga0495612_0143428 3300053078 Bacteria 1037
471 Ga0500635_0002719 3300053080 Bacteria 4389
472 Ga0495595_0001244 3300053084 Bacteria 9925
473 Ga0495619_0020514 3300053085 Bacteria 4210
474 Ga0500583_0153502 3300053092 Bacteria 1146
475 Ga0500651_0006448 3300053093 Bacteria 6769
476 Ga0500650_0173041 3300053098 Bacteria 992
477 Ga0500650_0203941 3300053098 Bacteria 900
478 Ga0500562_123071 3300053108 Bacteria 707
479 Ga0500595_000974 3300053119 Bacteria 16099
480 Ga0500658_0194967 3300053134 Bacteria 925
481 Ga0500658_0316721 3300053134 Bacteria 717
482 Ga0500568_0034806 3300053139 Bacteria 2059
483 Ga0500577_0148331 3300053142 Bacteria 993
484 Ga0500589_108394 3300053147 Bacteria 1195
485 Ga0500603_000343 3300053150 Bacteria 12160
486 Ga0500627_0126497 3300053158 Bacteria 1154
487 Ga0500634_0158798 3300053161 Bacteria 1046
488 Ga0500637_0263208 3300053178 Bacteria 957
489 Ga0500570_179757 3300053724 Bacteria 685
490 Ga0500609_019171 3300053731 Bacteria 932
491 2932801882 2932801729 Bacteria 7987968
492 2513697257 2513237101 Bacteria 7952346
493 2874606177 2874604998 Bacteria 7834745
494 2879115525 2879110137 Bacteria 8907982
495 2922389676 2922386360 Bacteria 7017218
496 8006999067 8006994254 Bacteria 8309700
497 JGI25153J46596_10001416
498 Ga0070658_10519053
499 Ga0070676_10033104
500 Ga0070683_100484063
501 Ga0070683_100713103
502 Ga0070670_100413440
503 Ga0070670_101012771
504 Ga0068869_100028973
505 Ga0068869_100147243
506 Ga0068869_100280985
507 Ga0068869_100622519
508 Ga0070680_100186521
509 Ga0070680_100303241
510 Ga0070682_100687879
511 Ga0068868_100637501
512 Ga0068868_100665212
513 Ga0070660_100068275
514 Ga0070660_100076622
515 Ga0070661_100219312
516 Ga0070661_100512146
517 Ga0070668_100035749
518 Ga0070668_100547945
519 Ga0070669_100459463
520 Ga0070675_101157150
521 Ga0070671_100105113
522 Ga0070671_100127417
523 Ga0070674_100060347
524 Ga0070674_100454645
525 Ga0070674_101202956
526 Ga0070659_101162719
527 Ga0070667_100150984
528 Ga0070709_10000542
529 Ga0070709_10192443
530 Ga0070713_100012220
531 Ga0070713_100105722
532 Ga0070713_101029227
533 Ga0070710_10076409
534 Ga0070701_10055938
535 Ga0070701_10350662
536 Ga0070711_100001693
537 Ga0070711_100102170
538 Ga0070700_100039031
539 Ga0070663_100018140
540 Ga0070663_100133980
541 Ga0070663_100256131
542 Ga0070663_100452336
543 Ga0070663_100573893
544 Ga0070663_100722103
545 Ga0070678_100043585
546 Ga0070662_100114783
547 Ga0070662_100129997
548 Ga0068867_100207547
549 Ga0068867_100879477
550 Ga0070706_101082647
551 Ga0070679_100415642
552 Ga0070684_100199039
553 Ga0068853_100538974
554 Ga0068853_100689534
555 Ga0068853_100863021
556 Ga0070672_100063202
557 Ga0070695_100308271
558 Ga0070693_100260269
559 Ga0070665_100002394
560 Ga0070665_100005213
561 Ga0070665_100159586
562 Ga0070665_100204222
563 Ga0070665_100311991
564 Ga0070665_100557035
565 Ga0068855_100026149
566 Ga0068855_100749346
567 Ga0068857_100507204
568 Ga0068856_100006229
569 Ga0068856_100023428
570 Ga0068856_101054806
571 Ga0070702_100083336
572 Ga0068852_100060857
573 Ga0068852_100205445
574 Ga0068859_100233103
575 Ga0068859_100306859
576 Ga0068859_101054025
577 Ga0068866_10109809
578 Ga0068861_100560651
579 Ga0068861_100585758
580 Ga0068851_10096941
581 Ga0068863_100277633
582 Ga0068858_100116128
583 Ga0068858_101084505
584 Ga0068860_100292318
585 Ga0068860_100579058
586 Ga0068862_100010352
587 Ga0068862_100026649
588 Ga0068862_100052503
589 Ga0068862_100565422
590 Ga0068862_101522768
591 Ga0081455_10025270
592 Ga0081540_1014734
593 Ga0081539_10009079
594 Ga0070717_10013721
595 Ga0070717_10198897
596 Ga0075365_10118488
597 Ga0075365_11028313
598 Ga0075368_10018742
599 Ga0075368_10056392
600 Ga0075363_100062994
601 Ga0075364_10074151
602 Ga0075364_10082233
603 Ga0075364_10736186
604 Ga0070715_10013984
605 Ga0070716_100014423
606 Ga0070716_100023117
607 Ga0070712_100015526
608 Ga0075362_10160442
609 Ga0075367_10071753
610 Ga0075367_10104051
611 Ga0075367_10109865
612 Ga0075367_10165459
613 Ga0075369_10039845
614 Ga0075369_10079874
615 Ga0075366_10105246
616 Ga0075366_10208086
617 Ga0097621_100374028
618 Ga0097621_100976316
619 Ga0075370_10175968
620 Ga0075428_100082832
621 Ga0075434_100127180
622 Ga0075434_100299752
623 Ga0075429_101261051
624 Ga0097620_100233131
625 Ga0097620_100306880
626 Ga0097620_101054073
627 Ga0099794_10057955
628 Ga0099794_10379802
629 Ga0099795_10050225
630 Ga0099795_10139487
631 Ga0099795_10224239
632 Ga0105250_10083447
633 Ga0105240_10689991
634 Ga0111539_10724559
635 Ga0111539_10958817
636 Ga0105245_10065056
637 Ga0105245_10297102
638 Ga0105247_10141071
639 Ga0114129_10100717
640 Ga0114129_11730380
641 Ga0105243_11461930
642 Ga0105241_10007922
643 Ga0105242_10034037
644 Ga0105248_10260333
645 Ga0105248_10690160
646 Ga0105237_10014182
647 Ga0105238_10337717
648 Ga0105238_11561636
649 Ga0105249_10016863
650 Ga0105249_10880967
651 Ga0099796_10176943
652 Ga0105239_10034860
653 Ga0105239_10361499
654 Ga0105239_10675310
655 Ga0105239_10736547
656 Ga0105246_10052887
657 Ga0105246_10181586
658 Ga0157369_10538357
659 Ga0157369_11341169
660 Ga0157374_10354625
661 Ga0157374_10935999
662 Ga0157378_10166800
663 Ga0163162_10024208
664 Ga0157372_10526179
665 Ga0157375_10079107
666 Ga0157375_10082021
667 Ga0157375_10567180
668 Ga0157375_11228539
669 Ga0163163_10183298
670 Ga0163163_11570733
671 Ga0157380_10228862
672 Ga0157377_10465898
673 Ga0157379_10162321
674 Ga0157379_10374646
675 Ga0157379_10970331
676 Ga0157379_11103501
677 Ga0157376_10288261
678 Ga0157376_10330412
679 Ga0157376_10791653
680 Ga0163161_10006317
681 Ga0206356_11862996
682 Ga0213876_10004130
683 Ga0209758_1009647
684 Ga0209758_1015925
685 Ga0207697_10043318
686 Ga0207692_10062873
687 Ga0207642_10068587
688 Ga0207642_10216125
689 Ga0207688_10124868
690 Ga0207688_10125717
691 Ga0207688_10359676
692 Ga0207680_10348532
693 Ga0207685_10015942
694 Ga0207699_10002461
695 Ga0207699_10019652
696 Ga0207699_10638382
697 Ga0207645_10038963
698 Ga0207643_10127261
699 Ga0207684_10200522
700 Ga0207684_10353363
701 Ga0207684_10753939
702 Ga0207654_10078232
703 Ga0207707_10020814
704 Ga0207671_10108395
705 Ga0207671_10174995
706 Ga0207693_10002055
707 Ga0207663_10006117
708 Ga0207663_10059054
709 Ga0207660_10132534
710 Ga0207660_10301600
711 Ga0207657_10021413
712 Ga0207657_10051937
713 Ga0207657_10530777
714 Ga0207649_10048682
715 Ga0207649_10466536
716 Ga0207652_10682511
717 Ga0207681_10857823
718 Ga0207694_10241210
719 Ga0207650_10088708
720 Ga0207650_10441494
721 Ga0207659_10327585
722 Ga0207659_10559135
723 Ga0207700_10029573
724 Ga0207700_10615368
725 Ga0207664_10102951
726 Ga0207664_10309366
727 Ga0207644_10097441
728 Ga0207644_10744767
729 Ga0207690_10251131
730 Ga0207690_10287283
731 Ga0207690_10382646
732 Ga0207706_10250593
733 Ga0207706_10260617
734 Ga0207709_10021512
735 Ga0207709_11055809
736 Ga0207669_10842236
737 Ga0207704_10197837
738 Ga0207665_10023354
739 Ga0207665_10023387
740 Ga0207665_10057894
741 Ga0207691_10053838
742 Ga0207691_10551719
743 Ga0207689_10015283
744 Ga0207689_10536492
745 Ga0207661_10100232
746 Ga0207679_10958774
747 Ga0207667_10047898
748 Ga0207667_10215761
749 Ga0207712_10616986
750 Ga0207668_10113387
751 Ga0207668_10132137
752 Ga0207668_10618283
753 Ga0207668_10643585
754 Ga0207658_10110404
755 Ga0207658_10802623
756 Ga0207677_10006386
757 Ga0207677_11052485
758 Ga0207703_10509784
759 Ga0207703_11030315
760 Ga0207639_10096552
761 Ga0207639_10142722
762 Ga0207678_10012752
763 Ga0207678_10066250
764 Ga0207678_10103696
765 Ga0207678_10113075
766 Ga0207678_10114338
767 Ga0207678_10505562
768 Ga0207702_10004851
769 Ga0207702_10712329
770 Ga0207702_11382906
771 Ga0207641_10936926
772 Ga0207648_10055076
773 Ga0207648_10899691
774 Ga0207676_10129395
775 Ga0207674_10201742
776 Ga0207674_10693422
777 Ga0207675_100027594
778 Ga0207675_100055763
779 Ga0207675_100083004
780 Ga0207675_100242837
781 Ga0207683_10005742
782 Ga0207683_10018090
783 Ga0207698_10179454
784 Ga0207698_10233214
785 Ga0207698_10501185
786 Ga0209588_1001521
787 Ga0209813_10055765
788 Ga0268266_10001169
789 Ga0268266_10002165
790 Ga0268266_10058190
791 Ga0268266_10330126
792 Ga0268265_10087215
793 Ga0268265_10380451
794 Ga0268265_10569866
795 Ga0268265_10823741
796 Ga0268264_10000458
797 Ga0268264_10281348
798 Ga0307515_10018157
799 Ga0307515_10153455
800 Ga0307515_10497586
801 Ga0307511_10117269
802 Ga0307512_10340563
803 Ga0265330_10097804
804 Ga0265330_10175112
805 Ga0265332_10013847
806 Ga0265339_10049967
807 Ga0265331_10032855
808 Ga0265331_10101047
809 Ga0265316_10142248
810 Ga0265316_10377138
811 Ga0307509_10110235
812 Ga0307509_10447016
813 Ga0265313_10223293
814 Ga0307508_10000541
815 Ga0265342_10022338
816 Ga0265342_10296291
817 Ga0307516_10304458
818 Ga0307516_10432612
819 Ga0307406_10536420
820 Ga0307415_100473888
821 Ga0307510_10022577
822 Ga0373923_0019959
823 Ga0373953_0019565
824 Ga0373954_0005528
825 Ga0373956_0001286
826 Ga0373957_0010442
827 Ga0373935_0470176
828 Ga0373927_0020281
829 Ga0373933_0000127
830 Ga0373933_0069436
831 Ga0373937_0395804
832 Ga0395900_0193482
833 Ga0436365_0232459
834 Ga0436360_0744142
835 Ga0436362_0394184
836 Ga0451795_0879068
837 Ga0451853_1159821
838 Ga0495617_016677
839 Ga0495592_0137784
840 Ga0495603_0093771
841 Ga0495603_0309882
842 Ga0495590_0083461
843 Ga0495629_0028607
844 Ga0495638_0302337
845 Ga0495653_0035922
846 Ga0495662_0043471
847 Ga0495584_0187205
848 Ga0495585_0163476
849 Ga0495585_0177032
850 Ga0495594_0120577
851 Ga0495594_0432389
852 Ga0495606_0001556
853 Ga0495606_0232941
854 Ga0495608_0227136
855 Ga0495616_0110602
856 Ga0495618_0313149
857 Ga0495620_0208744
858 Ga0495628_0720666
859 Ga0495643_0203305
860 Ga0495644_0063819
861 Ga0495644_0118495
862 Ga0495652_0396262
863 Ga0495587_0208262
864 Ga0495598_0022534
865 Ga0495609_0216045
866 Ga0495621_0052538
867 Ga0495621_0260446
868 Ga0495621_0296340
869 Ga0495597_0176000
870 Ga0495622_0176366
871 Ga0495656_0113362
872 Ga0495668_0071118
873 Ga0495611_0199220
874 Ga0495625_0165741
875 Ga0495635_0003655
876 Ga0495659_0067919
877 Ga0495588_0012237
878 Ga0495599_0004038
879 Ga0495623_0032867
880 Ga0495669_0004725
881 Ga0495670_0058844
882 Ga0495670_0337697
883 Ga0495671_0207683
884 Ga0495671_0270628
885 Ga0495671_0347858
886 Ga0495649_0240337
887 Ga0495589_0210384
888 Ga0495589_0309454
889 Ga0495600_0232851
890 Ga0495636_0418261
891 Ga0495674_0479834
892 Ga0495672_0288550
893 Ga0495676_0637705
894 Ga0495680_0287397
895 Ga0495680_0515801
896 Ga0495683_0061092
897 Ga0495683_0288584
898 Ga0495675_0019629
899 Ga0495673_0248553
900 Ga0495684_0009528
901 Ga0495593_0195022
902 Ga0496100_0155209
903 Ga0496101_0032337
904 Ga0496102_0010822
905 Ga0496104_0080689
906 Ga0496104_0171311
907 Ga0496104_0263075
908 Ga0496105_0281242
909 Ga0496105_0418019
910 Ga0496105_0752832
911 Ga0496107_0021351
912 Ga0496108_0070106
913 Ga0496108_0999428
914 Ga0496109_0381068
915 Ga0496110_0235335
916 Ga0496110_0423929
917 Ga0496110_0537080
918 Ga0496110_0678340
919 Ga0496111_0012746
920 Ga0496111_0155533
921 Ga0496111_0308868
922 Ga0496111_0752501
923 Ga0496112_0000054
924 Ga0496113_0022651
925 Ga0496113_0369102
926 Ga0496114_0593292
927 Ga0496115_0006885
928 Ga0496115_0140467
929 Ga0496115_0247515
930 Ga0496115_0841314
931 Ga0496119_0142271
932 Ga0496121_0003205
933 Ga0496121_0229746
934 Ga0496121_0327374
935 Ga0496121_0410728
936 Ga0496124_0347646
937 Ga0496124_0749053
938 Ga0496126_0012961
939 Ga0496126_0029121
940 Ga0496126_0029959
941 Ga0496126_0065580
942 Ga0496126_0374440
943 Ga0496126_0390558
944 Ga0496126_0563364
945 nmdc:mga03683_134335_c1
946 nmdc:mga00v17_397106_c1
947 nmdc:mga00v17_471163_c1
948 nmdc:mga00v17_54226_c1
949 nmdc:mga0yw44_297277_c1
950 nmdc:mga0yw44_431319_c1
951 nmdc:mga0yw44_467999_c1
952 nmdc:mga0yw44_92377_c1
953 nmdc:mga0k408_234566_c1
954 nmdc:mga0k408_67307_c2
955 nmdc:mga06z11_12821_c1
956 nmdc:mga06z11_202759_c1
957 nmdc:mga04h51_63472_c1
958 nmdc:mga07m45_14722_c1
959 nmdc:mga05p37_120142_c1
960 nmdc:mga09592_237333_c1
961 nmdc:mga08y16_847046_c1
962 nmdc:mga0n895_63276_c1
963 nmdc:mga0n895_714595_c1
964 nmdc:mga0sz30_213531_c1
965 nmdc:mga0sz30_28845_c1
966 Ga0495612_0143428
967 Ga0500635_0002719
968 Ga0495595_0001244
969 Ga0495619_0020514
970 Ga0500583_0153502
971 Ga0500651_0006448
972 Ga0500650_0173041
973 Ga0500650_0203941
974 Ga0500562_123071
975 Ga0500595_000974
976 Ga0500658_0194967
977 Ga0500658_0316721
978 Ga0500568_0034806
979 Ga0500577_0148331
980 Ga0500589_108394
981 Ga0500603_000343
982 Ga0500627_0126497
983 Ga0500634_0158798
984 Ga0500637_0263208
985 Ga0500570_179757
986 Ga0500609_019171
987 2932801882
988 2513697257
989 2874606177
990 2879115525
991 2922389676
992 8006999067

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2xb3-assembly1.cif.gz_A the structure of cyanobacterial psbp 0.6645 33 166
1v2b-assembly2.cif.gz_B crystal structure of psbp protein in the oxygen-evolving complex of photosystem ii from higher plants 0.6488 32 153
2p0c-assembly1.cif.gz_A catalytic domain of the proto-oncogene tyrosine-protein kinase mer 0.6469 96 136
7zas-assembly2.cif.gz_C-2 crystal structure of cleaved iripin-4 serpin from tick ixodes ricinus 0.6374 129 150
7ass-assembly2.cif.gz_D oxa-48_l67f_caz. what doesnt kill you makes you stronger: sub-mic selection drives cryptic evolution of oxa-48 0.6358 107 170
ID Description Score Start End Superfamily
2vlgB00 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.6858 117 147 3.30.450.20
2xb3A00 Alpha Beta;3-Layer(aba) Sandwich;Protein Transport Mog1p; Chain A;Mog1/PsbP, alpha/beta/alpha sandwich 0.6645 33 166 3.40.1000.10
af_A0A0P0XF80_79_240_3.40.1000.10 Alpha Beta;3-Layer(aba) Sandwich;Protein Transport Mog1p; Chain A;Mog1/PsbP, alpha/beta/alpha sandwich 0.6596 33 166 3.40.1000.10
af_Q8L5T9_35_144_3.10.450.10 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.6526 98 138 3.10.450.10
1v2bB00 Alpha Beta;3-Layer(aba) Sandwich;Protein Transport Mog1p; Chain A;Mog1/PsbP, alpha/beta/alpha sandwich 0.6488 32 153 3.40.1000.10
ID Description Score Start End GO Terms
AF-A0A1Q5RMR1-F1-model_v4 Uncharacterized protein 0.956 37 181
AF-A0A1Q5RMR1-F1-model_v4 Uncharacterized protein 0.9494 37 181
AF-A0A023XQW6-F1-model_v4 deleted 0.9449 68 181
AF-A0A537UU47-F1-model_v4 Uncharacterized protein 0.9379 33 174
AF-A0A023XQW6-F1-model_v4 deleted 0.9292 68 181

Map