F454948
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 496 | 266 | 496 | 157 |
Family's Representative Sequence
| Representative Sequence | 3300048914|Ga0496111_0148446|Ga0496111_0148446_1060_1533 |
| Length | 157 |
| Sequence | MSETIPREQSRADATAVRRLAYSDLPGVISIERRSFPAPWSLAMFVLELSKPSGICLAATSGDELLGYLVCSRYDQVWHLMNVAVSPDRRRRGVASGLIRHLLEETGRGGELPITLEVRVSNREAIAMYEGLGFRSAGVRPRYYQDNGEDALIMWLD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000532 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 3 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 4 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 5 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 26 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 30 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 35 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 36 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 37 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 38 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 39 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 40 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 41 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 42 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 43 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 44 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 45 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 46 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 47 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 48 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 49 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 50 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 54 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 55 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 78 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 125 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 129 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 130 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 131 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 132 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 133 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 134 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 135 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 136 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 137 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 138 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 139 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 140 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 141 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 142 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 143 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 144 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 145 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 146 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 147 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 148 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 149 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 150 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 151 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 152 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 153 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 154 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 155 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 156 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 157 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 158 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 159 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 160 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 161 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 162 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 219 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 220 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 221 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 222 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 223 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 224 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 225 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 226 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 227 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 228 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 229 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 230 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 231 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 232 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 233 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 234 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 235 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 236 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 237 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 238 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 239 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 240 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 241 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 242 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 254 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 255 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 258 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 262 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 263 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 264 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 265 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.8 |
| Metatranscriptomes | 0.2 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.41 |
| Nodule | 0 |
| Rhizoplane | 12.7 |
| Rhizosphere | 82.06 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.83 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | CNAas_1006915 | 3300000532 | Bacteria | 733 |
| 2 | JGI24746J21847_1000048 | 3300001977 | Bacteria | 11824 |
| 3 | JGI24034J26672_10010515 | 3300002239 | Bacteria | 1376 |
| 4 | JGI24742J22300_10019848 | 3300002244 | Bacteria | 1143 |
| 5 | JGI25406J46586_10046762 | 3300003203 | Bacteria | 1479 |
| 6 | Ga0070683_100019627 | 3300005329 | Bacteria | 6005 |
| 7 | Ga0070683_100053231 | 3300005329 | Bacteria | 3751 |
| 8 | Ga0070683_100106093 | 3300005329 | Bacteria | 2648 |
| 9 | Ga0070690_100118147 | 3300005330 | Bacteria | 1777 |
| 10 | Ga0070677_10000037 | 3300005333 | Bacteria | 40212 |
| 11 | Ga0070666_10069888 | 3300005335 | Bacteria | 2388 |
| 12 | Ga0070682_100000011 | 3300005337 | Bacteria | 266253 |
| 13 | Ga0070682_100000030 | 3300005337 | Bacteria | 182768 |
| 14 | Ga0068868_100002102 | 3300005338 | Bacteria | 13721 |
| 15 | Ga0070691_10000908 | 3300005341 | Bacteria | 12026 |
| 16 | Ga0070661_100000608 | 3300005344 | Bacteria | 26695 |
| 17 | Ga0070669_100451069 | 3300005353 | Bacteria | 1060 |
| 18 | Ga0070674_100000002 | 3300005356 | Bacteria | 271088 |
| 19 | Ga0070674_100000007 | 3300005356 | Bacteria | 145531 |
| 20 | Ga0070688_100000412 | 3300005365 | Bacteria | 21692 |
| 21 | Ga0070688_100022008 | 3300005365 | Bacteria | 3730 |
| 22 | Ga0070688_100303465 | 3300005365 | Bacteria | 1155 |
| 23 | Ga0070688_100672970 | 3300005365 | Bacteria | 799 |
| 24 | Ga0070659_100301183 | 3300005366 | Bacteria | 1337 |
| 25 | Ga0070667_100001123 | 3300005367 | Bacteria | 24412 |
| 26 | Ga0070714_100062407 | 3300005435 | Bacteria | 3203 |
| 27 | Ga0070714_100819408 | 3300005435 | Bacteria | 902 |
| 28 | Ga0070713_100096958 | 3300005436 | Bacteria | 2547 |
| 29 | Ga0070711_100001735 | 3300005439 | Bacteria | 12093 |
| 30 | Ga0070700_100094352 | 3300005441 | Bacteria | 1959 |
| 31 | Ga0070678_100383579 | 3300005456 | Bacteria | 1216 |
| 32 | Ga0070678_100794935 | 3300005456 | Bacteria | 859 |
| 33 | Ga0070662_100000002 | 3300005457 | Bacteria | 253208 |
| 34 | Ga0068867_100000204 | 3300005459 | Bacteria | 39518 |
| 35 | Ga0070685_10000013 | 3300005466 | Bacteria | 120875 |
| 36 | Ga0070685_10007592 | 3300005466 | Bacteria | 5547 |
| 37 | Ga0070685_10085369 | 3300005466 | Bacteria | 1901 |
| 38 | Ga0070679_100000181 | 3300005530 | Bacteria | 50834 |
| 39 | Ga0070684_100012567 | 3300005535 | Bacteria | 6792 |
| 40 | Ga0070684_100074570 | 3300005535 | Bacteria | 2991 |
| 41 | Ga0070684_100083172 | 3300005535 | Bacteria | 2835 |
| 42 | Ga0070684_100258796 | 3300005535 | Bacteria | 1592 |
| 43 | Ga0068853_100025258 | 3300005539 | Bacteria | 4985 |
| 44 | Ga0070672_100000083 | 3300005543 | Bacteria | 44812 |
| 45 | Ga0070686_100339038 | 3300005544 | Bacteria | 1126 |
| 46 | Ga0070693_100000987 | 3300005547 | Bacteria | 12667 |
| 47 | Ga0070665_100000040 | 3300005548 | Bacteria | 305480 |
| 48 | Ga0070665_100119714 | 3300005548 | Bacteria | 2635 |
| 49 | Ga0070665_100348798 | 3300005548 | Bacteria | 1485 |
| 50 | Ga0068855_100328389 | 3300005563 | Bacteria | 1689 |
| 51 | Ga0068855_100456808 | 3300005563 | Bacteria | 1393 |
| 52 | Ga0068857_100274783 | 3300005577 | Bacteria | 1549 |
| 53 | Ga0068854_100000363 | 3300005578 | Bacteria | 29001 |
| 54 | Ga0068854_100023409 | 3300005578 | Bacteria | 4219 |
| 55 | Ga0068856_100000237 | 3300005614 | Bacteria | 59854 |
| 56 | Ga0068856_100027399 | 3300005614 | Bacteria | 5559 |
| 57 | Ga0068852_100000002 | 3300005616 | Bacteria | 268221 |
| 58 | Ga0068852_100012193 | 3300005616 | Bacteria | 6514 |
| 59 | Ga0068852_101055372 | 3300005616 | Bacteria | 832 |
| 60 | Ga0068866_10000003 | 3300005718 | Bacteria | 281675 |
| 61 | Ga0068866_10001295 | 3300005718 | Bacteria | 10823 |
| 62 | Ga0068861_100246154 | 3300005719 | Bacteria | 1523 |
| 63 | Ga0068861_100342948 | 3300005719 | Bacteria | 1308 |
| 64 | Ga0068851_10004739 | 3300005834 | Bacteria | 6157 |
| 65 | Ga0068863_100001530 | 3300005841 | Bacteria | 22860 |
| 66 | Ga0068858_100000120 | 3300005842 | Bacteria | 81766 |
| 67 | Ga0068858_100006738 | 3300005842 | Bacteria | 11178 |
| 68 | Ga0068858_100083875 | 3300005842 | Bacteria | 2964 |
| 69 | Ga0068860_100056918 | 3300005843 | Bacteria | 3716 |
| 70 | Ga0068860_100057465 | 3300005843 | Bacteria | 3698 |
| 71 | Ga0068860_100956121 | 3300005843 | Bacteria | 874 |
| 72 | Ga0068862_100005726 | 3300005844 | Bacteria | 10368 |
| 73 | Ga0081455_10041414 | 3300005937 | Bacteria | 4050 |
| 74 | Ga0081538_10143624 | 3300005981 | Bacteria | 1095 |
| 75 | Ga0081540_1000123 | 3300005983 | Bacteria | 81914 |
| 76 | Ga0081540_1000639 | 3300005983 | Bacteria | 33299 |
| 77 | Ga0081540_1071063 | 3300005983 | Bacteria | 1609 |
| 78 | Ga0081540_1196929 | 3300005983 | Bacteria | 736 |
| 79 | Ga0081539_10004533 | 3300005985 | Bacteria | 15247 |
| 80 | Ga0081539_10136440 | 3300005985 | Bacteria | 1198 |
| 81 | Ga0081539_10166595 | 3300005985 | Bacteria | 1045 |
| 82 | Ga0070715_10000001 | 3300006163 | Bacteria | 693690 |
| 83 | Ga0070715_10110490 | 3300006163 | Bacteria | 1296 |
| 84 | Ga0070712_100004387 | 3300006175 | Bacteria | 8711 |
| 85 | Ga0097621_100651940 | 3300006237 | Bacteria | 966 |
| 86 | Ga0075433_10014316 | 3300006852 | Bacteria | 6479 |
| 87 | Ga0068865_100000134 | 3300006881 | Bacteria | 38568 |
| 88 | Ga0105240_10407549 | 3300009093 | Bacteria | 1530 |
| 89 | Ga0105240_10617969 | 3300009093 | Bacteria | 1191 |
| 90 | Ga0111539_10689128 | 3300009094 | Bacteria | 1189 |
| 91 | Ga0105245_10000026 | 3300009098 | Bacteria | 163660 |
| 92 | Ga0105245_10000143 | 3300009098 | Bacteria | 67618 |
| 93 | Ga0105245_10002179 | 3300009098 | Bacteria | 17745 |
| 94 | Ga0105245_10012210 | 3300009098 | Bacteria | 7471 |
| 95 | Ga0105245_10303667 | 3300009098 | Bacteria | 1567 |
| 96 | Ga0105247_10121750 | 3300009101 | Bacteria | 1691 |
| 97 | Ga0105243_10027253 | 3300009148 | Bacteria | 4376 |
| 98 | Ga0105243_10053227 | 3300009148 | Bacteria | 3210 |
| 99 | Ga0105241_10069970 | 3300009174 | Bacteria | 2722 |
| 100 | Ga0105242_10032261 | 3300009176 | Bacteria | 4188 |
| 101 | Ga0105242_10105713 | 3300009176 | Bacteria | 2391 |
| 102 | Ga0105248_10000020 | 3300009177 | Bacteria | 284637 |
| 103 | Ga0105248_10117972 | 3300009177 | Bacteria | 2993 |
| 104 | Ga0105238_10000009 | 3300009551 | Bacteria | 288729 |
| 105 | Ga0105249_10000070 | 3300009553 | Bacteria | 147277 |
| 106 | Ga0105249_10627246 | 3300009553 | Unclassified | 1131 |
| 107 | Ga0105249_11054213 | 3300009553 | Bacteria | 882 |
| 108 | Ga0105239_10476537 | 3300010375 | Bacteria | 1418 |
| 109 | Ga0105239_11092735 | 3300010375 | Bacteria | 918 |
| 110 | Ga0105246_11119237 | 3300011119 | Bacteria | 720 |
| 111 | Ga0157369_10000014 | 3300013105 | Bacteria | 266411 |
| 112 | Ga0157374_10013277 | 3300013296 | Bacteria | 7186 |
| 113 | Ga0157374_11972016 | 3300013296 | Bacteria | 610 |
| 114 | Ga0157378_10051353 | 3300013297 | Bacteria | 3669 |
| 115 | Ga0157378_10093267 | 3300013297 | Bacteria | 2741 |
| 116 | Ga0157378_11257173 | 3300013297 | Bacteria | 781 |
| 117 | Ga0163162_10325302 | 3300013306 | Bacteria | 1670 |
| 118 | Ga0157372_10000060 | 3300013307 | Bacteria | 122372 |
| 119 | Ga0157375_10003070 | 3300013308 | Bacteria | 14493 |
| 120 | Ga0157375_10004333 | 3300013308 | Bacteria | 12321 |
| 121 | Ga0157375_11241477 | 3300013308 | Bacteria | 875 |
| 122 | Ga0163163_10483151 | 3300014325 | Bacteria | 1300 |
| 123 | Ga0163163_11158041 | 3300014325 | Bacteria | 836 |
| 124 | Ga0157380_10023476 | 3300014326 | Bacteria | 4652 |
| 125 | Ga0157379_10033468 | 3300014968 | Bacteria | 4583 |
| 126 | Ga0157379_10058054 | 3300014968 | Bacteria | 3459 |
| 127 | Ga0157379_10105847 | 3300014968 | Bacteria | 2525 |
| 128 | Ga0163161_10021169 | 3300017792 | Bacteria | 4571 |
| 129 | Ga0163161_11708957 | 3300017792 | Bacteria | 558 |
| 130 | Ga0224712_10155727 | 3300022467 | Bacteria | 1016 |
| 131 | Ga0207656_10021074 | 3300025321 | Bacteria | 2599 |
| 132 | Ga0207656_10028797 | 3300025321 | Bacteria | 2283 |
| 133 | Ga0207682_10000018 | 3300025893 | Bacteria | 66215 |
| 134 | Ga0207642_10000002 | 3300025899 | Bacteria | 658166 |
| 135 | Ga0207642_10000634 | 3300025899 | Bacteria | 10772 |
| 136 | Ga0207710_10000997 | 3300025900 | Bacteria | 14813 |
| 137 | Ga0207680_10000567 | 3300025903 | Bacteria | 17482 |
| 138 | Ga0207685_10000005 | 3300025905 | Bacteria | 289944 |
| 139 | Ga0207654_10106053 | 3300025911 | Bacteria | 1739 |
| 140 | Ga0207695_10425791 | 3300025913 | Bacteria | 1211 |
| 141 | Ga0207695_10518784 | 3300025913 | Bacteria | 1073 |
| 142 | Ga0207693_10015036 | 3300025915 | Bacteria | 6213 |
| 143 | Ga0207663_10042943 | 3300025916 | Bacteria | 2765 |
| 144 | Ga0207663_10080051 | 3300025916 | Bacteria | 2135 |
| 145 | Ga0207649_10000003 | 3300025920 | Bacteria | 388908 |
| 146 | Ga0207652_10000371 | 3300025921 | Bacteria | 46723 |
| 147 | Ga0207681_10772865 | 3300025923 | Bacteria | 801 |
| 148 | Ga0207694_10000004 | 3300025924 | Bacteria | 967075 |
| 149 | Ga0207650_10182994 | 3300025925 | Bacteria | 1671 |
| 150 | Ga0207659_10000368 | 3300025926 | Bacteria | 27047 |
| 151 | Ga0207687_10000017 | 3300025927 | Bacteria | 237310 |
| 152 | Ga0207687_10000020 | 3300025927 | Bacteria | 228407 |
| 153 | Ga0207687_10001467 | 3300025927 | Bacteria | 16198 |
| 154 | Ga0207687_10010029 | 3300025927 | Bacteria | 6197 |
| 155 | Ga0207664_10229876 | 3300025929 | Bacteria | 1612 |
| 156 | Ga0207664_10995519 | 3300025929 | Bacteria | 751 |
| 157 | Ga0207690_10240805 | 3300025932 | Bacteria | 1393 |
| 158 | Ga0207706_10000001 | 3300025933 | Bacteria | 423014 |
| 159 | Ga0207686_10181970 | 3300025934 | Bacteria | 1491 |
| 160 | Ga0207709_10013906 | 3300025935 | Bacteria | 4443 |
| 161 | Ga0207709_10161357 | 3300025935 | Bacteria | 1564 |
| 162 | Ga0207670_10010569 | 3300025936 | Bacteria | 5325 |
| 163 | Ga0207670_10036018 | 3300025936 | Bacteria | 3215 |
| 164 | Ga0207669_10000001 | 3300025937 | Bacteria | 377747 |
| 165 | Ga0207669_10000003 | 3300025937 | Bacteria | 252239 |
| 166 | Ga0207704_10000110 | 3300025938 | Bacteria | 45277 |
| 167 | Ga0207665_10063868 | 3300025939 | Bacteria | 2501 |
| 168 | Ga0207691_10000641 | 3300025940 | Bacteria | 34560 |
| 169 | Ga0207711_10000006 | 3300025941 | Bacteria | 792692 |
| 170 | Ga0207661_10000867 | 3300025944 | Bacteria | 19843 |
| 171 | Ga0207661_10011021 | 3300025944 | Bacteria | 6533 |
| 172 | Ga0207661_10018898 | 3300025944 | Bacteria | 5129 |
| 173 | Ga0207661_10033030 | 3300025944 | Bacteria | 4014 |
| 174 | Ga0207661_11231173 | 3300025944 | Bacteria | 688 |
| 175 | Ga0207679_10327214 | 3300025945 | Bacteria | 1329 |
| 176 | Ga0207667_10456553 | 3300025949 | Bacteria | 1298 |
| 177 | Ga0207651_10037230 | 3300025960 | Bacteria | 3185 |
| 178 | Ga0207712_10000019 | 3300025961 | Bacteria | 317060 |
| 179 | Ga0207712_10026616 | 3300025961 | Bacteria | 3855 |
| 180 | Ga0207712_10395574 | 3300025961 | Unclassified | 1160 |
| 181 | Ga0207640_10000110 | 3300025981 | Bacteria | 61907 |
| 182 | Ga0207640_10005989 | 3300025981 | Bacteria | 6645 |
| 183 | Ga0207658_10000724 | 3300025986 | Bacteria | 28537 |
| 184 | Ga0207658_10182655 | 3300025986 | Bacteria | 1737 |
| 185 | Ga0207677_10000362 | 3300026023 | Bacteria | 31866 |
| 186 | Ga0207677_10004995 | 3300026023 | Bacteria | 7161 |
| 187 | Ga0207703_10000018 | 3300026035 | Bacteria | 271377 |
| 188 | Ga0207703_10000170 | 3300026035 | Bacteria | 75814 |
| 189 | Ga0207703_10233624 | 3300026035 | Bacteria | 1650 |
| 190 | Ga0207639_10007449 | 3300026041 | Bacteria | 7464 |
| 191 | Ga0207639_10087562 | 3300026041 | Bacteria | 2483 |
| 192 | Ga0207708_10127228 | 3300026075 | Bacteria | 1989 |
| 193 | Ga0207708_10130501 | 3300026075 | Bacteria | 1964 |
| 194 | Ga0207702_10000251 | 3300026078 | Bacteria | 62222 |
| 195 | Ga0207702_10007011 | 3300026078 | Bacteria | 9640 |
| 196 | Ga0207641_10000016 | 3300026088 | Bacteria | 307363 |
| 197 | Ga0207648_10000643 | 3300026089 | Bacteria | 39180 |
| 198 | Ga0207674_10280873 | 3300026116 | Bacteria | 1613 |
| 199 | Ga0207675_100445021 | 3300026118 | Bacteria | 1283 |
| 200 | Ga0207683_10031544 | 3300026121 | Bacteria | 4599 |
| 201 | Ga0207683_10412863 | 3300026121 | Bacteria | 1243 |
| 202 | Ga0207683_10432745 | 3300026121 | Bacteria | 1212 |
| 203 | Ga0207683_11744216 | 3300026121 | Bacteria | 572 |
| 204 | Ga0207698_10000004 | 3300026142 | Bacteria | 313614 |
| 205 | Ga0207698_10006867 | 3300026142 | Bacteria | 7121 |
| 206 | Ga0207428_10558653 | 3300027907 | Bacteria | 827 |
| 207 | Ga0268266_10000045 | 3300028379 | Bacteria | 312955 |
| 208 | Ga0268266_10111412 | 3300028379 | Bacteria | 2425 |
| 209 | Ga0268266_11201915 | 3300028379 | Bacteria | 733 |
| 210 | Ga0268265_10004189 | 3300028380 | Bacteria | 10094 |
| 211 | Ga0268264_10012280 | 3300028381 | Bacteria | 7049 |
| 212 | Ga0268264_10042357 | 3300028381 | Bacteria | 3769 |
| 213 | Ga0268264_10253874 | 3300028381 | Bacteria | 1635 |
| 214 | Ga0265337_1000034 | 3300028556 | Bacteria | 60151 |
| 215 | Ga0265326_10000041 | 3300028558 | Bacteria | 83872 |
| 216 | Ga0265318_10218035 | 3300028577 | Bacteria | 697 |
| 217 | Ga0265322_10000004 | 3300028654 | Bacteria | 275155 |
| 218 | Ga0265336_10014153 | 3300028666 | Bacteria | 2647 |
| 219 | Ga0265338_10158296 | 3300028800 | Bacteria | 1752 |
| 220 | Ga0265324_10237727 | 3300029957 | Bacteria | 618 |
| 221 | Ga0307511_10045873 | 3300030521 | Bacteria | 3605 |
| 222 | Ga0265328_10003370 | 3300031239 | Bacteria | 7064 |
| 223 | Ga0265320_10000029 | 3300031240 | Bacteria | 159627 |
| 224 | Ga0265329_10003419 | 3300031242 | Bacteria | 6923 |
| 225 | Ga0265339_10006278 | 3300031249 | Bacteria | 7813 |
| 226 | Ga0265331_10000526 | 3300031250 | Bacteria | 35306 |
| 227 | Ga0265327_10000015 | 3300031251 | Bacteria | 496677 |
| 228 | Ga0265316_10016243 | 3300031344 | Bacteria | 6463 |
| 229 | Ga0265313_10040058 | 3300031595 | Bacteria | 2319 |
| 230 | Ga0265314_10000119 | 3300031711 | Bacteria | 122334 |
| 231 | Ga0307405_10483394 | 3300031731 | Bacteria | 989 |
| 232 | Ga0307415_100003139 | 3300032126 | Bacteria | 8373 |
| 233 | Ga0373953_0123258 | 3300035117 | Bacteria | 1102 |
| 234 | Ga0373935_1056439 | 3300035692 | Bacteria | 604 |
| 235 | Ga0373937_0018727 | 3300036401 | Bacteria | 6188 |
| 236 | Ga0395900_0474103 | 3300037418 | Bacteria | 1205 |
| 237 | Ga0395900_0746971 | 3300037418 | Bacteria | 909 |
| 238 | Ga0395900_0908271 | 3300037418 | Bacteria | 804 |
| 239 | Ga0395900_1045810 | 3300037418 | Bacteria | 735 |
| 240 | Ga0395898_0195388 | 3300037466 | Bacteria | 1933 |
| 241 | Ga0395905_0515418 | 3300037471 | Bacteria | 1096 |
| 242 | Ga0395905_0912525 | 3300037471 | Bacteria | 781 |
| 243 | Ga0395905_1090058 | 3300037471 | Bacteria | 702 |
| 244 | Ga0436364_1035306 | 3300037853 | Bacteria | 1083 |
| 245 | Ga0395901_0180203 | 3300038443 | Bacteria | 2216 |
| 246 | Ga0395901_1355843 | 3300038443 | Bacteria | 671 |
| 247 | Ga0451807_0042816 | 3300041486 | Bacteria | 811 |
| 248 | Ga0451839_0200805 | 3300041496 | Bacteria | 904 |
| 249 | Ga0451845_0860192 | 3300041501 | Bacteria | 706 |
| 250 | Ga0451853_2679834 | 3300041512 | Bacteria | 9437 |
| 251 | Ga0451853_3964082 | 3300041512 | Bacteria | 902 |
| 252 | Ga0466963_0000043 | 3300044694 | Bacteria | 40976 |
| 253 | Ga0466963_0076444 | 3300044694 | Bacteria | 2261 |
| 254 | Ga0466963_0331809 | 3300044694 | Bacteria | 1071 |
| 255 | Ga0466963_0403703 | 3300044694 | Bacteria | 964 |
| 256 | Ga0466957_0000293 | 3300044842 | Bacteria | 24503 |
| 257 | Ga0466967_0000006 | 3300045976 | Bacteria | 144065 |
| 258 | Ga0466967_0268647 | 3300045976 | Bacteria | 1634 |
| 259 | Ga0495592_0158857 | 3300046454 | Bacteria | 1557 |
| 260 | Ga0495603_0000033 | 3300046455 | Bacteria | 57940 |
| 261 | Ga0495603_0000391 | 3300046455 | Bacteria | 24052 |
| 262 | Ga0495603_0007880 | 3300046455 | Bacteria | 6423 |
| 263 | Ga0495603_0204902 | 3300046455 | Bacteria | 1140 |
| 264 | Ga0495591_114202 | 3300046458 | Bacteria | 662 |
| 265 | Ga0495591_122506 | 3300046458 | Bacteria | 634 |
| 266 | Ga0495629_0001657 | 3300046459 | Bacteria | 17477 |
| 267 | Ga0495629_0010304 | 3300046459 | Bacteria | 6809 |
| 268 | Ga0495629_0031498 | 3300046459 | Bacteria | 3755 |
| 269 | Ga0495629_0092576 | 3300046459 | Bacteria | 2110 |
| 270 | Ga0495629_0218475 | 3300046459 | Bacteria | 1315 |
| 271 | Ga0495638_0015861 | 3300046460 | Bacteria | 5049 |
| 272 | Ga0495641_0000014 | 3300046461 | Bacteria | 140908 |
| 273 | Ga0495641_0022653 | 3300046461 | Bacteria | 3137 |
| 274 | Ga0495641_0170627 | 3300046461 | Bacteria | 973 |
| 275 | Ga0495651_0395099 | 3300046462 | Bacteria | 904 |
| 276 | Ga0495653_0015144 | 3300046463 | Bacteria | 6287 |
| 277 | Ga0495653_0058220 | 3300046463 | Bacteria | 2938 |
| 278 | Ga0495653_0299537 | 3300046463 | Bacteria | 1049 |
| 279 | Ga0495653_0571687 | 3300046463 | Bacteria | 697 |
| 280 | Ga0495653_0599176 | 3300046463 | Bacteria | 677 |
| 281 | Ga0495582_0000009 | 3300046473 | Bacteria | 123633 |
| 282 | Ga0495582_0738497 | 3300046473 | Bacteria | 570 |
| 283 | Ga0495662_0000001 | 3300046476 | Bacteria | 179185 |
| 284 | Ga0495662_0002954 | 3300046476 | Bacteria | 8583 |
| 285 | Ga0495662_0038877 | 3300046476 | Bacteria | 2299 |
| 286 | Ga0495662_0200633 | 3300046476 | Bacteria | 983 |
| 287 | Ga0495662_0381565 | 3300046476 | Bacteria | 692 |
| 288 | Ga0495594_0000006 | 3300046499 | Bacteria | 167901 |
| 289 | Ga0495594_0585896 | 3300046499 | Bacteria | 632 |
| 290 | Ga0495606_0000463 | 3300046507 | Bacteria | 66752 |
| 291 | Ga0495608_0000007 | 3300046511 | Bacteria | 313495 |
| 292 | Ga0495608_0000361 | 3300046511 | Bacteria | 31801 |
| 293 | Ga0495618_0000070 | 3300046514 | Bacteria | 72312 |
| 294 | Ga0495618_0253354 | 3300046514 | Bacteria | 1104 |
| 295 | Ga0495620_0000215 | 3300046515 | Bacteria | 43539 |
| 296 | Ga0495628_0008170 | 3300046516 | Bacteria | 9000 |
| 297 | Ga0495628_0072311 | 3300046516 | Bacteria | 2687 |
| 298 | Ga0495628_0197377 | 3300046516 | Bacteria | 1517 |
| 299 | Ga0495628_0240945 | 3300046516 | Bacteria | 1353 |
| 300 | Ga0495630_0000060 | 3300046517 | Bacteria | 90021 |
| 301 | Ga0495630_0002249 | 3300046517 | Bacteria | 13440 |
| 302 | Ga0495652_0000010 | 3300046529 | Bacteria | 261584 |
| 303 | Ga0495652_0007462 | 3300046529 | Bacteria | 10079 |
| 304 | Ga0495640_0024363 | 3300046533 | Bacteria | 4404 |
| 305 | Ga0495640_0031669 | 3300046533 | Bacteria | 3772 |
| 306 | Ga0495586_0081805 | 3300046535 | Bacteria | 1775 |
| 307 | Ga0495587_0308331 | 3300046536 | Bacteria | 885 |
| 308 | Ga0495587_0414600 | 3300046536 | Bacteria | 748 |
| 309 | Ga0495598_0004462 | 3300046537 | Bacteria | 3031 |
| 310 | Ga0495621_0002501 | 3300046539 | Bacteria | 4954 |
| 311 | Ga0495645_0031398 | 3300046543 | Bacteria | 3871 |
| 312 | Ga0495645_0045277 | 3300046543 | Bacteria | 3210 |
| 313 | Ga0495622_0000297 | 3300046557 | Bacteria | 37460 |
| 314 | Ga0495667_0000045 | 3300046559 | Bacteria | 118562 |
| 315 | Ga0495667_0037656 | 3300046559 | Bacteria | 3223 |
| 316 | Ga0495656_0001136 | 3300046615 | Bacteria | 8648 |
| 317 | Ga0495668_0024540 | 3300046616 | Bacteria | 3429 |
| 318 | Ga0495634_0000045 | 3300046642 | Bacteria | 99087 |
| 319 | Ga0495634_0001402 | 3300046642 | Bacteria | 21621 |
| 320 | Ga0495634_0028701 | 3300046642 | Bacteria | 3860 |
| 321 | Ga0495625_0000032 | 3300046660 | Bacteria | 233135 |
| 322 | Ga0495625_0288905 | 3300046660 | Bacteria | 1053 |
| 323 | Ga0495635_0000074 | 3300046663 | Bacteria | 62264 |
| 324 | Ga0495635_0093153 | 3300046663 | Bacteria | 2060 |
| 325 | Ga0495588_0001071 | 3300046674 | Bacteria | 11845 |
| 326 | Ga0495588_0169278 | 3300046674 | Bacteria | 1155 |
| 327 | Ga0495657_0000001 | 3300046675 | Bacteria | 445641 |
| 328 | Ga0495657_0004097 | 3300046675 | Bacteria | 11689 |
| 329 | Ga0495599_0047195 | 3300046678 | Bacteria | 2699 |
| 330 | Ga0495599_0208885 | 3300046678 | Bacteria | 1198 |
| 331 | Ga0495623_0385519 | 3300046679 | Bacteria | 757 |
| 332 | Ga0495647_0000023 | 3300046681 | Bacteria | 67025 |
| 333 | Ga0495647_0000063 | 3300046681 | Bacteria | 26932 |
| 334 | Ga0495647_0013099 | 3300046681 | Bacteria | 2867 |
| 335 | Ga0495658_0000002 | 3300046683 | Bacteria | 309651 |
| 336 | Ga0495658_0005120 | 3300046683 | Bacteria | 6446 |
| 337 | Ga0495658_0233517 | 3300046683 | Bacteria | 1154 |
| 338 | Ga0495658_0494867 | 3300046683 | Unclassified | 782 |
| 339 | Ga0495669_0000261 | 3300046684 | Bacteria | 30497 |
| 340 | Ga0495669_0165031 | 3300046684 | Bacteria | 1052 |
| 341 | Ga0495613_0000032 | 3300046689 | Bacteria | 139806 |
| 342 | Ga0495613_0000220 | 3300046689 | Bacteria | 55692 |
| 343 | Ga0495613_0130334 | 3300046689 | Bacteria | 1801 |
| 344 | Ga0495613_0467384 | 3300046689 | Bacteria | 853 |
| 345 | Ga0495624_0000071 | 3300046690 | Bacteria | 65995 |
| 346 | Ga0495624_0000243 | 3300046690 | Bacteria | 42818 |
| 347 | Ga0495624_0115319 | 3300046690 | Bacteria | 1651 |
| 348 | Ga0495670_0017664 | 3300046691 | Bacteria | 3513 |
| 349 | Ga0495649_0003945 | 3300046694 | Bacteria | 9799 |
| 350 | Ga0495600_0003218 | 3300046809 | Bacteria | 9555 |
| 351 | Ga0495600_0063488 | 3300046809 | Bacteria | 2413 |
| 352 | Ga0495600_0193856 | 3300046809 | Bacteria | 1306 |
| 353 | Ga0495604_0000927 | 3300047317 | Bacteria | 24398 |
| 354 | Ga0495604_0001215 | 3300047317 | Bacteria | 21186 |
| 355 | Ga0495674_0000010 | 3300047319 | Bacteria | 285794 |
| 356 | Ga0495676_0000136 | 3300047321 | Bacteria | 55706 |
| 357 | Ga0495676_0005715 | 3300047321 | Bacteria | 11405 |
| 358 | Ga0495676_0014346 | 3300047321 | Bacteria | 7091 |
| 359 | Ga0495680_0000472 | 3300047322 | Bacteria | 45335 |
| 360 | Ga0495680_0000486 | 3300047322 | Bacteria | 44707 |
| 361 | Ga0495680_0058909 | 3300047322 | Bacteria | 2966 |
| 362 | Ga0495680_0066060 | 3300047322 | Bacteria | 2769 |
| 363 | Ga0495680_0116046 | 3300047322 | Bacteria | 1980 |
| 364 | Ga0495680_0489018 | 3300047322 | Bacteria | 837 |
| 365 | Ga0495675_0000017 | 3300047444 | Bacteria | 123394 |
| 366 | Ga0495675_0115419 | 3300047444 | Bacteria | 1674 |
| 367 | Ga0495677_0091269 | 3300047445 | Bacteria | 1148 |
| 368 | Ga0495679_019804 | 3300047446 | Bacteria | 2356 |
| 369 | Ga0495685_004050 | 3300047447 | Bacteria | 4714 |
| 370 | Ga0495684_0085096 | 3300047471 | Bacteria | 2398 |
| 371 | Ga0495686_0066193 | 3300047472 | Bacteria | 2233 |
| 372 | Ga0495593_0137049 | 3300047673 | Bacteria | 1240 |
| 373 | Ga0495602_0000007 | 3300048088 | Bacteria | 273212 |
| 374 | Ga0495602_0003667 | 3300048088 | Bacteria | 15918 |
| 375 | Ga0495602_0031280 | 3300048088 | Bacteria | 5035 |
| 376 | Ga0495602_0196575 | 3300048088 | Bacteria | 1542 |
| 377 | Ga0495602_0315934 | 3300048088 | Unclassified | 1138 |
| 378 | Ga0495614_0187051 | 3300048089 | Bacteria | 933 |
| 379 | Ga0496100_0000001 | 3300048903 | Bacteria | 530179 |
| 380 | Ga0496100_0000014 | 3300048903 | Bacteria | 174991 |
| 381 | Ga0496100_0936473 | 3300048903 | Bacteria | 681 |
| 382 | Ga0496101_0000004 | 3300048904 | Bacteria | 331599 |
| 383 | Ga0496101_0000036 | 3300048904 | Bacteria | 175595 |
| 384 | Ga0496101_1204545 | 3300048904 | Bacteria | 593 |
| 385 | Ga0496102_0976081 | 3300048905 | Bacteria | 768 |
| 386 | Ga0496103_0000057 | 3300048906 | Bacteria | 142223 |
| 387 | Ga0496104_0000015 | 3300048907 | Bacteria | 374530 |
| 388 | Ga0496104_0000024 | 3300048907 | Bacteria | 229913 |
| 389 | Ga0496104_0000866 | 3300048907 | Bacteria | 26077 |
| 390 | Ga0496104_0038236 | 3300048907 | Bacteria | 4490 |
| 391 | Ga0496105_0000004 | 3300048908 | Bacteria | 475798 |
| 392 | Ga0496105_0000013 | 3300048908 | Bacteria | 229894 |
| 393 | Ga0496105_0000059 | 3300048908 | Bacteria | 86884 |
| 394 | Ga0496105_0034930 | 3300048908 | Bacteria | 4137 |
| 395 | Ga0496105_0748067 | 3300048908 | Bacteria | 747 |
| 396 | Ga0496106_0000091 | 3300048909 | Bacteria | 71361 |
| 397 | Ga0496106_0000111 | 3300048909 | Bacteria | 63431 |
| 398 | Ga0496106_0000795 | 3300048909 | Bacteria | 22795 |
| 399 | Ga0496106_0126652 | 3300048909 | Bacteria | 2000 |
| 400 | Ga0496107_0000005 | 3300048910 | Bacteria | 281747 |
| 401 | Ga0496107_0000022 | 3300048910 | Bacteria | 128991 |
| 402 | Ga0496107_0012674 | 3300048910 | Bacteria | 5887 |
| 403 | Ga0496108_0000006 | 3300048911 | Bacteria | 469473 |
| 404 | Ga0496108_0000026 | 3300048911 | Bacteria | 172399 |
| 405 | Ga0496108_0001422 | 3300048911 | Bacteria | 18875 |
| 406 | Ga0496108_0009264 | 3300048911 | Bacteria | 7966 |
| 407 | Ga0496108_1051529 | 3300048911 | Bacteria | 693 |
| 408 | Ga0496109_0000004 | 3300048912 | Bacteria | 404818 |
| 409 | Ga0496109_0000012 | 3300048912 | Bacteria | 229699 |
| 410 | Ga0496109_0000056 | 3300048912 | Bacteria | 120835 |
| 411 | Ga0496109_0001040 | 3300048912 | Bacteria | 22963 |
| 412 | Ga0496109_0175020 | 3300048912 | Bacteria | 2014 |
| 413 | Ga0496109_0415697 | 3300048912 | Bacteria | 1271 |
| 414 | Ga0496109_0642730 | 3300048912 | Bacteria | 998 |
| 415 | Ga0496110_0000750 | 3300048913 | Bacteria | 22419 |
| 416 | Ga0496110_0013308 | 3300048913 | Bacteria | 6797 |
| 417 | Ga0496110_0072871 | 3300048913 | Bacteria | 3048 |
| 418 | Ga0496110_0282282 | 3300048913 | Bacteria | 1512 |
| 419 | Ga0496111_0000047 | 3300048914 | Bacteria | 47782 |
| 420 | Ga0496111_0050802 | 3300048914 | Bacteria | 2992 |
| 421 | Ga0496111_0148446 | 3300048914 | Bacteria | 1739 |
| 422 | Ga0496111_0252334 | 3300048914 | Bacteria | 1309 |
| 423 | Ga0496111_0269293 | 3300048914 | Bacteria | 1264 |
| 424 | Ga0496112_0000006 | 3300048915 | Bacteria | 365227 |
| 425 | Ga0496112_0000566 | 3300048915 | Bacteria | 25425 |
| 426 | Ga0496112_0213911 | 3300048915 | Bacteria | 1884 |
| 427 | Ga0496112_0402977 | 3300048915 | Bacteria | 1308 |
| 428 | Ga0496112_0413934 | 3300048915 | Bacteria | 1287 |
| 429 | Ga0496113_0000037 | 3300048916 | Bacteria | 56610 |
| 430 | Ga0496113_0003344 | 3300048916 | Bacteria | 9576 |
| 431 | Ga0496113_0035042 | 3300048916 | Bacteria | 3667 |
| 432 | Ga0496113_0090841 | 3300048916 | Bacteria | 2353 |
| 433 | Ga0496113_0183897 | 3300048916 | Bacteria | 1657 |
| 434 | Ga0496113_0191710 | 3300048916 | Bacteria | 1622 |
| 435 | Ga0496113_0910694 | 3300048916 | Bacteria | 695 |
| 436 | Ga0496113_0935808 | 3300048916 | Bacteria | 684 |
| 437 | Ga0496114_0012163 | 3300048917 | Bacteria | 6887 |
| 438 | Ga0496114_0374111 | 3300048917 | Bacteria | 1261 |
| 439 | Ga0496115_0000525 | 3300048918 | Bacteria | 29761 |
| 440 | Ga0496115_0030753 | 3300048918 | Bacteria | 4226 |
| 441 | Ga0496117_0077842 | 3300048920 | Bacteria | 2192 |
| 442 | Ga0496117_0191134 | 3300048920 | Bacteria | 1166 |
| 443 | Ga0496117_0413237 | 3300048920 | Bacteria | 677 |
| 444 | Ga0496118_0228412 | 3300048921 | Bacteria | 1076 |
| 445 | Ga0496118_0317397 | 3300048921 | Bacteria | 847 |
| 446 | Ga0496119_0062828 | 3300048922 | Bacteria | 2211 |
| 447 | Ga0496120_0263833 | 3300048923 | Bacteria | 803 |
| 448 | Ga0496121_0008006 | 3300048924 | Bacteria | 12613 |
| 449 | Ga0496124_0108892 | 3300048927 | Bacteria | 2234 |
| 450 | Ga0496124_0518313 | 3300048927 | Bacteria | 795 |
| 451 | Ga0496125_0048312 | 3300048928 | Bacteria | 3550 |
| 452 | Ga0496125_0282058 | 3300048928 | Bacteria | 1028 |
| 453 | Ga0496126_0030735 | 3300048929 | Bacteria | 5085 |
| 454 | Ga0501032_0217894 | 3300049569 | Bacteria | 1243 |
| 455 | Ga0501042_0030117 | 3300049578 | Bacteria | 3832 |
| 456 | Ga0501042_0074672 | 3300049578 | Bacteria | 2426 |
| 457 | Ga0501042_0258254 | 3300049578 | Bacteria | 1258 |
| 458 | Ga0501047_0346569 | 3300049581 | Bacteria | 1322 |
| 459 | Ga0501068_0049638 | 3300049584 | Bacteria | 2535 |
| 460 | Ga0501068_0203026 | 3300049584 | Bacteria | 1257 |
| 461 | Ga0501070_0009917 | 3300049586 | Bacteria | 8052 |
| 462 | Ga0501070_0169220 | 3300049586 | Bacteria | 1800 |
| 463 | Ga0501070_0319069 | 3300049586 | Bacteria | 1264 |
| 464 | Ga0501071_0864780 | 3300049587 | Bacteria | 697 |
| 465 | Ga0501075_0000699 | 3300049591 | Bacteria | 20775 |
| 466 | Ga0501079_0773403 | 3300049741 | Bacteria | 756 |
| 467 | Ga0501079_1201216 | 3300049741 | Bacteria | 597 |
| 468 | Ga0501083_0029279 | 3300049744 | Bacteria | 3789 |
| 469 | Ga0501044_1058016 | 3300049823 | Bacteria | 682 |
| 470 | Ga0501045_0695196 | 3300049824 | Bacteria | 751 |
| 471 | nmdc:mga00v17_523835_c1 | 3300050491 | Bacteria | 767 |
| 472 | nmdc:mga08y16_1159395_c1 | 3300050511 | Bacteria | 745 |
| 473 | nmdc:mga0a205_13_c1 | 3300050515 | Bacteria | 111131 |
| 474 | nmdc:mga0a205_337_c1 | 3300050515 | Bacteria | 35228 |
| 475 | nmdc:mga0a205_869642_c1 | 3300050515 | Bacteria | 748 |
| 476 | Ga0495601_0000099 | 3300053077 | Bacteria | 47704 |
| 477 | Ga0495601_0000887 | 3300053077 | Bacteria | 16319 |
| 478 | Ga0495601_0059700 | 3300053077 | Bacteria | 2419 |
| 479 | Ga0495601_0469564 | 3300053077 | Bacteria | 813 |
| 480 | Ga0500635_0272434 | 3300053080 | Bacteria | 666 |
| 481 | Ga0495655_0000005 | 3300053083 | Bacteria | 257472 |
| 482 | Ga0495655_0000547 | 3300053083 | Bacteria | 6176 |
| 483 | Ga0495595_0000002 | 3300053084 | Bacteria | 445641 |
| 484 | Ga0495595_0001245 | 3300053084 | Bacteria | 9923 |
| 485 | Ga0495619_0000008 | 3300053085 | Bacteria | 305999 |
| 486 | Ga0495619_0000082 | 3300053085 | Bacteria | 71788 |
| 487 | Ga0495619_0000183 | 3300053085 | Bacteria | 46388 |
| 488 | Ga0495619_0000376 | 3300053085 | Bacteria | 30790 |
| 489 | Ga0495619_0006399 | 3300053085 | Bacteria | 7463 |
| 490 | Ga0500566_0005771 | 3300053094 | Bacteria | 7354 |
| 491 | Ga0500566_0084297 | 3300053094 | Bacteria | 1764 |
| 492 | Ga0500595_029677 | 3300053119 | Bacteria | 1853 |
| 493 | Ga0500614_000077 | 3300053123 | Bacteria | 21548 |
| 494 | Ga0500628_000001 | 3300053129 | Bacteria | 564074 |
| 495 | Ga0501084_0954844 | 3300054114 | Bacteria | 721 |
| 496 | Ga0501082_0380888 | 3300060353 | Bacteria | 1231 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049823 | Ga0501044_1058016 | Ga0501044_1058016_235_669 | 128 |
| 2 | 3300009094 | Ga0111539_10689128 | Ga0111539_106891282 | 141 |
| 3 | 3300046459 | Ga0495629_0010304 | Ga0495629_0010304_3902_4327 | 141 |
| 4 | 3300048909 | Ga0496106_0126652 | Ga0496106_0126652_1279_1728 | 141 |
| 5 | 3300048918 | Ga0496115_0030753 | Ga0496115_0030753_3403_3828 | 141 |
| 6 | 3300049587 | Ga0501071_0864780 | Ga0501071_0864780_38_463 | 141 |
| 7 | 3300049824 | Ga0501045_0695196 | Ga0501045_0695196_194_619 | 141 |
| 8 | 3300050511 | nmdc:mga08y16_1159395_c1 | nmdc:mga08y16_1159395_c1_224_670 | 141 |
| 9 | 3300050515 | nmdc:mga0a205_869642_c1 | nmdc:mga0a205_869642_c1_141_587 | 141 |
| 10 | 3300053085 | Ga0495619_0006399 | Ga0495619_0006399_6226_6651 | 141 |
| 11 | 3300005985 | Ga0081539_10166595 | Ga0081539_101665952 | 142 |
| 12 | 3300046684 | Ga0495669_0165031 | Ga0495669_0165031_540_974 | 142 |
| 13 | 3300048914 | Ga0496111_0269293 | Ga0496111_0269293_610_1044 | 142 |
| 14 | 3300048916 | Ga0496113_0935808 | Ga0496113_0935808_76_510 | 142 |
| 15 | 3300046459 | Ga0495629_0092576 | Ga0495629_0092576_1469_1906 | 143 |
| 16 | 3300046514 | Ga0495618_0253354 | Ga0495618_0253354_176_613 | 143 |
| 17 | 3300046529 | Ga0495652_0007462 | Ga0495652_0007462_4970_5407 | 143 |
| 18 | 3300046543 | Ga0495645_0031398 | Ga0495645_0031398_760_1197 | 143 |
| 19 | 3300046642 | Ga0495634_0001402 | Ga0495634_0001402_18372_18809 | 143 |
| 20 | 3300005983 | Ga0081540_1000123 | Ga0081540_10001233 | 144 |
| 21 | 3300046539 | Ga0495621_0002501 | Ga0495621_0002501_3966_4400 | 144 |
| 22 | 3300048916 | Ga0496113_0003344 | Ga0496113_0003344_3200_3634 | 144 |
| 23 | 3300009148 | Ga0105243_10027253 | Ga0105243_100272537 | 145 |
| 24 | 3300013296 | Ga0157374_10013277 | Ga0157374_100132772 | 145 |
| 25 | 3300013297 | Ga0157378_10051353 | Ga0157378_100513534 | 145 |
| 26 | 3300013308 | Ga0157375_10003070 | Ga0157375_100030705 | 145 |
| 27 | 3300013308 | Ga0157375_10004333 | Ga0157375_100043338 | 145 |
| 28 | 3300014325 | Ga0163163_11158041 | Ga0163163_111580411 | 145 |
| 29 | 3300025916 | Ga0207663_10080051 | Ga0207663_100800513 | 145 |
| 30 | 3300037853 | Ga0436364_1035306 | Ga0436364_1035306_508_981 | 145 |
| 31 | 3300046454 | Ga0495592_0158857 | Ga0495592_0158857_480_917 | 145 |
| 32 | 3300046455 | Ga0495603_0000033 | Ga0495603_0000033_10846_11283 | 145 |
| 33 | 3300046458 | Ga0495591_114202 | Ga0495591_114202_155_592 | 145 |
| 34 | 3300046459 | Ga0495629_0031498 | Ga0495629_0031498_2609_3046 | 145 |
| 35 | 3300046459 | Ga0495629_0218475 | Ga0495629_0218475_505_942 | 145 |
| 36 | 3300046463 | Ga0495653_0058220 | Ga0495653_0058220_1789_2226 | 145 |
| 37 | 3300046463 | Ga0495653_0571687 | Ga0495653_0571687_232_669 | 145 |
| 38 | 3300046514 | Ga0495618_0000070 | Ga0495618_0000070_57050_57487 | 145 |
| 39 | 3300046535 | Ga0495586_0081805 | Ga0495586_0081805_588_1025 | 145 |
| 40 | 3300046559 | Ga0495667_0000045 | Ga0495667_0000045_82892_83329 | 145 |
| 41 | 3300046642 | Ga0495634_0000045 | Ga0495634_0000045_37054_37491 | 145 |
| 42 | 3300046674 | Ga0495588_0169278 | Ga0495588_0169278_374_811 | 145 |
| 43 | 3300046681 | Ga0495647_0000023 | Ga0495647_0000023_4968_5405 | 145 |
| 44 | 3300046689 | Ga0495613_0000220 | Ga0495613_0000220_39919_40356 | 145 |
| 45 | 3300046690 | Ga0495624_0000071 | Ga0495624_0000071_53403_53840 | 145 |
| 46 | 3300046809 | Ga0495600_0063488 | Ga0495600_0063488_545_982 | 145 |
| 47 | 3300047322 | Ga0495680_0058909 | Ga0495680_0058909_1626_2063 | 145 |
| 48 | 3300047322 | Ga0495680_0066060 | Ga0495680_0066060_1987_2424 | 145 |
| 49 | 3300047471 | Ga0495684_0085096 | Ga0495684_0085096_983_1420 | 145 |
| 50 | 3300048088 | Ga0495602_0031280 | Ga0495602_0031280_1134_1571 | 145 |
| 51 | 3300048907 | Ga0496104_0000015 | Ga0496104_0000015_75110_75547 | 145 |
| 52 | 3300048908 | Ga0496105_0034930 | Ga0496105_0034930_11_448 | 145 |
| 53 | 3300048911 | Ga0496108_0009264 | Ga0496108_0009264_1304_1741 | 145 |
| 54 | 3300048912 | Ga0496109_0175020 | Ga0496109_0175020_1452_1889 | 145 |
| 55 | 3300048915 | Ga0496112_0000006 | Ga0496112_0000006_99629_100066 | 145 |
| 56 | 3300048916 | Ga0496113_0191710 | Ga0496113_0191710_1060_1497 | 145 |
| 57 | 3300049584 | Ga0501068_0049638 | Ga0501068_0049638_1355_1792 | 145 |
| 58 | 3300053085 | Ga0495619_0000008 | Ga0495619_0000008_44442_44879 | 145 |
| 59 | 3300009101 | Ga0105247_10121750 | Ga0105247_101217502 | 148 |
| 60 | 3300049581 | Ga0501047_0346569 | Ga0501047_0346569_305_802 | 148 |
| 61 | 3300005544 | Ga0070686_100339038 | Ga0070686_1003390382 | 152 |
| 62 | 3300005981 | Ga0081538_10143624 | Ga0081538_101436242 | 152 |
| 63 | 3300005983 | Ga0081540_1000639 | Ga0081540_100063932 | 152 |
| 64 | 3300005983 | Ga0081540_1196929 | Ga0081540_11969292 | 152 |
| 65 | 3300005985 | Ga0081539_10136440 | Ga0081539_101364402 | 152 |
| 66 | 3300009098 | Ga0105245_10303667 | Ga0105245_103036672 | 152 |
| 67 | 3300010375 | Ga0105239_11092735 | Ga0105239_110927351 | 152 |
| 68 | 3300014325 | Ga0163163_10483151 | Ga0163163_104831512 | 152 |
| 69 | 3300014326 | Ga0157380_10023476 | Ga0157380_100234765 | 152 |
| 70 | 3300026121 | Ga0207683_11744216 | Ga0207683_117442161 | 152 |
| 71 | 3300037418 | Ga0395900_0474103 | Ga0395900_0474103_21_527 | 152 |
| 72 | 3300037418 | Ga0395900_0746971 | Ga0395900_0746971_274_780 | 152 |
| 73 | 3300037418 | Ga0395900_0908271 | Ga0395900_0908271_33_539 | 152 |
| 74 | 3300037418 | Ga0395900_1045810 | Ga0395900_1045810_157_648 | 152 |
| 75 | 3300037466 | Ga0395898_0195388 | Ga0395898_0195388_625_1131 | 152 |
| 76 | 3300037471 | Ga0395905_0515418 | Ga0395905_0515418_304_810 | 152 |
| 77 | 3300037471 | Ga0395905_0912525 | Ga0395905_0912525_232_723 | 152 |
| 78 | 3300037471 | Ga0395905_1090058 | Ga0395905_1090058_98_604 | 152 |
| 79 | 3300038443 | Ga0395901_0180203 | Ga0395901_0180203_485_976 | 152 |
| 80 | 3300038443 | Ga0395901_1355843 | Ga0395901_1355843_81_587 | 152 |
| 81 | 3300046458 | Ga0495591_122506 | Ga0495591_122506_51_551 | 152 |
| 82 | 3300046616 | Ga0495668_0024540 | Ga0495668_0024540_1090_1548 | 152 |
| 83 | 3300046681 | Ga0495647_0013099 | Ga0495647_0013099_746_1204 | 152 |
| 84 | 3300046683 | Ga0495658_0233517 | Ga0495658_0233517_412_918 | 152 |
| 85 | 3300047445 | Ga0495677_0091269 | Ga0495677_0091269_471_977 | 152 |
| 86 | 3300048903 | Ga0496100_0936473 | Ga0496100_0936473_173_664 | 152 |
| 87 | 3300048915 | Ga0496112_0413934 | Ga0496112_0413934_598_1089 | 152 |
| 88 | 3300048916 | Ga0496113_0183897 | Ga0496113_0183897_63_554 | 152 |
| 89 | 3300050491 | nmdc:mga00v17_523835_c1 | nmdc:mga00v17_523835_c1_162_668 | 152 |
| 90 | 3300005842 | Ga0068858_100083875 | Ga0068858_1000838753 | 153 |
| 91 | 3300025944 | Ga0207661_11231173 | Ga0207661_112311731 | 153 |
| 92 | 3300026035 | Ga0207703_10233624 | Ga0207703_102336243 | 153 |
| 93 | 3300046476 | Ga0495662_0038877 | Ga0495662_0038877_1202_1669 | 153 |
| 94 | 3300046533 | Ga0495640_0024363 | Ga0495640_0024363_1674_2135 | 153 |
| 95 | 3300046642 | Ga0495634_0028701 | Ga0495634_0028701_1926_2393 | 153 |
| 96 | 3300047319 | Ga0495674_0000010 | Ga0495674_0000010_117745_118206 | 153 |
| 97 | 3300047444 | Ga0495675_0115419 | Ga0495675_0115419_1139_1600 | 153 |
| 98 | 3300047472 | Ga0495686_0066193 | Ga0495686_0066193_430_891 | 153 |
| 99 | 3300048912 | Ga0496109_0415697 | Ga0496109_0415697_624_1091 | 153 |
| 100 | 3300048915 | Ga0496112_0402977 | Ga0496112_0402977_786_1253 | 153 |
| 101 | 3300048916 | Ga0496113_0035042 | Ga0496113_0035042_374_841 | 153 |
| 102 | 3300048921 | Ga0496118_0228412 | Ga0496118_0228412_456_917 | 153 |
| 103 | 3300046689 | Ga0495613_0130334 | Ga0495613_0130334_273_752 | 154 |
| 104 | 3300005441 | Ga0070700_100094352 | Ga0070700_1000943522 | 155 |
| 105 | 3300005456 | Ga0070678_100794935 | Ga0070678_1007949351 | 155 |
| 106 | 3300005459 | Ga0068867_100000204 | Ga0068867_10000020419 | 155 |
| 107 | 3300014968 | Ga0157379_10105847 | Ga0157379_101058472 | 155 |
| 108 | 3300026075 | Ga0207708_10127228 | Ga0207708_101272282 | 155 |
| 109 | 3300026089 | Ga0207648_10000643 | Ga0207648_1000064318 | 155 |
| 110 | 3300026121 | Ga0207683_10412863 | Ga0207683_104128633 | 155 |
| 111 | 3300046463 | Ga0495653_0299537 | Ga0495653_0299537_29_511 | 155 |
| 112 | 3300046516 | Ga0495628_0008170 | Ga0495628_0008170_3194_3661 | 155 |
| 113 | 3300046536 | Ga0495587_0414600 | Ga0495587_0414600_246_713 | 155 |
| 114 | 3300046678 | Ga0495599_0208885 | Ga0495599_0208885_300_776 | 155 |
| 115 | 3300046683 | Ga0495658_0005120 | Ga0495658_0005120_394_861 | 155 |
| 116 | 3300046689 | Ga0495613_0467384 | Ga0495613_0467384_198_671 | 155 |
| 117 | 3300048088 | Ga0495602_0003667 | Ga0495602_0003667_14438_14905 | 155 |
| 118 | 3300048088 | Ga0495602_0196575 | Ga0495602_0196575_260_736 | 155 |
| 119 | 3300048914 | Ga0496111_0148446 | Ga0496111_0148446_1060_1533 | 155 |
| 120 | 3300053077 | Ga0495601_0469564 | Ga0495601_0469564_34_510 | 155 |
| 121 | 3300000532 | CNAas_1006915 | CNAas_10069151 | 156 |
| 122 | 3300001977 | JGI24746J21847_1000048 | JGI24746J21847_100004812 | 156 |
| 123 | 3300002239 | JGI24034J26672_10010515 | JGI24034J26672_100105152 | 156 |
| 124 | 3300002244 | JGI24742J22300_10019848 | JGI24742J22300_100198482 | 156 |
| 125 | 3300003203 | JGI25406J46586_10046762 | JGI25406J46586_100467621 | 156 |
| 126 | 3300005329 | Ga0070683_100019627 | Ga0070683_1000196272 | 156 |
| 127 | 3300005329 | Ga0070683_100053231 | Ga0070683_1000532315 | 156 |
| 128 | 3300005329 | Ga0070683_100106093 | Ga0070683_1001060932 | 156 |
| 129 | 3300005330 | Ga0070690_100118147 | Ga0070690_1001181474 | 156 |
| 130 | 3300005333 | Ga0070677_10000037 | Ga0070677_1000003736 | 156 |
| 131 | 3300005335 | Ga0070666_10069888 | Ga0070666_100698882 | 156 |
| 132 | 3300005337 | Ga0070682_100000011 | Ga0070682_100000011147 | 156 |
| 133 | 3300005337 | Ga0070682_100000030 | Ga0070682_10000003054 | 156 |
| 134 | 3300005338 | Ga0068868_100002102 | Ga0068868_10000210211 | 156 |
| 135 | 3300005341 | Ga0070691_10000908 | Ga0070691_1000090814 | 156 |
| 136 | 3300005344 | Ga0070661_100000608 | Ga0070661_10000060816 | 156 |
| 137 | 3300005353 | Ga0070669_100451069 | Ga0070669_1004510692 | 156 |
| 138 | 3300005356 | Ga0070674_100000002 | Ga0070674_100000002196 | 156 |
| 139 | 3300005356 | Ga0070674_100000007 | Ga0070674_10000000717 | 156 |
| 140 | 3300005365 | Ga0070688_100000412 | Ga0070688_10000041218 | 156 |
| 141 | 3300005365 | Ga0070688_100022008 | Ga0070688_1000220082 | 156 |
| 142 | 3300005365 | Ga0070688_100303465 | Ga0070688_1003034652 | 156 |
| 143 | 3300005365 | Ga0070688_100672970 | Ga0070688_1006729701 | 156 |
| 144 | 3300005366 | Ga0070659_100301183 | Ga0070659_1003011832 | 156 |
| 145 | 3300005367 | Ga0070667_100001123 | Ga0070667_1000011239 | 156 |
| 146 | 3300005435 | Ga0070714_100062407 | Ga0070714_1000624074 | 156 |
| 147 | 3300005435 | Ga0070714_100819408 | Ga0070714_1008194082 | 156 |
| 148 | 3300005436 | Ga0070713_100096958 | Ga0070713_1000969581 | 156 |
| 149 | 3300005439 | Ga0070711_100001735 | Ga0070711_1000017358 | 156 |
| 150 | 3300005456 | Ga0070678_100383579 | Ga0070678_1003835792 | 156 |
| 151 | 3300005457 | Ga0070662_100000002 | Ga0070662_100000002109 | 156 |
| 152 | 3300005466 | Ga0070685_10000013 | Ga0070685_1000001370 | 156 |
| 153 | 3300005466 | Ga0070685_10007592 | Ga0070685_100075928 | 156 |
| 154 | 3300005466 | Ga0070685_10085369 | Ga0070685_100853691 | 156 |
| 155 | 3300005530 | Ga0070679_100000181 | Ga0070679_10000018117 | 156 |
| 156 | 3300005535 | Ga0070684_100012567 | Ga0070684_1000125676 | 156 |
| 157 | 3300005535 | Ga0070684_100074570 | Ga0070684_1000745705 | 156 |
| 158 | 3300005535 | Ga0070684_100083172 | Ga0070684_1000831722 | 156 |
| 159 | 3300005535 | Ga0070684_100258796 | Ga0070684_1002587962 | 156 |
| 160 | 3300005539 | Ga0068853_100025258 | Ga0068853_1000252582 | 156 |
| 161 | 3300005543 | Ga0070672_100000083 | Ga0070672_10000008316 | 156 |
| 162 | 3300005547 | Ga0070693_100000987 | Ga0070693_10000098710 | 156 |
| 163 | 3300005548 | Ga0070665_100000040 | Ga0070665_100000040124 | 156 |
| 164 | 3300005548 | Ga0070665_100119714 | Ga0070665_1001197142 | 156 |
| 165 | 3300005548 | Ga0070665_100348798 | Ga0070665_1003487982 | 156 |
| 166 | 3300005563 | Ga0068855_100328389 | Ga0068855_1003283891 | 156 |
| 167 | 3300005563 | Ga0068855_100456808 | Ga0068855_1004568082 | 156 |
| 168 | 3300005577 | Ga0068857_100274783 | Ga0068857_1002747832 | 156 |
| 169 | 3300005578 | Ga0068854_100000363 | Ga0068854_10000036328 | 156 |
| 170 | 3300005578 | Ga0068854_100023409 | Ga0068854_1000234092 | 156 |
| 171 | 3300005614 | Ga0068856_100000237 | Ga0068856_10000023764 | 156 |
| 172 | 3300005614 | Ga0068856_100027399 | Ga0068856_1000273992 | 156 |
| 173 | 3300005616 | Ga0068852_100000002 | Ga0068852_10000000274 | 156 |
| 174 | 3300005616 | Ga0068852_100012193 | Ga0068852_1000121932 | 156 |
| 175 | 3300005616 | Ga0068852_101055372 | Ga0068852_1010553721 | 156 |
| 176 | 3300005718 | Ga0068866_10000003 | Ga0068866_10000003158 | 156 |
| 177 | 3300005718 | Ga0068866_10001295 | Ga0068866_1000129511 | 156 |
| 178 | 3300005719 | Ga0068861_100246154 | Ga0068861_1002461542 | 156 |
| 179 | 3300005719 | Ga0068861_100342948 | Ga0068861_1003429482 | 156 |
| 180 | 3300005834 | Ga0068851_10004739 | Ga0068851_100047394 | 156 |
| 181 | 3300005841 | Ga0068863_100001530 | Ga0068863_10000153015 | 156 |
| 182 | 3300005842 | Ga0068858_100000120 | Ga0068858_10000012066 | 156 |
| 183 | 3300005842 | Ga0068858_100006738 | Ga0068858_1000067388 | 156 |
| 184 | 3300005843 | Ga0068860_100056918 | Ga0068860_1000569182 | 156 |
| 185 | 3300005843 | Ga0068860_100057465 | Ga0068860_1000574656 | 156 |
| 186 | 3300005843 | Ga0068860_100956121 | Ga0068860_1009561212 | 156 |
| 187 | 3300005844 | Ga0068862_100005726 | Ga0068862_1000057269 | 156 |
| 188 | 3300005937 | Ga0081455_10041414 | Ga0081455_100414144 | 156 |
| 189 | 3300005983 | Ga0081540_1071063 | Ga0081540_10710632 | 156 |
| 190 | 3300005985 | Ga0081539_10004533 | Ga0081539_100045338 | 156 |
| 191 | 3300006163 | Ga0070715_10000001 | Ga0070715_10000001702 | 156 |
| 192 | 3300006163 | Ga0070715_10110490 | Ga0070715_101104902 | 156 |
| 193 | 3300006175 | Ga0070712_100004387 | Ga0070712_10000438710 | 156 |
| 194 | 3300006237 | Ga0097621_100651940 | Ga0097621_1006519402 | 156 |
| 195 | 3300006852 | Ga0075433_10014316 | Ga0075433_100143166 | 156 |
| 196 | 3300006881 | Ga0068865_100000134 | Ga0068865_10000013418 | 156 |
| 197 | 3300009093 | Ga0105240_10407549 | Ga0105240_104075491 | 156 |
| 198 | 3300009093 | Ga0105240_10617969 | Ga0105240_106179691 | 156 |
| 199 | 3300009098 | Ga0105245_10000026 | Ga0105245_10000026160 | 156 |
| 200 | 3300009098 | Ga0105245_10000143 | Ga0105245_1000014315 | 156 |
| 201 | 3300009098 | Ga0105245_10002179 | Ga0105245_1000217915 | 156 |
| 202 | 3300009098 | Ga0105245_10012210 | Ga0105245_1001221010 | 156 |
| 203 | 3300009148 | Ga0105243_10053227 | Ga0105243_100532275 | 156 |
| 204 | 3300009174 | Ga0105241_10069970 | Ga0105241_100699702 | 156 |
| 205 | 3300009176 | Ga0105242_10032261 | Ga0105242_100322616 | 156 |
| 206 | 3300009176 | Ga0105242_10105713 | Ga0105242_101057133 | 156 |
| 207 | 3300009177 | Ga0105248_10000020 | Ga0105248_10000020279 | 156 |
| 208 | 3300009177 | Ga0105248_10117972 | Ga0105248_101179722 | 156 |
| 209 | 3300009551 | Ga0105238_10000009 | Ga0105238_10000009188 | 156 |
| 210 | 3300009553 | Ga0105249_10000070 | Ga0105249_10000070127 | 156 |
| 211 | 3300009553 | Ga0105249_10627246 | Ga0105249_106272461 | 156 |
| 212 | 3300009553 | Ga0105249_11054213 | Ga0105249_110542131 | 156 |
| 213 | 3300010375 | Ga0105239_10476537 | Ga0105239_104765372 | 156 |
| 214 | 3300011119 | Ga0105246_11119237 | Ga0105246_111192372 | 156 |
| 215 | 3300013105 | Ga0157369_10000014 | Ga0157369_1000001472 | 156 |
| 216 | 3300013296 | Ga0157374_11972016 | Ga0157374_119720161 | 156 |
| 217 | 3300013297 | Ga0157378_10093267 | Ga0157378_100932674 | 156 |
| 218 | 3300013297 | Ga0157378_11257173 | Ga0157378_112571732 | 156 |
| 219 | 3300013306 | Ga0163162_10325302 | Ga0163162_103253023 | 156 |
| 220 | 3300013307 | Ga0157372_10000060 | Ga0157372_1000006018 | 156 |
| 221 | 3300013308 | Ga0157375_11241477 | Ga0157375_112414771 | 156 |
| 222 | 3300014968 | Ga0157379_10033468 | Ga0157379_100334683 | 156 |
| 223 | 3300014968 | Ga0157379_10058054 | Ga0157379_100580544 | 156 |
| 224 | 3300017792 | Ga0163161_10021169 | Ga0163161_100211693 | 156 |
| 225 | 3300017792 | Ga0163161_11708957 | Ga0163161_117089571 | 156 |
| 226 | 3300022467 | Ga0224712_10155727 | Ga0224712_101557272 | 156 |
| 227 | 3300025321 | Ga0207656_10021074 | Ga0207656_100210744 | 156 |
| 228 | 3300025321 | Ga0207656_10028797 | Ga0207656_100287972 | 156 |
| 229 | 3300025893 | Ga0207682_10000018 | Ga0207682_1000001865 | 156 |
| 230 | 3300025899 | Ga0207642_10000002 | Ga0207642_10000002410 | 156 |
| 231 | 3300025899 | Ga0207642_10000634 | Ga0207642_1000063411 | 156 |
| 232 | 3300025900 | Ga0207710_10000997 | Ga0207710_1000099714 | 156 |
| 233 | 3300025903 | Ga0207680_10000567 | Ga0207680_1000056712 | 156 |
| 234 | 3300025905 | Ga0207685_10000005 | Ga0207685_1000000529 | 156 |
| 235 | 3300025911 | Ga0207654_10106053 | Ga0207654_101060532 | 156 |
| 236 | 3300025913 | Ga0207695_10425791 | Ga0207695_104257912 | 156 |
| 237 | 3300025913 | Ga0207695_10518784 | Ga0207695_105187842 | 156 |
| 238 | 3300025915 | Ga0207693_10015036 | Ga0207693_100150365 | 156 |
| 239 | 3300025916 | Ga0207663_10042943 | Ga0207663_100429435 | 156 |
| 240 | 3300025920 | Ga0207649_10000003 | Ga0207649_10000003341 | 156 |
| 241 | 3300025921 | Ga0207652_10000371 | Ga0207652_1000037130 | 156 |
| 242 | 3300025923 | Ga0207681_10772865 | Ga0207681_107728652 | 156 |
| 243 | 3300025924 | Ga0207694_10000004 | Ga0207694_10000004108 | 156 |
| 244 | 3300025925 | Ga0207650_10182994 | Ga0207650_101829942 | 156 |
| 245 | 3300025926 | Ga0207659_10000368 | Ga0207659_1000036810 | 156 |
| 246 | 3300025927 | Ga0207687_10000017 | Ga0207687_1000001722 | 156 |
| 247 | 3300025927 | Ga0207687_10000020 | Ga0207687_10000020125 | 156 |
| 248 | 3300025927 | Ga0207687_10001467 | Ga0207687_1000146712 | 156 |
| 249 | 3300025927 | Ga0207687_10010029 | Ga0207687_100100292 | 156 |
| 250 | 3300025929 | Ga0207664_10229876 | Ga0207664_102298762 | 156 |
| 251 | 3300025929 | Ga0207664_10995519 | Ga0207664_109955191 | 156 |
| 252 | 3300025932 | Ga0207690_10240805 | Ga0207690_102408052 | 156 |
| 253 | 3300025933 | Ga0207706_10000001 | Ga0207706_10000001289 | 156 |
| 254 | 3300025934 | Ga0207686_10181970 | Ga0207686_101819702 | 156 |
| 255 | 3300025935 | Ga0207709_10013906 | Ga0207709_100139067 | 156 |
| 256 | 3300025935 | Ga0207709_10161357 | Ga0207709_101613571 | 156 |
| 257 | 3300025936 | Ga0207670_10010569 | Ga0207670_100105697 | 156 |
| 258 | 3300025936 | Ga0207670_10036018 | Ga0207670_100360184 | 156 |
| 259 | 3300025937 | Ga0207669_10000001 | Ga0207669_10000001132 | 156 |
| 260 | 3300025937 | Ga0207669_10000003 | Ga0207669_1000000398 | 156 |
| 261 | 3300025938 | Ga0207704_10000110 | Ga0207704_1000011035 | 156 |
| 262 | 3300025939 | Ga0207665_10063868 | Ga0207665_100638684 | 156 |
| 263 | 3300025940 | Ga0207691_10000641 | Ga0207691_1000064116 | 156 |
| 264 | 3300025941 | Ga0207711_10000006 | Ga0207711_1000000699 | 156 |
| 265 | 3300025944 | Ga0207661_10000867 | Ga0207661_1000086710 | 156 |
| 266 | 3300025944 | Ga0207661_10011021 | Ga0207661_100110216 | 156 |
| 267 | 3300025944 | Ga0207661_10018898 | Ga0207661_100188981 | 156 |
| 268 | 3300025944 | Ga0207661_10033030 | Ga0207661_100330301 | 156 |
| 269 | 3300025945 | Ga0207679_10327214 | Ga0207679_103272142 | 156 |
| 270 | 3300025949 | Ga0207667_10456553 | Ga0207667_104565531 | 156 |
| 271 | 3300025960 | Ga0207651_10037230 | Ga0207651_100372303 | 156 |
| 272 | 3300025961 | Ga0207712_10000019 | Ga0207712_10000019184 | 156 |
| 273 | 3300025961 | Ga0207712_10026616 | Ga0207712_100266166 | 156 |
| 274 | 3300025961 | Ga0207712_10395574 | Ga0207712_103955741 | 156 |
| 275 | 3300025981 | Ga0207640_10000110 | Ga0207640_1000011058 | 156 |
| 276 | 3300025981 | Ga0207640_10005989 | Ga0207640_100059892 | 156 |
| 277 | 3300025986 | Ga0207658_10000724 | Ga0207658_100007249 | 156 |
| 278 | 3300025986 | Ga0207658_10182655 | Ga0207658_101826552 | 156 |
| 279 | 3300026023 | Ga0207677_10000362 | Ga0207677_1000036213 | 156 |
| 280 | 3300026023 | Ga0207677_10004995 | Ga0207677_100049958 | 156 |
| 281 | 3300026035 | Ga0207703_10000018 | Ga0207703_10000018185 | 156 |
| 282 | 3300026035 | Ga0207703_10000170 | Ga0207703_1000017031 | 156 |
| 283 | 3300026041 | Ga0207639_10007449 | Ga0207639_100074496 | 156 |
| 284 | 3300026041 | Ga0207639_10087562 | Ga0207639_100875622 | 156 |
| 285 | 3300026075 | Ga0207708_10130501 | Ga0207708_101305012 | 156 |
| 286 | 3300026078 | Ga0207702_10000251 | Ga0207702_100002516 | 156 |
| 287 | 3300026078 | Ga0207702_10007011 | Ga0207702_100070114 | 156 |
| 288 | 3300026088 | Ga0207641_10000016 | Ga0207641_1000001628 | 156 |
| 289 | 3300026116 | Ga0207674_10280873 | Ga0207674_102808732 | 156 |
| 290 | 3300026118 | Ga0207675_100445021 | Ga0207675_1004450211 | 156 |
| 291 | 3300026121 | Ga0207683_10031544 | Ga0207683_100315442 | 156 |
| 292 | 3300026121 | Ga0207683_10432745 | Ga0207683_104327452 | 156 |
| 293 | 3300026142 | Ga0207698_10000004 | Ga0207698_10000004211 | 156 |
| 294 | 3300026142 | Ga0207698_10006867 | Ga0207698_100068672 | 156 |
| 295 | 3300027907 | Ga0207428_10558653 | Ga0207428_105586532 | 156 |
| 296 | 3300028379 | Ga0268266_10000045 | Ga0268266_10000045127 | 156 |
| 297 | 3300028379 | Ga0268266_10111412 | Ga0268266_101114124 | 156 |
| 298 | 3300028379 | Ga0268266_11201915 | Ga0268266_112019151 | 156 |
| 299 | 3300028380 | Ga0268265_10004189 | Ga0268265_100041896 | 156 |
| 300 | 3300028381 | Ga0268264_10012280 | Ga0268264_100122804 | 156 |
| 301 | 3300028381 | Ga0268264_10042357 | Ga0268264_100423572 | 156 |
| 302 | 3300028381 | Ga0268264_10253874 | Ga0268264_102538742 | 156 |
| 303 | 3300028556 | Ga0265337_1000034 | Ga0265337_100003432 | 156 |
| 304 | 3300028558 | Ga0265326_10000041 | Ga0265326_1000004131 | 156 |
| 305 | 3300028577 | Ga0265318_10218035 | Ga0265318_102180352 | 156 |
| 306 | 3300028654 | Ga0265322_10000004 | Ga0265322_1000000431 | 156 |
| 307 | 3300028666 | Ga0265336_10014153 | Ga0265336_100141532 | 156 |
| 308 | 3300028800 | Ga0265338_10158296 | Ga0265338_101582962 | 156 |
| 309 | 3300029957 | Ga0265324_10237727 | Ga0265324_102377271 | 156 |
| 310 | 3300030521 | Ga0307511_10045873 | Ga0307511_100458735 | 156 |
| 311 | 3300031239 | Ga0265328_10003370 | Ga0265328_100033706 | 156 |
| 312 | 3300031240 | Ga0265320_10000029 | Ga0265320_1000002930 | 156 |
| 313 | 3300031242 | Ga0265329_10003419 | Ga0265329_100034194 | 156 |
| 314 | 3300031249 | Ga0265339_10006278 | Ga0265339_100062783 | 156 |
| 315 | 3300031250 | Ga0265331_10000526 | Ga0265331_1000052632 | 156 |
| 316 | 3300031251 | Ga0265327_10000015 | Ga0265327_1000001579 | 156 |
| 317 | 3300031344 | Ga0265316_10016243 | Ga0265316_100162434 | 156 |
| 318 | 3300031595 | Ga0265313_10040058 | Ga0265313_100400581 | 156 |
| 319 | 3300031711 | Ga0265314_10000119 | Ga0265314_1000011948 | 156 |
| 320 | 3300031731 | Ga0307405_10483394 | Ga0307405_104833942 | 156 |
| 321 | 3300032126 | Ga0307415_100003139 | Ga0307415_1000031398 | 156 |
| 322 | 3300035117 | Ga0373953_0123258 | Ga0373953_0123258_28_513 | 156 |
| 323 | 3300035692 | Ga0373935_1056439 | Ga0373935_1056439_101_592 | 156 |
| 324 | 3300036401 | Ga0373937_0018727 | Ga0373937_0018727_5330_5815 | 156 |
| 325 | 3300041486 | Ga0451807_0042816 | Ga0451807_0042816_169_639 | 156 |
| 326 | 3300041496 | Ga0451839_0200805 | Ga0451839_0200805_392_862 | 156 |
| 327 | 3300041501 | Ga0451845_0860192 | Ga0451845_0860192_45_515 | 156 |
| 328 | 3300041512 | Ga0451853_2679834 | Ga0451853_2679834_3661_4146 | 156 |
| 329 | 3300041512 | Ga0451853_3964082 | Ga0451853_3964082_388_858 | 156 |
| 330 | 3300044694 | Ga0466963_0000043 | Ga0466963_0000043_39155_39640 | 156 |
| 331 | 3300044694 | Ga0466963_0076444 | Ga0466963_0076444_573_1043 | 156 |
| 332 | 3300044694 | Ga0466963_0331809 | Ga0466963_0331809_115_585 | 156 |
| 333 | 3300044694 | Ga0466963_0403703 | Ga0466963_0403703_88_558 | 156 |
| 334 | 3300044842 | Ga0466957_0000293 | Ga0466957_0000293_17094_17564 | 156 |
| 335 | 3300045976 | Ga0466967_0000006 | Ga0466967_0000006_119555_120025 | 156 |
| 336 | 3300045976 | Ga0466967_0268647 | Ga0466967_0268647_764_1243 | 156 |
| 337 | 3300046455 | Ga0495603_0000391 | Ga0495603_0000391_2997_3482 | 156 |
| 338 | 3300046455 | Ga0495603_0007880 | Ga0495603_0007880_1500_1985 | 156 |
| 339 | 3300046455 | Ga0495603_0204902 | Ga0495603_0204902_462_947 | 156 |
| 340 | 3300046459 | Ga0495629_0001657 | Ga0495629_0001657_5439_5909 | 156 |
| 341 | 3300046460 | Ga0495638_0015861 | Ga0495638_0015861_699_1169 | 156 |
| 342 | 3300046461 | Ga0495641_0000014 | Ga0495641_0000014_53637_54122 | 156 |
| 343 | 3300046461 | Ga0495641_0022653 | Ga0495641_0022653_1417_1887 | 156 |
| 344 | 3300046461 | Ga0495641_0170627 | Ga0495641_0170627_128_613 | 156 |
| 345 | 3300046462 | Ga0495651_0395099 | Ga0495651_0395099_198_668 | 156 |
| 346 | 3300046463 | Ga0495653_0015144 | Ga0495653_0015144_681_1151 | 156 |
| 347 | 3300046463 | Ga0495653_0599176 | Ga0495653_0599176_127_612 | 156 |
| 348 | 3300046473 | Ga0495582_0000009 | Ga0495582_0000009_76405_76875 | 156 |
| 349 | 3300046473 | Ga0495582_0738497 | Ga0495582_0738497_62_538 | 156 |
| 350 | 3300046476 | Ga0495662_0000001 | Ga0495662_0000001_143637_144122 | 156 |
| 351 | 3300046476 | Ga0495662_0002954 | Ga0495662_0002954_5371_5841 | 156 |
| 352 | 3300046476 | Ga0495662_0200633 | Ga0495662_0200633_274_759 | 156 |
| 353 | 3300046476 | Ga0495662_0381565 | Ga0495662_0381565_87_557 | 156 |
| 354 | 3300046499 | Ga0495594_0000006 | Ga0495594_0000006_122984_123454 | 156 |
| 355 | 3300046499 | Ga0495594_0585896 | Ga0495594_0585896_88_558 | 156 |
| 356 | 3300046507 | Ga0495606_0000463 | Ga0495606_0000463_60845_61330 | 156 |
| 357 | 3300046511 | Ga0495608_0000007 | Ga0495608_0000007_306349_306819 | 156 |
| 358 | 3300046511 | Ga0495608_0000361 | Ga0495608_0000361_5340_5825 | 156 |
| 359 | 3300046515 | Ga0495620_0000215 | Ga0495620_0000215_7351_7836 | 156 |
| 360 | 3300046516 | Ga0495628_0072311 | Ga0495628_0072311_160_645 | 156 |
| 361 | 3300046516 | Ga0495628_0197377 | Ga0495628_0197377_756_1241 | 156 |
| 362 | 3300046516 | Ga0495628_0240945 | Ga0495628_0240945_67_552 | 156 |
| 363 | 3300046517 | Ga0495630_0000060 | Ga0495630_0000060_17436_17906 | 156 |
| 364 | 3300046517 | Ga0495630_0002249 | Ga0495630_0002249_5370_5855 | 156 |
| 365 | 3300046529 | Ga0495652_0000010 | Ga0495652_0000010_93879_94349 | 156 |
| 366 | 3300046533 | Ga0495640_0031669 | Ga0495640_0031669_3164_3649 | 156 |
| 367 | 3300046536 | Ga0495587_0308331 | Ga0495587_0308331_198_668 | 156 |
| 368 | 3300046537 | Ga0495598_0004462 | Ga0495598_0004462_702_1187 | 156 |
| 369 | 3300046543 | Ga0495645_0045277 | Ga0495645_0045277_478_963 | 156 |
| 370 | 3300046557 | Ga0495622_0000297 | Ga0495622_0000297_31487_31957 | 156 |
| 371 | 3300046559 | Ga0495667_0037656 | Ga0495667_0037656_1759_2244 | 156 |
| 372 | 3300046615 | Ga0495656_0001136 | Ga0495656_0001136_954_1439 | 156 |
| 373 | 3300046660 | Ga0495625_0000032 | Ga0495625_0000032_153046_153516 | 156 |
| 374 | 3300046660 | Ga0495625_0288905 | Ga0495625_0288905_333_806 | 156 |
| 375 | 3300046663 | Ga0495635_0000074 | Ga0495635_0000074_40904_41389 | 156 |
| 376 | 3300046663 | Ga0495635_0093153 | Ga0495635_0093153_765_1250 | 156 |
| 377 | 3300046674 | Ga0495588_0001071 | Ga0495588_0001071_5505_5975 | 156 |
| 378 | 3300046675 | Ga0495657_0000001 | Ga0495657_0000001_438495_438965 | 156 |
| 379 | 3300046675 | Ga0495657_0004097 | Ga0495657_0004097_9484_9969 | 156 |
| 380 | 3300046678 | Ga0495599_0047195 | Ga0495599_0047195_449_934 | 156 |
| 381 | 3300046679 | Ga0495623_0385519 | Ga0495623_0385519_182_667 | 156 |
| 382 | 3300046681 | Ga0495647_0000063 | Ga0495647_0000063_21068_21538 | 156 |
| 383 | 3300046683 | Ga0495658_0000002 | Ga0495658_0000002_76400_76870 | 156 |
| 384 | 3300046683 | Ga0495658_0494867 | Ga0495658_0494867_158_643 | 156 |
| 385 | 3300046684 | Ga0495669_0000261 | Ga0495669_0000261_22745_23230 | 156 |
| 386 | 3300046689 | Ga0495613_0000032 | Ga0495613_0000032_91803_92273 | 156 |
| 387 | 3300046690 | Ga0495624_0000243 | Ga0495624_0000243_14594_15064 | 156 |
| 388 | 3300046690 | Ga0495624_0115319 | Ga0495624_0115319_271_756 | 156 |
| 389 | 3300046691 | Ga0495670_0017664 | Ga0495670_0017664_1860_2351 | 156 |
| 390 | 3300046694 | Ga0495649_0003945 | Ga0495649_0003945_3883_4368 | 156 |
| 391 | 3300046809 | Ga0495600_0003218 | Ga0495600_0003218_8501_8986 | 156 |
| 392 | 3300046809 | Ga0495600_0193856 | Ga0495600_0193856_777_1262 | 156 |
| 393 | 3300047317 | Ga0495604_0000927 | Ga0495604_0000927_181_651 | 156 |
| 394 | 3300047317 | Ga0495604_0001215 | Ga0495604_0001215_20639_21109 | 156 |
| 395 | 3300047321 | Ga0495676_0000136 | Ga0495676_0000136_14822_15307 | 156 |
| 396 | 3300047321 | Ga0495676_0005715 | Ga0495676_0005715_3810_4280 | 156 |
| 397 | 3300047321 | Ga0495676_0014346 | Ga0495676_0014346_6058_6528 | 156 |
| 398 | 3300047322 | Ga0495680_0000472 | Ga0495680_0000472_41599_42084 | 156 |
| 399 | 3300047322 | Ga0495680_0000486 | Ga0495680_0000486_30799_31284 | 156 |
| 400 | 3300047322 | Ga0495680_0116046 | Ga0495680_0116046_1141_1611 | 156 |
| 401 | 3300047322 | Ga0495680_0489018 | Ga0495680_0489018_203_688 | 156 |
| 402 | 3300047444 | Ga0495675_0000017 | Ga0495675_0000017_6683_7153 | 156 |
| 403 | 3300047446 | Ga0495679_019804 | Ga0495679_019804_309_794 | 156 |
| 404 | 3300047447 | Ga0495685_004050 | Ga0495685_004050_1638_2123 | 156 |
| 405 | 3300047673 | Ga0495593_0137049 | Ga0495593_0137049_308_778 | 156 |
| 406 | 3300048088 | Ga0495602_0000007 | Ga0495602_0000007_7749_8219 | 156 |
| 407 | 3300048088 | Ga0495602_0315934 | Ga0495602_0315934_548_1033 | 156 |
| 408 | 3300048089 | Ga0495614_0187051 | Ga0495614_0187051_311_796 | 156 |
| 409 | 3300048903 | Ga0496100_0000001 | Ga0496100_0000001_257004_257474 | 156 |
| 410 | 3300048903 | Ga0496100_0000014 | Ga0496100_0000014_133018_133503 | 156 |
| 411 | 3300048904 | Ga0496101_0000004 | Ga0496101_0000004_58356_58826 | 156 |
| 412 | 3300048904 | Ga0496101_0000036 | Ga0496101_0000036_133622_134107 | 156 |
| 413 | 3300048904 | Ga0496101_1204545 | Ga0496101_1204545_24_500 | 156 |
| 414 | 3300048905 | Ga0496102_0976081 | Ga0496102_0976081_60_533 | 156 |
| 415 | 3300048906 | Ga0496103_0000057 | Ga0496103_0000057_53162_53632 | 156 |
| 416 | 3300048907 | Ga0496104_0000024 | Ga0496104_0000024_129213_129698 | 156 |
| 417 | 3300048907 | Ga0496104_0000866 | Ga0496104_0000866_9396_9866 | 156 |
| 418 | 3300048907 | Ga0496104_0038236 | Ga0496104_0038236_3826_4302 | 156 |
| 419 | 3300048908 | Ga0496105_0000004 | Ga0496105_0000004_400252_400722 | 156 |
| 420 | 3300048908 | Ga0496105_0000013 | Ga0496105_0000013_100216_100701 | 156 |
| 421 | 3300048908 | Ga0496105_0000059 | Ga0496105_0000059_29672_30142 | 156 |
| 422 | 3300048908 | Ga0496105_0748067 | Ga0496105_0748067_222_698 | 156 |
| 423 | 3300048909 | Ga0496106_0000091 | Ga0496106_0000091_50669_51139 | 156 |
| 424 | 3300048909 | Ga0496106_0000111 | Ga0496106_0000111_39333_39818 | 156 |
| 425 | 3300048909 | Ga0496106_0000795 | Ga0496106_0000795_5440_5925 | 156 |
| 426 | 3300048910 | Ga0496107_0000005 | Ga0496107_0000005_272774_273244 | 156 |
| 427 | 3300048910 | Ga0496107_0000022 | Ga0496107_0000022_87018_87503 | 156 |
| 428 | 3300048910 | Ga0496107_0012674 | Ga0496107_0012674_459_944 | 156 |
| 429 | 3300048911 | Ga0496108_0000006 | Ga0496108_0000006_98098_98583 | 156 |
| 430 | 3300048911 | Ga0496108_0000026 | Ga0496108_0000026_18965_19435 | 156 |
| 431 | 3300048911 | Ga0496108_0001422 | Ga0496108_0001422_14763_15248 | 156 |
| 432 | 3300048911 | Ga0496108_1051529 | Ga0496108_1051529_49_519 | 156 |
| 433 | 3300048912 | Ga0496109_0000004 | Ga0496109_0000004_270841_271326 | 156 |
| 434 | 3300048912 | Ga0496109_0000012 | Ga0496109_0000012_174818_175288 | 156 |
| 435 | 3300048912 | Ga0496109_0000056 | Ga0496109_0000056_35676_36146 | 156 |
| 436 | 3300048912 | Ga0496109_0001040 | Ga0496109_0001040_17377_17862 | 156 |
| 437 | 3300048912 | Ga0496109_0642730 | Ga0496109_0642730_101_571 | 156 |
| 438 | 3300048913 | Ga0496110_0000750 | Ga0496110_0000750_18822_19292 | 156 |
| 439 | 3300048913 | Ga0496110_0013308 | Ga0496110_0013308_2445_2930 | 156 |
| 440 | 3300048913 | Ga0496110_0072871 | Ga0496110_0072871_313_798 | 156 |
| 441 | 3300048913 | Ga0496110_0282282 | Ga0496110_0282282_499_969 | 156 |
| 442 | 3300048914 | Ga0496111_0000047 | Ga0496111_0000047_41946_42416 | 156 |
| 443 | 3300048914 | Ga0496111_0050802 | Ga0496111_0050802_1887_2357 | 156 |
| 444 | 3300048914 | Ga0496111_0252334 | Ga0496111_0252334_722_1213 | 156 |
| 445 | 3300048915 | Ga0496112_0000566 | Ga0496112_0000566_5214_5684 | 156 |
| 446 | 3300048915 | Ga0496112_0213911 | Ga0496112_0213911_691_1161 | 156 |
| 447 | 3300048916 | Ga0496113_0000037 | Ga0496113_0000037_15722_16192 | 156 |
| 448 | 3300048916 | Ga0496113_0090841 | Ga0496113_0090841_601_1071 | 156 |
| 449 | 3300048916 | Ga0496113_0910694 | Ga0496113_0910694_97_582 | 156 |
| 450 | 3300048917 | Ga0496114_0012163 | Ga0496114_0012163_2324_2809 | 156 |
| 451 | 3300048917 | Ga0496114_0374111 | Ga0496114_0374111_322_807 | 156 |
| 452 | 3300048918 | Ga0496115_0000525 | Ga0496115_0000525_8687_9172 | 156 |
| 453 | 3300048920 | Ga0496117_0077842 | Ga0496117_0077842_217_693 | 156 |
| 454 | 3300048920 | Ga0496117_0191134 | Ga0496117_0191134_371_844 | 156 |
| 455 | 3300048920 | Ga0496117_0413237 | Ga0496117_0413237_188_664 | 156 |
| 456 | 3300048921 | Ga0496118_0317397 | Ga0496118_0317397_165_638 | 156 |
| 457 | 3300048922 | Ga0496119_0062828 | Ga0496119_0062828_666_1142 | 156 |
| 458 | 3300048923 | Ga0496120_0263833 | Ga0496120_0263833_46_540 | 156 |
| 459 | 3300048924 | Ga0496121_0008006 | Ga0496121_0008006_11210_11686 | 156 |
| 460 | 3300048927 | Ga0496124_0108892 | Ga0496124_0108892_370_864 | 156 |
| 461 | 3300048927 | Ga0496124_0518313 | Ga0496124_0518313_149_622 | 156 |
| 462 | 3300048928 | Ga0496125_0048312 | Ga0496125_0048312_867_1352 | 156 |
| 463 | 3300048928 | Ga0496125_0282058 | Ga0496125_0282058_537_1013 | 156 |
| 464 | 3300048929 | Ga0496126_0030735 | Ga0496126_0030735_918_1412 | 156 |
| 465 | 3300049569 | Ga0501032_0217894 | Ga0501032_0217894_292_768 | 156 |
| 466 | 3300049578 | Ga0501042_0030117 | Ga0501042_0030117_1224_1709 | 156 |
| 467 | 3300049578 | Ga0501042_0074672 | Ga0501042_0074672_468_938 | 156 |
| 468 | 3300049578 | Ga0501042_0258254 | Ga0501042_0258254_105_590 | 156 |
| 469 | 3300049584 | Ga0501068_0203026 | Ga0501068_0203026_597_1067 | 156 |
| 470 | 3300049586 | Ga0501070_0009917 | Ga0501070_0009917_4113_4589 | 156 |
| 471 | 3300049586 | Ga0501070_0169220 | Ga0501070_0169220_1260_1730 | 156 |
| 472 | 3300049586 | Ga0501070_0319069 | Ga0501070_0319069_622_1092 | 156 |
| 473 | 3300049591 | Ga0501075_0000699 | Ga0501075_0000699_16360_16845 | 156 |
| 474 | 3300049741 | Ga0501079_0773403 | Ga0501079_0773403_12_482 | 156 |
| 475 | 3300049741 | Ga0501079_1201216 | Ga0501079_1201216_20_490 | 156 |
| 476 | 3300049744 | Ga0501083_0029279 | Ga0501083_0029279_3139_3615 | 156 |
| 477 | 3300050515 | nmdc:mga0a205_13_c1 | nmdc:mga0a205_13_c1_79357_79842 | 156 |
| 478 | 3300050515 | nmdc:mga0a205_337_c1 | nmdc:mga0a205_337_c1_16041_16526 | 156 |
| 479 | 3300053077 | Ga0495601_0000099 | Ga0495601_0000099_3739_4209 | 156 |
| 480 | 3300053077 | Ga0495601_0000887 | Ga0495601_0000887_10467_10952 | 156 |
| 481 | 3300053077 | Ga0495601_0059700 | Ga0495601_0059700_179_649 | 156 |
| 482 | 3300053080 | Ga0500635_0272434 | Ga0500635_0272434_74_550 | 156 |
| 483 | 3300053083 | Ga0495655_0000005 | Ga0495655_0000005_16050_16520 | 156 |
| 484 | 3300053083 | Ga0495655_0000547 | Ga0495655_0000547_5409_5879 | 156 |
| 485 | 3300053084 | Ga0495595_0000002 | Ga0495595_0000002_6677_7147 | 156 |
| 486 | 3300053084 | Ga0495595_0001245 | Ga0495595_0001245_8434_8919 | 156 |
| 487 | 3300053085 | Ga0495619_0000082 | Ga0495619_0000082_43557_44027 | 156 |
| 488 | 3300053085 | Ga0495619_0000183 | Ga0495619_0000183_6677_7147 | 156 |
| 489 | 3300053085 | Ga0495619_0000376 | Ga0495619_0000376_26986_27471 | 156 |
| 490 | 3300053094 | Ga0500566_0005771 | Ga0500566_0005771_5456_5926 | 156 |
| 491 | 3300053094 | Ga0500566_0084297 | Ga0500566_0084297_284_760 | 156 |
| 492 | 3300053119 | Ga0500595_029677 | Ga0500595_029677_387_863 | 156 |
| 493 | 3300053123 | Ga0500614_000077 | Ga0500614_000077_18613_19098 | 156 |
| 494 | 3300053129 | Ga0500628_000001 | Ga0500628_000001_72291_72761 | 156 |
| 495 | 3300054114 | Ga0501084_0954844 | Ga0501084_0954844_190_666 | 156 |
| 496 | 3300060353 | Ga0501082_0380888 | Ga0501082_0380888_283_753 | 156 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5isv-assembly2.cif.gz_B | crystal structure of the ribosomal-protein-s18-alanine n-acetyltransferase from escherichia coli | 0.9246 | 16 | 155 |
| 3v8h-assembly1.cif.gz_D | crystal structure of thymidylate synthase from burkholderia thailandensis | 0.9242 | 112 | 155 |
| 4qvt-assembly5.cif.gz_H | crystal structure of predicted n-acyltransferase (ypea) in complex with acetyl-coa from escherichia coli | 0.9121 | 17 | 136 |
| 2cnt-assembly4.cif.gz_D | rimi - ribosomal s18 n-alpha-protein acetyltransferase in complex with coenzymea. | 0.9117 | 16 | 155 |
| 4qvt-assembly2.cif.gz_D | crystal structure of predicted n-acyltransferase (ypea) in complex with acetyl-coa from escherichia coli | 0.9087 | 17 | 136 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I6YG32_8_156_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.9574 | 17 | 156 | 3.40.630.30 |
| af_C7IYZ1_1_59_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.9403 | 112 | 154 | 3.40.630.30 |
| af_Q58925_1_145_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.939 | 17 | 154 | 3.40.630.30 |
| af_Q555H5_1389_1473_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.9385 | 66 | 106 | 3.40.630.30 |
| af_Q2FWL1_1_136_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.9249 | 27 | 156 | 3.40.630.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538LRL0-F1-model_v4 | Ribosomal-protein-alanine N-acetyltransferase | 0.989 | 17 | 155 |
GO:0008080
|
| AF-A0A7V9LFD8-F1-model_v4 | Ribosomal protein S18-alanine N-acetyltransferase | 0.9852 | 16 | 155 |
GO:0005840
GO:0008080 |
| AF-A0A6J4S7N2-F1-model_v4 | Ribosomal-protein-S18p-alanine acetyltransferase (EC 2.3.1.128) | 0.983 | 14 | 155 |
GO:0008999
|
| AF-A0A419GN36-F1-model_v4 | [Ribosomal protein bS18]-alanine N-acetyltransferase (EC 2.3.1.266) | 0.9784 | 16 | 156 |
GO:0005737
GO:0008999 |
| AF-A0A1C3FEG0-F1-model_v4 | deleted | 0.9754 | 16 | 156 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar