F454948

General Info

Members Datasets Scaffolds Average Seq Length
496 266 496 157

Family's Representative Sequence

Representative Sequence 3300048914|Ga0496111_0148446|Ga0496111_0148446_1060_1533
Length 157
Sequence MSETIPREQSRADATAVRRLAYSDLPGVISIERRSFPAPWSLAMFVLELSKPSGICLAATSGDELLGYLVCSRYDQVWHLMNVAVSPDRRRRGVASGLIRHLLEETGRGGELPITLEVRVSNREAIAMYEGLGFRSAGVRPRYYQDNGEDALIMWLD

Samples

Sample ID Description Type Environment
1 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
48 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
129 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
130 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
131 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
132 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
133 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
134 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
135 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
136 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
137 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
138 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
139 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
140 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
141 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
142 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
143 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
144 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
145 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
146 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
147 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
148 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
149 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
151 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
152 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
153 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
154 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
155 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
156 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
157 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
158 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
159 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
160 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
161 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
162 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
163 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
164 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
165 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
166 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
167 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
168 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
169 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
170 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
171 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
172 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
173 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
174 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
175 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
176 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
177 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
178 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
179 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
180 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
181 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
182 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
183 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
184 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
185 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
186 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
187 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
188 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
189 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
190 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
191 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
192 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
193 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
194 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
195 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
196 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
197 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
198 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
199 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
200 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
201 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
202 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
203 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
204 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
205 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
206 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
207 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
208 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
209 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
210 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
211 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
212 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
213 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
214 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
215 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
216 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
217 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
218 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
219 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
220 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
221 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
222 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
223 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
224 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
225 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
226 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
227 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
228 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
229 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
230 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
231 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
232 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
233 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
234 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
235 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
236 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
237 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
238 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
239 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
240 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
241 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
242 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
246 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
247 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
248 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
249 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
250 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
251 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
253 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
254 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
255 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
256 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
257 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
258 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
259 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
260 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
261 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
262 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
263 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
264 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
265 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
266 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.8
Metatranscriptomes 0.2
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.41
Nodule 0
Rhizoplane 12.7
Rhizosphere 82.06
Stem 0
Stem Tuber 0
Unclassified 3.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNAas_1006915 3300000532 Bacteria 733
2 JGI24746J21847_1000048 3300001977 Bacteria 11824
3 JGI24034J26672_10010515 3300002239 Bacteria 1376
4 JGI24742J22300_10019848 3300002244 Bacteria 1143
5 JGI25406J46586_10046762 3300003203 Bacteria 1479
6 Ga0070683_100019627 3300005329 Bacteria 6005
7 Ga0070683_100053231 3300005329 Bacteria 3751
8 Ga0070683_100106093 3300005329 Bacteria 2648
9 Ga0070690_100118147 3300005330 Bacteria 1777
10 Ga0070677_10000037 3300005333 Bacteria 40212
11 Ga0070666_10069888 3300005335 Bacteria 2388
12 Ga0070682_100000011 3300005337 Bacteria 266253
13 Ga0070682_100000030 3300005337 Bacteria 182768
14 Ga0068868_100002102 3300005338 Bacteria 13721
15 Ga0070691_10000908 3300005341 Bacteria 12026
16 Ga0070661_100000608 3300005344 Bacteria 26695
17 Ga0070669_100451069 3300005353 Bacteria 1060
18 Ga0070674_100000002 3300005356 Bacteria 271088
19 Ga0070674_100000007 3300005356 Bacteria 145531
20 Ga0070688_100000412 3300005365 Bacteria 21692
21 Ga0070688_100022008 3300005365 Bacteria 3730
22 Ga0070688_100303465 3300005365 Bacteria 1155
23 Ga0070688_100672970 3300005365 Bacteria 799
24 Ga0070659_100301183 3300005366 Bacteria 1337
25 Ga0070667_100001123 3300005367 Bacteria 24412
26 Ga0070714_100062407 3300005435 Bacteria 3203
27 Ga0070714_100819408 3300005435 Bacteria 902
28 Ga0070713_100096958 3300005436 Bacteria 2547
29 Ga0070711_100001735 3300005439 Bacteria 12093
30 Ga0070700_100094352 3300005441 Bacteria 1959
31 Ga0070678_100383579 3300005456 Bacteria 1216
32 Ga0070678_100794935 3300005456 Bacteria 859
33 Ga0070662_100000002 3300005457 Bacteria 253208
34 Ga0068867_100000204 3300005459 Bacteria 39518
35 Ga0070685_10000013 3300005466 Bacteria 120875
36 Ga0070685_10007592 3300005466 Bacteria 5547
37 Ga0070685_10085369 3300005466 Bacteria 1901
38 Ga0070679_100000181 3300005530 Bacteria 50834
39 Ga0070684_100012567 3300005535 Bacteria 6792
40 Ga0070684_100074570 3300005535 Bacteria 2991
41 Ga0070684_100083172 3300005535 Bacteria 2835
42 Ga0070684_100258796 3300005535 Bacteria 1592
43 Ga0068853_100025258 3300005539 Bacteria 4985
44 Ga0070672_100000083 3300005543 Bacteria 44812
45 Ga0070686_100339038 3300005544 Bacteria 1126
46 Ga0070693_100000987 3300005547 Bacteria 12667
47 Ga0070665_100000040 3300005548 Bacteria 305480
48 Ga0070665_100119714 3300005548 Bacteria 2635
49 Ga0070665_100348798 3300005548 Bacteria 1485
50 Ga0068855_100328389 3300005563 Bacteria 1689
51 Ga0068855_100456808 3300005563 Bacteria 1393
52 Ga0068857_100274783 3300005577 Bacteria 1549
53 Ga0068854_100000363 3300005578 Bacteria 29001
54 Ga0068854_100023409 3300005578 Bacteria 4219
55 Ga0068856_100000237 3300005614 Bacteria 59854
56 Ga0068856_100027399 3300005614 Bacteria 5559
57 Ga0068852_100000002 3300005616 Bacteria 268221
58 Ga0068852_100012193 3300005616 Bacteria 6514
59 Ga0068852_101055372 3300005616 Bacteria 832
60 Ga0068866_10000003 3300005718 Bacteria 281675
61 Ga0068866_10001295 3300005718 Bacteria 10823
62 Ga0068861_100246154 3300005719 Bacteria 1523
63 Ga0068861_100342948 3300005719 Bacteria 1308
64 Ga0068851_10004739 3300005834 Bacteria 6157
65 Ga0068863_100001530 3300005841 Bacteria 22860
66 Ga0068858_100000120 3300005842 Bacteria 81766
67 Ga0068858_100006738 3300005842 Bacteria 11178
68 Ga0068858_100083875 3300005842 Bacteria 2964
69 Ga0068860_100056918 3300005843 Bacteria 3716
70 Ga0068860_100057465 3300005843 Bacteria 3698
71 Ga0068860_100956121 3300005843 Bacteria 874
72 Ga0068862_100005726 3300005844 Bacteria 10368
73 Ga0081455_10041414 3300005937 Bacteria 4050
74 Ga0081538_10143624 3300005981 Bacteria 1095
75 Ga0081540_1000123 3300005983 Bacteria 81914
76 Ga0081540_1000639 3300005983 Bacteria 33299
77 Ga0081540_1071063 3300005983 Bacteria 1609
78 Ga0081540_1196929 3300005983 Bacteria 736
79 Ga0081539_10004533 3300005985 Bacteria 15247
80 Ga0081539_10136440 3300005985 Bacteria 1198
81 Ga0081539_10166595 3300005985 Bacteria 1045
82 Ga0070715_10000001 3300006163 Bacteria 693690
83 Ga0070715_10110490 3300006163 Bacteria 1296
84 Ga0070712_100004387 3300006175 Bacteria 8711
85 Ga0097621_100651940 3300006237 Bacteria 966
86 Ga0075433_10014316 3300006852 Bacteria 6479
87 Ga0068865_100000134 3300006881 Bacteria 38568
88 Ga0105240_10407549 3300009093 Bacteria 1530
89 Ga0105240_10617969 3300009093 Bacteria 1191
90 Ga0111539_10689128 3300009094 Bacteria 1189
91 Ga0105245_10000026 3300009098 Bacteria 163660
92 Ga0105245_10000143 3300009098 Bacteria 67618
93 Ga0105245_10002179 3300009098 Bacteria 17745
94 Ga0105245_10012210 3300009098 Bacteria 7471
95 Ga0105245_10303667 3300009098 Bacteria 1567
96 Ga0105247_10121750 3300009101 Bacteria 1691
97 Ga0105243_10027253 3300009148 Bacteria 4376
98 Ga0105243_10053227 3300009148 Bacteria 3210
99 Ga0105241_10069970 3300009174 Bacteria 2722
100 Ga0105242_10032261 3300009176 Bacteria 4188
101 Ga0105242_10105713 3300009176 Bacteria 2391
102 Ga0105248_10000020 3300009177 Bacteria 284637
103 Ga0105248_10117972 3300009177 Bacteria 2993
104 Ga0105238_10000009 3300009551 Bacteria 288729
105 Ga0105249_10000070 3300009553 Bacteria 147277
106 Ga0105249_10627246 3300009553 Unclassified 1131
107 Ga0105249_11054213 3300009553 Bacteria 882
108 Ga0105239_10476537 3300010375 Bacteria 1418
109 Ga0105239_11092735 3300010375 Bacteria 918
110 Ga0105246_11119237 3300011119 Bacteria 720
111 Ga0157369_10000014 3300013105 Bacteria 266411
112 Ga0157374_10013277 3300013296 Bacteria 7186
113 Ga0157374_11972016 3300013296 Bacteria 610
114 Ga0157378_10051353 3300013297 Bacteria 3669
115 Ga0157378_10093267 3300013297 Bacteria 2741
116 Ga0157378_11257173 3300013297 Bacteria 781
117 Ga0163162_10325302 3300013306 Bacteria 1670
118 Ga0157372_10000060 3300013307 Bacteria 122372
119 Ga0157375_10003070 3300013308 Bacteria 14493
120 Ga0157375_10004333 3300013308 Bacteria 12321
121 Ga0157375_11241477 3300013308 Bacteria 875
122 Ga0163163_10483151 3300014325 Bacteria 1300
123 Ga0163163_11158041 3300014325 Bacteria 836
124 Ga0157380_10023476 3300014326 Bacteria 4652
125 Ga0157379_10033468 3300014968 Bacteria 4583
126 Ga0157379_10058054 3300014968 Bacteria 3459
127 Ga0157379_10105847 3300014968 Bacteria 2525
128 Ga0163161_10021169 3300017792 Bacteria 4571
129 Ga0163161_11708957 3300017792 Bacteria 558
130 Ga0224712_10155727 3300022467 Bacteria 1016
131 Ga0207656_10021074 3300025321 Bacteria 2599
132 Ga0207656_10028797 3300025321 Bacteria 2283
133 Ga0207682_10000018 3300025893 Bacteria 66215
134 Ga0207642_10000002 3300025899 Bacteria 658166
135 Ga0207642_10000634 3300025899 Bacteria 10772
136 Ga0207710_10000997 3300025900 Bacteria 14813
137 Ga0207680_10000567 3300025903 Bacteria 17482
138 Ga0207685_10000005 3300025905 Bacteria 289944
139 Ga0207654_10106053 3300025911 Bacteria 1739
140 Ga0207695_10425791 3300025913 Bacteria 1211
141 Ga0207695_10518784 3300025913 Bacteria 1073
142 Ga0207693_10015036 3300025915 Bacteria 6213
143 Ga0207663_10042943 3300025916 Bacteria 2765
144 Ga0207663_10080051 3300025916 Bacteria 2135
145 Ga0207649_10000003 3300025920 Bacteria 388908
146 Ga0207652_10000371 3300025921 Bacteria 46723
147 Ga0207681_10772865 3300025923 Bacteria 801
148 Ga0207694_10000004 3300025924 Bacteria 967075
149 Ga0207650_10182994 3300025925 Bacteria 1671
150 Ga0207659_10000368 3300025926 Bacteria 27047
151 Ga0207687_10000017 3300025927 Bacteria 237310
152 Ga0207687_10000020 3300025927 Bacteria 228407
153 Ga0207687_10001467 3300025927 Bacteria 16198
154 Ga0207687_10010029 3300025927 Bacteria 6197
155 Ga0207664_10229876 3300025929 Bacteria 1612
156 Ga0207664_10995519 3300025929 Bacteria 751
157 Ga0207690_10240805 3300025932 Bacteria 1393
158 Ga0207706_10000001 3300025933 Bacteria 423014
159 Ga0207686_10181970 3300025934 Bacteria 1491
160 Ga0207709_10013906 3300025935 Bacteria 4443
161 Ga0207709_10161357 3300025935 Bacteria 1564
162 Ga0207670_10010569 3300025936 Bacteria 5325
163 Ga0207670_10036018 3300025936 Bacteria 3215
164 Ga0207669_10000001 3300025937 Bacteria 377747
165 Ga0207669_10000003 3300025937 Bacteria 252239
166 Ga0207704_10000110 3300025938 Bacteria 45277
167 Ga0207665_10063868 3300025939 Bacteria 2501
168 Ga0207691_10000641 3300025940 Bacteria 34560
169 Ga0207711_10000006 3300025941 Bacteria 792692
170 Ga0207661_10000867 3300025944 Bacteria 19843
171 Ga0207661_10011021 3300025944 Bacteria 6533
172 Ga0207661_10018898 3300025944 Bacteria 5129
173 Ga0207661_10033030 3300025944 Bacteria 4014
174 Ga0207661_11231173 3300025944 Bacteria 688
175 Ga0207679_10327214 3300025945 Bacteria 1329
176 Ga0207667_10456553 3300025949 Bacteria 1298
177 Ga0207651_10037230 3300025960 Bacteria 3185
178 Ga0207712_10000019 3300025961 Bacteria 317060
179 Ga0207712_10026616 3300025961 Bacteria 3855
180 Ga0207712_10395574 3300025961 Unclassified 1160
181 Ga0207640_10000110 3300025981 Bacteria 61907
182 Ga0207640_10005989 3300025981 Bacteria 6645
183 Ga0207658_10000724 3300025986 Bacteria 28537
184 Ga0207658_10182655 3300025986 Bacteria 1737
185 Ga0207677_10000362 3300026023 Bacteria 31866
186 Ga0207677_10004995 3300026023 Bacteria 7161
187 Ga0207703_10000018 3300026035 Bacteria 271377
188 Ga0207703_10000170 3300026035 Bacteria 75814
189 Ga0207703_10233624 3300026035 Bacteria 1650
190 Ga0207639_10007449 3300026041 Bacteria 7464
191 Ga0207639_10087562 3300026041 Bacteria 2483
192 Ga0207708_10127228 3300026075 Bacteria 1989
193 Ga0207708_10130501 3300026075 Bacteria 1964
194 Ga0207702_10000251 3300026078 Bacteria 62222
195 Ga0207702_10007011 3300026078 Bacteria 9640
196 Ga0207641_10000016 3300026088 Bacteria 307363
197 Ga0207648_10000643 3300026089 Bacteria 39180
198 Ga0207674_10280873 3300026116 Bacteria 1613
199 Ga0207675_100445021 3300026118 Bacteria 1283
200 Ga0207683_10031544 3300026121 Bacteria 4599
201 Ga0207683_10412863 3300026121 Bacteria 1243
202 Ga0207683_10432745 3300026121 Bacteria 1212
203 Ga0207683_11744216 3300026121 Bacteria 572
204 Ga0207698_10000004 3300026142 Bacteria 313614
205 Ga0207698_10006867 3300026142 Bacteria 7121
206 Ga0207428_10558653 3300027907 Bacteria 827
207 Ga0268266_10000045 3300028379 Bacteria 312955
208 Ga0268266_10111412 3300028379 Bacteria 2425
209 Ga0268266_11201915 3300028379 Bacteria 733
210 Ga0268265_10004189 3300028380 Bacteria 10094
211 Ga0268264_10012280 3300028381 Bacteria 7049
212 Ga0268264_10042357 3300028381 Bacteria 3769
213 Ga0268264_10253874 3300028381 Bacteria 1635
214 Ga0265337_1000034 3300028556 Bacteria 60151
215 Ga0265326_10000041 3300028558 Bacteria 83872
216 Ga0265318_10218035 3300028577 Bacteria 697
217 Ga0265322_10000004 3300028654 Bacteria 275155
218 Ga0265336_10014153 3300028666 Bacteria 2647
219 Ga0265338_10158296 3300028800 Bacteria 1752
220 Ga0265324_10237727 3300029957 Bacteria 618
221 Ga0307511_10045873 3300030521 Bacteria 3605
222 Ga0265328_10003370 3300031239 Bacteria 7064
223 Ga0265320_10000029 3300031240 Bacteria 159627
224 Ga0265329_10003419 3300031242 Bacteria 6923
225 Ga0265339_10006278 3300031249 Bacteria 7813
226 Ga0265331_10000526 3300031250 Bacteria 35306
227 Ga0265327_10000015 3300031251 Bacteria 496677
228 Ga0265316_10016243 3300031344 Bacteria 6463
229 Ga0265313_10040058 3300031595 Bacteria 2319
230 Ga0265314_10000119 3300031711 Bacteria 122334
231 Ga0307405_10483394 3300031731 Bacteria 989
232 Ga0307415_100003139 3300032126 Bacteria 8373
233 Ga0373953_0123258 3300035117 Bacteria 1102
234 Ga0373935_1056439 3300035692 Bacteria 604
235 Ga0373937_0018727 3300036401 Bacteria 6188
236 Ga0395900_0474103 3300037418 Bacteria 1205
237 Ga0395900_0746971 3300037418 Bacteria 909
238 Ga0395900_0908271 3300037418 Bacteria 804
239 Ga0395900_1045810 3300037418 Bacteria 735
240 Ga0395898_0195388 3300037466 Bacteria 1933
241 Ga0395905_0515418 3300037471 Bacteria 1096
242 Ga0395905_0912525 3300037471 Bacteria 781
243 Ga0395905_1090058 3300037471 Bacteria 702
244 Ga0436364_1035306 3300037853 Bacteria 1083
245 Ga0395901_0180203 3300038443 Bacteria 2216
246 Ga0395901_1355843 3300038443 Bacteria 671
247 Ga0451807_0042816 3300041486 Bacteria 811
248 Ga0451839_0200805 3300041496 Bacteria 904
249 Ga0451845_0860192 3300041501 Bacteria 706
250 Ga0451853_2679834 3300041512 Bacteria 9437
251 Ga0451853_3964082 3300041512 Bacteria 902
252 Ga0466963_0000043 3300044694 Bacteria 40976
253 Ga0466963_0076444 3300044694 Bacteria 2261
254 Ga0466963_0331809 3300044694 Bacteria 1071
255 Ga0466963_0403703 3300044694 Bacteria 964
256 Ga0466957_0000293 3300044842 Bacteria 24503
257 Ga0466967_0000006 3300045976 Bacteria 144065
258 Ga0466967_0268647 3300045976 Bacteria 1634
259 Ga0495592_0158857 3300046454 Bacteria 1557
260 Ga0495603_0000033 3300046455 Bacteria 57940
261 Ga0495603_0000391 3300046455 Bacteria 24052
262 Ga0495603_0007880 3300046455 Bacteria 6423
263 Ga0495603_0204902 3300046455 Bacteria 1140
264 Ga0495591_114202 3300046458 Bacteria 662
265 Ga0495591_122506 3300046458 Bacteria 634
266 Ga0495629_0001657 3300046459 Bacteria 17477
267 Ga0495629_0010304 3300046459 Bacteria 6809
268 Ga0495629_0031498 3300046459 Bacteria 3755
269 Ga0495629_0092576 3300046459 Bacteria 2110
270 Ga0495629_0218475 3300046459 Bacteria 1315
271 Ga0495638_0015861 3300046460 Bacteria 5049
272 Ga0495641_0000014 3300046461 Bacteria 140908
273 Ga0495641_0022653 3300046461 Bacteria 3137
274 Ga0495641_0170627 3300046461 Bacteria 973
275 Ga0495651_0395099 3300046462 Bacteria 904
276 Ga0495653_0015144 3300046463 Bacteria 6287
277 Ga0495653_0058220 3300046463 Bacteria 2938
278 Ga0495653_0299537 3300046463 Bacteria 1049
279 Ga0495653_0571687 3300046463 Bacteria 697
280 Ga0495653_0599176 3300046463 Bacteria 677
281 Ga0495582_0000009 3300046473 Bacteria 123633
282 Ga0495582_0738497 3300046473 Bacteria 570
283 Ga0495662_0000001 3300046476 Bacteria 179185
284 Ga0495662_0002954 3300046476 Bacteria 8583
285 Ga0495662_0038877 3300046476 Bacteria 2299
286 Ga0495662_0200633 3300046476 Bacteria 983
287 Ga0495662_0381565 3300046476 Bacteria 692
288 Ga0495594_0000006 3300046499 Bacteria 167901
289 Ga0495594_0585896 3300046499 Bacteria 632
290 Ga0495606_0000463 3300046507 Bacteria 66752
291 Ga0495608_0000007 3300046511 Bacteria 313495
292 Ga0495608_0000361 3300046511 Bacteria 31801
293 Ga0495618_0000070 3300046514 Bacteria 72312
294 Ga0495618_0253354 3300046514 Bacteria 1104
295 Ga0495620_0000215 3300046515 Bacteria 43539
296 Ga0495628_0008170 3300046516 Bacteria 9000
297 Ga0495628_0072311 3300046516 Bacteria 2687
298 Ga0495628_0197377 3300046516 Bacteria 1517
299 Ga0495628_0240945 3300046516 Bacteria 1353
300 Ga0495630_0000060 3300046517 Bacteria 90021
301 Ga0495630_0002249 3300046517 Bacteria 13440
302 Ga0495652_0000010 3300046529 Bacteria 261584
303 Ga0495652_0007462 3300046529 Bacteria 10079
304 Ga0495640_0024363 3300046533 Bacteria 4404
305 Ga0495640_0031669 3300046533 Bacteria 3772
306 Ga0495586_0081805 3300046535 Bacteria 1775
307 Ga0495587_0308331 3300046536 Bacteria 885
308 Ga0495587_0414600 3300046536 Bacteria 748
309 Ga0495598_0004462 3300046537 Bacteria 3031
310 Ga0495621_0002501 3300046539 Bacteria 4954
311 Ga0495645_0031398 3300046543 Bacteria 3871
312 Ga0495645_0045277 3300046543 Bacteria 3210
313 Ga0495622_0000297 3300046557 Bacteria 37460
314 Ga0495667_0000045 3300046559 Bacteria 118562
315 Ga0495667_0037656 3300046559 Bacteria 3223
316 Ga0495656_0001136 3300046615 Bacteria 8648
317 Ga0495668_0024540 3300046616 Bacteria 3429
318 Ga0495634_0000045 3300046642 Bacteria 99087
319 Ga0495634_0001402 3300046642 Bacteria 21621
320 Ga0495634_0028701 3300046642 Bacteria 3860
321 Ga0495625_0000032 3300046660 Bacteria 233135
322 Ga0495625_0288905 3300046660 Bacteria 1053
323 Ga0495635_0000074 3300046663 Bacteria 62264
324 Ga0495635_0093153 3300046663 Bacteria 2060
325 Ga0495588_0001071 3300046674 Bacteria 11845
326 Ga0495588_0169278 3300046674 Bacteria 1155
327 Ga0495657_0000001 3300046675 Bacteria 445641
328 Ga0495657_0004097 3300046675 Bacteria 11689
329 Ga0495599_0047195 3300046678 Bacteria 2699
330 Ga0495599_0208885 3300046678 Bacteria 1198
331 Ga0495623_0385519 3300046679 Bacteria 757
332 Ga0495647_0000023 3300046681 Bacteria 67025
333 Ga0495647_0000063 3300046681 Bacteria 26932
334 Ga0495647_0013099 3300046681 Bacteria 2867
335 Ga0495658_0000002 3300046683 Bacteria 309651
336 Ga0495658_0005120 3300046683 Bacteria 6446
337 Ga0495658_0233517 3300046683 Bacteria 1154
338 Ga0495658_0494867 3300046683 Unclassified 782
339 Ga0495669_0000261 3300046684 Bacteria 30497
340 Ga0495669_0165031 3300046684 Bacteria 1052
341 Ga0495613_0000032 3300046689 Bacteria 139806
342 Ga0495613_0000220 3300046689 Bacteria 55692
343 Ga0495613_0130334 3300046689 Bacteria 1801
344 Ga0495613_0467384 3300046689 Bacteria 853
345 Ga0495624_0000071 3300046690 Bacteria 65995
346 Ga0495624_0000243 3300046690 Bacteria 42818
347 Ga0495624_0115319 3300046690 Bacteria 1651
348 Ga0495670_0017664 3300046691 Bacteria 3513
349 Ga0495649_0003945 3300046694 Bacteria 9799
350 Ga0495600_0003218 3300046809 Bacteria 9555
351 Ga0495600_0063488 3300046809 Bacteria 2413
352 Ga0495600_0193856 3300046809 Bacteria 1306
353 Ga0495604_0000927 3300047317 Bacteria 24398
354 Ga0495604_0001215 3300047317 Bacteria 21186
355 Ga0495674_0000010 3300047319 Bacteria 285794
356 Ga0495676_0000136 3300047321 Bacteria 55706
357 Ga0495676_0005715 3300047321 Bacteria 11405
358 Ga0495676_0014346 3300047321 Bacteria 7091
359 Ga0495680_0000472 3300047322 Bacteria 45335
360 Ga0495680_0000486 3300047322 Bacteria 44707
361 Ga0495680_0058909 3300047322 Bacteria 2966
362 Ga0495680_0066060 3300047322 Bacteria 2769
363 Ga0495680_0116046 3300047322 Bacteria 1980
364 Ga0495680_0489018 3300047322 Bacteria 837
365 Ga0495675_0000017 3300047444 Bacteria 123394
366 Ga0495675_0115419 3300047444 Bacteria 1674
367 Ga0495677_0091269 3300047445 Bacteria 1148
368 Ga0495679_019804 3300047446 Bacteria 2356
369 Ga0495685_004050 3300047447 Bacteria 4714
370 Ga0495684_0085096 3300047471 Bacteria 2398
371 Ga0495686_0066193 3300047472 Bacteria 2233
372 Ga0495593_0137049 3300047673 Bacteria 1240
373 Ga0495602_0000007 3300048088 Bacteria 273212
374 Ga0495602_0003667 3300048088 Bacteria 15918
375 Ga0495602_0031280 3300048088 Bacteria 5035
376 Ga0495602_0196575 3300048088 Bacteria 1542
377 Ga0495602_0315934 3300048088 Unclassified 1138
378 Ga0495614_0187051 3300048089 Bacteria 933
379 Ga0496100_0000001 3300048903 Bacteria 530179
380 Ga0496100_0000014 3300048903 Bacteria 174991
381 Ga0496100_0936473 3300048903 Bacteria 681
382 Ga0496101_0000004 3300048904 Bacteria 331599
383 Ga0496101_0000036 3300048904 Bacteria 175595
384 Ga0496101_1204545 3300048904 Bacteria 593
385 Ga0496102_0976081 3300048905 Bacteria 768
386 Ga0496103_0000057 3300048906 Bacteria 142223
387 Ga0496104_0000015 3300048907 Bacteria 374530
388 Ga0496104_0000024 3300048907 Bacteria 229913
389 Ga0496104_0000866 3300048907 Bacteria 26077
390 Ga0496104_0038236 3300048907 Bacteria 4490
391 Ga0496105_0000004 3300048908 Bacteria 475798
392 Ga0496105_0000013 3300048908 Bacteria 229894
393 Ga0496105_0000059 3300048908 Bacteria 86884
394 Ga0496105_0034930 3300048908 Bacteria 4137
395 Ga0496105_0748067 3300048908 Bacteria 747
396 Ga0496106_0000091 3300048909 Bacteria 71361
397 Ga0496106_0000111 3300048909 Bacteria 63431
398 Ga0496106_0000795 3300048909 Bacteria 22795
399 Ga0496106_0126652 3300048909 Bacteria 2000
400 Ga0496107_0000005 3300048910 Bacteria 281747
401 Ga0496107_0000022 3300048910 Bacteria 128991
402 Ga0496107_0012674 3300048910 Bacteria 5887
403 Ga0496108_0000006 3300048911 Bacteria 469473
404 Ga0496108_0000026 3300048911 Bacteria 172399
405 Ga0496108_0001422 3300048911 Bacteria 18875
406 Ga0496108_0009264 3300048911 Bacteria 7966
407 Ga0496108_1051529 3300048911 Bacteria 693
408 Ga0496109_0000004 3300048912 Bacteria 404818
409 Ga0496109_0000012 3300048912 Bacteria 229699
410 Ga0496109_0000056 3300048912 Bacteria 120835
411 Ga0496109_0001040 3300048912 Bacteria 22963
412 Ga0496109_0175020 3300048912 Bacteria 2014
413 Ga0496109_0415697 3300048912 Bacteria 1271
414 Ga0496109_0642730 3300048912 Bacteria 998
415 Ga0496110_0000750 3300048913 Bacteria 22419
416 Ga0496110_0013308 3300048913 Bacteria 6797
417 Ga0496110_0072871 3300048913 Bacteria 3048
418 Ga0496110_0282282 3300048913 Bacteria 1512
419 Ga0496111_0000047 3300048914 Bacteria 47782
420 Ga0496111_0050802 3300048914 Bacteria 2992
421 Ga0496111_0148446 3300048914 Bacteria 1739
422 Ga0496111_0252334 3300048914 Bacteria 1309
423 Ga0496111_0269293 3300048914 Bacteria 1264
424 Ga0496112_0000006 3300048915 Bacteria 365227
425 Ga0496112_0000566 3300048915 Bacteria 25425
426 Ga0496112_0213911 3300048915 Bacteria 1884
427 Ga0496112_0402977 3300048915 Bacteria 1308
428 Ga0496112_0413934 3300048915 Bacteria 1287
429 Ga0496113_0000037 3300048916 Bacteria 56610
430 Ga0496113_0003344 3300048916 Bacteria 9576
431 Ga0496113_0035042 3300048916 Bacteria 3667
432 Ga0496113_0090841 3300048916 Bacteria 2353
433 Ga0496113_0183897 3300048916 Bacteria 1657
434 Ga0496113_0191710 3300048916 Bacteria 1622
435 Ga0496113_0910694 3300048916 Bacteria 695
436 Ga0496113_0935808 3300048916 Bacteria 684
437 Ga0496114_0012163 3300048917 Bacteria 6887
438 Ga0496114_0374111 3300048917 Bacteria 1261
439 Ga0496115_0000525 3300048918 Bacteria 29761
440 Ga0496115_0030753 3300048918 Bacteria 4226
441 Ga0496117_0077842 3300048920 Bacteria 2192
442 Ga0496117_0191134 3300048920 Bacteria 1166
443 Ga0496117_0413237 3300048920 Bacteria 677
444 Ga0496118_0228412 3300048921 Bacteria 1076
445 Ga0496118_0317397 3300048921 Bacteria 847
446 Ga0496119_0062828 3300048922 Bacteria 2211
447 Ga0496120_0263833 3300048923 Bacteria 803
448 Ga0496121_0008006 3300048924 Bacteria 12613
449 Ga0496124_0108892 3300048927 Bacteria 2234
450 Ga0496124_0518313 3300048927 Bacteria 795
451 Ga0496125_0048312 3300048928 Bacteria 3550
452 Ga0496125_0282058 3300048928 Bacteria 1028
453 Ga0496126_0030735 3300048929 Bacteria 5085
454 Ga0501032_0217894 3300049569 Bacteria 1243
455 Ga0501042_0030117 3300049578 Bacteria 3832
456 Ga0501042_0074672 3300049578 Bacteria 2426
457 Ga0501042_0258254 3300049578 Bacteria 1258
458 Ga0501047_0346569 3300049581 Bacteria 1322
459 Ga0501068_0049638 3300049584 Bacteria 2535
460 Ga0501068_0203026 3300049584 Bacteria 1257
461 Ga0501070_0009917 3300049586 Bacteria 8052
462 Ga0501070_0169220 3300049586 Bacteria 1800
463 Ga0501070_0319069 3300049586 Bacteria 1264
464 Ga0501071_0864780 3300049587 Bacteria 697
465 Ga0501075_0000699 3300049591 Bacteria 20775
466 Ga0501079_0773403 3300049741 Bacteria 756
467 Ga0501079_1201216 3300049741 Bacteria 597
468 Ga0501083_0029279 3300049744 Bacteria 3789
469 Ga0501044_1058016 3300049823 Bacteria 682
470 Ga0501045_0695196 3300049824 Bacteria 751
471 nmdc:mga00v17_523835_c1 3300050491 Bacteria 767
472 nmdc:mga08y16_1159395_c1 3300050511 Bacteria 745
473 nmdc:mga0a205_13_c1 3300050515 Bacteria 111131
474 nmdc:mga0a205_337_c1 3300050515 Bacteria 35228
475 nmdc:mga0a205_869642_c1 3300050515 Bacteria 748
476 Ga0495601_0000099 3300053077 Bacteria 47704
477 Ga0495601_0000887 3300053077 Bacteria 16319
478 Ga0495601_0059700 3300053077 Bacteria 2419
479 Ga0495601_0469564 3300053077 Bacteria 813
480 Ga0500635_0272434 3300053080 Bacteria 666
481 Ga0495655_0000005 3300053083 Bacteria 257472
482 Ga0495655_0000547 3300053083 Bacteria 6176
483 Ga0495595_0000002 3300053084 Bacteria 445641
484 Ga0495595_0001245 3300053084 Bacteria 9923
485 Ga0495619_0000008 3300053085 Bacteria 305999
486 Ga0495619_0000082 3300053085 Bacteria 71788
487 Ga0495619_0000183 3300053085 Bacteria 46388
488 Ga0495619_0000376 3300053085 Bacteria 30790
489 Ga0495619_0006399 3300053085 Bacteria 7463
490 Ga0500566_0005771 3300053094 Bacteria 7354
491 Ga0500566_0084297 3300053094 Bacteria 1764
492 Ga0500595_029677 3300053119 Bacteria 1853
493 Ga0500614_000077 3300053123 Bacteria 21548
494 Ga0500628_000001 3300053129 Bacteria 564074
495 Ga0501084_0954844 3300054114 Bacteria 721
496 Ga0501082_0380888 3300060353 Bacteria 1231

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049823 Ga0501044_1058016 Ga0501044_1058016_235_669 128
2 3300009094 Ga0111539_10689128 Ga0111539_106891282 141
3 3300046459 Ga0495629_0010304 Ga0495629_0010304_3902_4327 141
4 3300048909 Ga0496106_0126652 Ga0496106_0126652_1279_1728 141
5 3300048918 Ga0496115_0030753 Ga0496115_0030753_3403_3828 141
6 3300049587 Ga0501071_0864780 Ga0501071_0864780_38_463 141
7 3300049824 Ga0501045_0695196 Ga0501045_0695196_194_619 141
8 3300050511 nmdc:mga08y16_1159395_c1 nmdc:mga08y16_1159395_c1_224_670 141
9 3300050515 nmdc:mga0a205_869642_c1 nmdc:mga0a205_869642_c1_141_587 141
10 3300053085 Ga0495619_0006399 Ga0495619_0006399_6226_6651 141
11 3300005985 Ga0081539_10166595 Ga0081539_101665952 142
12 3300046684 Ga0495669_0165031 Ga0495669_0165031_540_974 142
13 3300048914 Ga0496111_0269293 Ga0496111_0269293_610_1044 142
14 3300048916 Ga0496113_0935808 Ga0496113_0935808_76_510 142
15 3300046459 Ga0495629_0092576 Ga0495629_0092576_1469_1906 143
16 3300046514 Ga0495618_0253354 Ga0495618_0253354_176_613 143
17 3300046529 Ga0495652_0007462 Ga0495652_0007462_4970_5407 143
18 3300046543 Ga0495645_0031398 Ga0495645_0031398_760_1197 143
19 3300046642 Ga0495634_0001402 Ga0495634_0001402_18372_18809 143
20 3300005983 Ga0081540_1000123 Ga0081540_10001233 144
21 3300046539 Ga0495621_0002501 Ga0495621_0002501_3966_4400 144
22 3300048916 Ga0496113_0003344 Ga0496113_0003344_3200_3634 144
23 3300009148 Ga0105243_10027253 Ga0105243_100272537 145
24 3300013296 Ga0157374_10013277 Ga0157374_100132772 145
25 3300013297 Ga0157378_10051353 Ga0157378_100513534 145
26 3300013308 Ga0157375_10003070 Ga0157375_100030705 145
27 3300013308 Ga0157375_10004333 Ga0157375_100043338 145
28 3300014325 Ga0163163_11158041 Ga0163163_111580411 145
29 3300025916 Ga0207663_10080051 Ga0207663_100800513 145
30 3300037853 Ga0436364_1035306 Ga0436364_1035306_508_981 145
31 3300046454 Ga0495592_0158857 Ga0495592_0158857_480_917 145
32 3300046455 Ga0495603_0000033 Ga0495603_0000033_10846_11283 145
33 3300046458 Ga0495591_114202 Ga0495591_114202_155_592 145
34 3300046459 Ga0495629_0031498 Ga0495629_0031498_2609_3046 145
35 3300046459 Ga0495629_0218475 Ga0495629_0218475_505_942 145
36 3300046463 Ga0495653_0058220 Ga0495653_0058220_1789_2226 145
37 3300046463 Ga0495653_0571687 Ga0495653_0571687_232_669 145
38 3300046514 Ga0495618_0000070 Ga0495618_0000070_57050_57487 145
39 3300046535 Ga0495586_0081805 Ga0495586_0081805_588_1025 145
40 3300046559 Ga0495667_0000045 Ga0495667_0000045_82892_83329 145
41 3300046642 Ga0495634_0000045 Ga0495634_0000045_37054_37491 145
42 3300046674 Ga0495588_0169278 Ga0495588_0169278_374_811 145
43 3300046681 Ga0495647_0000023 Ga0495647_0000023_4968_5405 145
44 3300046689 Ga0495613_0000220 Ga0495613_0000220_39919_40356 145
45 3300046690 Ga0495624_0000071 Ga0495624_0000071_53403_53840 145
46 3300046809 Ga0495600_0063488 Ga0495600_0063488_545_982 145
47 3300047322 Ga0495680_0058909 Ga0495680_0058909_1626_2063 145
48 3300047322 Ga0495680_0066060 Ga0495680_0066060_1987_2424 145
49 3300047471 Ga0495684_0085096 Ga0495684_0085096_983_1420 145
50 3300048088 Ga0495602_0031280 Ga0495602_0031280_1134_1571 145
51 3300048907 Ga0496104_0000015 Ga0496104_0000015_75110_75547 145
52 3300048908 Ga0496105_0034930 Ga0496105_0034930_11_448 145
53 3300048911 Ga0496108_0009264 Ga0496108_0009264_1304_1741 145
54 3300048912 Ga0496109_0175020 Ga0496109_0175020_1452_1889 145
55 3300048915 Ga0496112_0000006 Ga0496112_0000006_99629_100066 145
56 3300048916 Ga0496113_0191710 Ga0496113_0191710_1060_1497 145
57 3300049584 Ga0501068_0049638 Ga0501068_0049638_1355_1792 145
58 3300053085 Ga0495619_0000008 Ga0495619_0000008_44442_44879 145
59 3300009101 Ga0105247_10121750 Ga0105247_101217502 148
60 3300049581 Ga0501047_0346569 Ga0501047_0346569_305_802 148
61 3300005544 Ga0070686_100339038 Ga0070686_1003390382 152
62 3300005981 Ga0081538_10143624 Ga0081538_101436242 152
63 3300005983 Ga0081540_1000639 Ga0081540_100063932 152
64 3300005983 Ga0081540_1196929 Ga0081540_11969292 152
65 3300005985 Ga0081539_10136440 Ga0081539_101364402 152
66 3300009098 Ga0105245_10303667 Ga0105245_103036672 152
67 3300010375 Ga0105239_11092735 Ga0105239_110927351 152
68 3300014325 Ga0163163_10483151 Ga0163163_104831512 152
69 3300014326 Ga0157380_10023476 Ga0157380_100234765 152
70 3300026121 Ga0207683_11744216 Ga0207683_117442161 152
71 3300037418 Ga0395900_0474103 Ga0395900_0474103_21_527 152
72 3300037418 Ga0395900_0746971 Ga0395900_0746971_274_780 152
73 3300037418 Ga0395900_0908271 Ga0395900_0908271_33_539 152
74 3300037418 Ga0395900_1045810 Ga0395900_1045810_157_648 152
75 3300037466 Ga0395898_0195388 Ga0395898_0195388_625_1131 152
76 3300037471 Ga0395905_0515418 Ga0395905_0515418_304_810 152
77 3300037471 Ga0395905_0912525 Ga0395905_0912525_232_723 152
78 3300037471 Ga0395905_1090058 Ga0395905_1090058_98_604 152
79 3300038443 Ga0395901_0180203 Ga0395901_0180203_485_976 152
80 3300038443 Ga0395901_1355843 Ga0395901_1355843_81_587 152
81 3300046458 Ga0495591_122506 Ga0495591_122506_51_551 152
82 3300046616 Ga0495668_0024540 Ga0495668_0024540_1090_1548 152
83 3300046681 Ga0495647_0013099 Ga0495647_0013099_746_1204 152
84 3300046683 Ga0495658_0233517 Ga0495658_0233517_412_918 152
85 3300047445 Ga0495677_0091269 Ga0495677_0091269_471_977 152
86 3300048903 Ga0496100_0936473 Ga0496100_0936473_173_664 152
87 3300048915 Ga0496112_0413934 Ga0496112_0413934_598_1089 152
88 3300048916 Ga0496113_0183897 Ga0496113_0183897_63_554 152
89 3300050491 nmdc:mga00v17_523835_c1 nmdc:mga00v17_523835_c1_162_668 152
90 3300005842 Ga0068858_100083875 Ga0068858_1000838753 153
91 3300025944 Ga0207661_11231173 Ga0207661_112311731 153
92 3300026035 Ga0207703_10233624 Ga0207703_102336243 153
93 3300046476 Ga0495662_0038877 Ga0495662_0038877_1202_1669 153
94 3300046533 Ga0495640_0024363 Ga0495640_0024363_1674_2135 153
95 3300046642 Ga0495634_0028701 Ga0495634_0028701_1926_2393 153
96 3300047319 Ga0495674_0000010 Ga0495674_0000010_117745_118206 153
97 3300047444 Ga0495675_0115419 Ga0495675_0115419_1139_1600 153
98 3300047472 Ga0495686_0066193 Ga0495686_0066193_430_891 153
99 3300048912 Ga0496109_0415697 Ga0496109_0415697_624_1091 153
100 3300048915 Ga0496112_0402977 Ga0496112_0402977_786_1253 153
101 3300048916 Ga0496113_0035042 Ga0496113_0035042_374_841 153
102 3300048921 Ga0496118_0228412 Ga0496118_0228412_456_917 153
103 3300046689 Ga0495613_0130334 Ga0495613_0130334_273_752 154
104 3300005441 Ga0070700_100094352 Ga0070700_1000943522 155
105 3300005456 Ga0070678_100794935 Ga0070678_1007949351 155
106 3300005459 Ga0068867_100000204 Ga0068867_10000020419 155
107 3300014968 Ga0157379_10105847 Ga0157379_101058472 155
108 3300026075 Ga0207708_10127228 Ga0207708_101272282 155
109 3300026089 Ga0207648_10000643 Ga0207648_1000064318 155
110 3300026121 Ga0207683_10412863 Ga0207683_104128633 155
111 3300046463 Ga0495653_0299537 Ga0495653_0299537_29_511 155
112 3300046516 Ga0495628_0008170 Ga0495628_0008170_3194_3661 155
113 3300046536 Ga0495587_0414600 Ga0495587_0414600_246_713 155
114 3300046678 Ga0495599_0208885 Ga0495599_0208885_300_776 155
115 3300046683 Ga0495658_0005120 Ga0495658_0005120_394_861 155
116 3300046689 Ga0495613_0467384 Ga0495613_0467384_198_671 155
117 3300048088 Ga0495602_0003667 Ga0495602_0003667_14438_14905 155
118 3300048088 Ga0495602_0196575 Ga0495602_0196575_260_736 155
119 3300048914 Ga0496111_0148446 Ga0496111_0148446_1060_1533 155
120 3300053077 Ga0495601_0469564 Ga0495601_0469564_34_510 155
121 3300000532 CNAas_1006915 CNAas_10069151 156
122 3300001977 JGI24746J21847_1000048 JGI24746J21847_100004812 156
123 3300002239 JGI24034J26672_10010515 JGI24034J26672_100105152 156
124 3300002244 JGI24742J22300_10019848 JGI24742J22300_100198482 156
125 3300003203 JGI25406J46586_10046762 JGI25406J46586_100467621 156
126 3300005329 Ga0070683_100019627 Ga0070683_1000196272 156
127 3300005329 Ga0070683_100053231 Ga0070683_1000532315 156
128 3300005329 Ga0070683_100106093 Ga0070683_1001060932 156
129 3300005330 Ga0070690_100118147 Ga0070690_1001181474 156
130 3300005333 Ga0070677_10000037 Ga0070677_1000003736 156
131 3300005335 Ga0070666_10069888 Ga0070666_100698882 156
132 3300005337 Ga0070682_100000011 Ga0070682_100000011147 156
133 3300005337 Ga0070682_100000030 Ga0070682_10000003054 156
134 3300005338 Ga0068868_100002102 Ga0068868_10000210211 156
135 3300005341 Ga0070691_10000908 Ga0070691_1000090814 156
136 3300005344 Ga0070661_100000608 Ga0070661_10000060816 156
137 3300005353 Ga0070669_100451069 Ga0070669_1004510692 156
138 3300005356 Ga0070674_100000002 Ga0070674_100000002196 156
139 3300005356 Ga0070674_100000007 Ga0070674_10000000717 156
140 3300005365 Ga0070688_100000412 Ga0070688_10000041218 156
141 3300005365 Ga0070688_100022008 Ga0070688_1000220082 156
142 3300005365 Ga0070688_100303465 Ga0070688_1003034652 156
143 3300005365 Ga0070688_100672970 Ga0070688_1006729701 156
144 3300005366 Ga0070659_100301183 Ga0070659_1003011832 156
145 3300005367 Ga0070667_100001123 Ga0070667_1000011239 156
146 3300005435 Ga0070714_100062407 Ga0070714_1000624074 156
147 3300005435 Ga0070714_100819408 Ga0070714_1008194082 156
148 3300005436 Ga0070713_100096958 Ga0070713_1000969581 156
149 3300005439 Ga0070711_100001735 Ga0070711_1000017358 156
150 3300005456 Ga0070678_100383579 Ga0070678_1003835792 156
151 3300005457 Ga0070662_100000002 Ga0070662_100000002109 156
152 3300005466 Ga0070685_10000013 Ga0070685_1000001370 156
153 3300005466 Ga0070685_10007592 Ga0070685_100075928 156
154 3300005466 Ga0070685_10085369 Ga0070685_100853691 156
155 3300005530 Ga0070679_100000181 Ga0070679_10000018117 156
156 3300005535 Ga0070684_100012567 Ga0070684_1000125676 156
157 3300005535 Ga0070684_100074570 Ga0070684_1000745705 156
158 3300005535 Ga0070684_100083172 Ga0070684_1000831722 156
159 3300005535 Ga0070684_100258796 Ga0070684_1002587962 156
160 3300005539 Ga0068853_100025258 Ga0068853_1000252582 156
161 3300005543 Ga0070672_100000083 Ga0070672_10000008316 156
162 3300005547 Ga0070693_100000987 Ga0070693_10000098710 156
163 3300005548 Ga0070665_100000040 Ga0070665_100000040124 156
164 3300005548 Ga0070665_100119714 Ga0070665_1001197142 156
165 3300005548 Ga0070665_100348798 Ga0070665_1003487982 156
166 3300005563 Ga0068855_100328389 Ga0068855_1003283891 156
167 3300005563 Ga0068855_100456808 Ga0068855_1004568082 156
168 3300005577 Ga0068857_100274783 Ga0068857_1002747832 156
169 3300005578 Ga0068854_100000363 Ga0068854_10000036328 156
170 3300005578 Ga0068854_100023409 Ga0068854_1000234092 156
171 3300005614 Ga0068856_100000237 Ga0068856_10000023764 156
172 3300005614 Ga0068856_100027399 Ga0068856_1000273992 156
173 3300005616 Ga0068852_100000002 Ga0068852_10000000274 156
174 3300005616 Ga0068852_100012193 Ga0068852_1000121932 156
175 3300005616 Ga0068852_101055372 Ga0068852_1010553721 156
176 3300005718 Ga0068866_10000003 Ga0068866_10000003158 156
177 3300005718 Ga0068866_10001295 Ga0068866_1000129511 156
178 3300005719 Ga0068861_100246154 Ga0068861_1002461542 156
179 3300005719 Ga0068861_100342948 Ga0068861_1003429482 156
180 3300005834 Ga0068851_10004739 Ga0068851_100047394 156
181 3300005841 Ga0068863_100001530 Ga0068863_10000153015 156
182 3300005842 Ga0068858_100000120 Ga0068858_10000012066 156
183 3300005842 Ga0068858_100006738 Ga0068858_1000067388 156
184 3300005843 Ga0068860_100056918 Ga0068860_1000569182 156
185 3300005843 Ga0068860_100057465 Ga0068860_1000574656 156
186 3300005843 Ga0068860_100956121 Ga0068860_1009561212 156
187 3300005844 Ga0068862_100005726 Ga0068862_1000057269 156
188 3300005937 Ga0081455_10041414 Ga0081455_100414144 156
189 3300005983 Ga0081540_1071063 Ga0081540_10710632 156
190 3300005985 Ga0081539_10004533 Ga0081539_100045338 156
191 3300006163 Ga0070715_10000001 Ga0070715_10000001702 156
192 3300006163 Ga0070715_10110490 Ga0070715_101104902 156
193 3300006175 Ga0070712_100004387 Ga0070712_10000438710 156
194 3300006237 Ga0097621_100651940 Ga0097621_1006519402 156
195 3300006852 Ga0075433_10014316 Ga0075433_100143166 156
196 3300006881 Ga0068865_100000134 Ga0068865_10000013418 156
197 3300009093 Ga0105240_10407549 Ga0105240_104075491 156
198 3300009093 Ga0105240_10617969 Ga0105240_106179691 156
199 3300009098 Ga0105245_10000026 Ga0105245_10000026160 156
200 3300009098 Ga0105245_10000143 Ga0105245_1000014315 156
201 3300009098 Ga0105245_10002179 Ga0105245_1000217915 156
202 3300009098 Ga0105245_10012210 Ga0105245_1001221010 156
203 3300009148 Ga0105243_10053227 Ga0105243_100532275 156
204 3300009174 Ga0105241_10069970 Ga0105241_100699702 156
205 3300009176 Ga0105242_10032261 Ga0105242_100322616 156
206 3300009176 Ga0105242_10105713 Ga0105242_101057133 156
207 3300009177 Ga0105248_10000020 Ga0105248_10000020279 156
208 3300009177 Ga0105248_10117972 Ga0105248_101179722 156
209 3300009551 Ga0105238_10000009 Ga0105238_10000009188 156
210 3300009553 Ga0105249_10000070 Ga0105249_10000070127 156
211 3300009553 Ga0105249_10627246 Ga0105249_106272461 156
212 3300009553 Ga0105249_11054213 Ga0105249_110542131 156
213 3300010375 Ga0105239_10476537 Ga0105239_104765372 156
214 3300011119 Ga0105246_11119237 Ga0105246_111192372 156
215 3300013105 Ga0157369_10000014 Ga0157369_1000001472 156
216 3300013296 Ga0157374_11972016 Ga0157374_119720161 156
217 3300013297 Ga0157378_10093267 Ga0157378_100932674 156
218 3300013297 Ga0157378_11257173 Ga0157378_112571732 156
219 3300013306 Ga0163162_10325302 Ga0163162_103253023 156
220 3300013307 Ga0157372_10000060 Ga0157372_1000006018 156
221 3300013308 Ga0157375_11241477 Ga0157375_112414771 156
222 3300014968 Ga0157379_10033468 Ga0157379_100334683 156
223 3300014968 Ga0157379_10058054 Ga0157379_100580544 156
224 3300017792 Ga0163161_10021169 Ga0163161_100211693 156
225 3300017792 Ga0163161_11708957 Ga0163161_117089571 156
226 3300022467 Ga0224712_10155727 Ga0224712_101557272 156
227 3300025321 Ga0207656_10021074 Ga0207656_100210744 156
228 3300025321 Ga0207656_10028797 Ga0207656_100287972 156
229 3300025893 Ga0207682_10000018 Ga0207682_1000001865 156
230 3300025899 Ga0207642_10000002 Ga0207642_10000002410 156
231 3300025899 Ga0207642_10000634 Ga0207642_1000063411 156
232 3300025900 Ga0207710_10000997 Ga0207710_1000099714 156
233 3300025903 Ga0207680_10000567 Ga0207680_1000056712 156
234 3300025905 Ga0207685_10000005 Ga0207685_1000000529 156
235 3300025911 Ga0207654_10106053 Ga0207654_101060532 156
236 3300025913 Ga0207695_10425791 Ga0207695_104257912 156
237 3300025913 Ga0207695_10518784 Ga0207695_105187842 156
238 3300025915 Ga0207693_10015036 Ga0207693_100150365 156
239 3300025916 Ga0207663_10042943 Ga0207663_100429435 156
240 3300025920 Ga0207649_10000003 Ga0207649_10000003341 156
241 3300025921 Ga0207652_10000371 Ga0207652_1000037130 156
242 3300025923 Ga0207681_10772865 Ga0207681_107728652 156
243 3300025924 Ga0207694_10000004 Ga0207694_10000004108 156
244 3300025925 Ga0207650_10182994 Ga0207650_101829942 156
245 3300025926 Ga0207659_10000368 Ga0207659_1000036810 156
246 3300025927 Ga0207687_10000017 Ga0207687_1000001722 156
247 3300025927 Ga0207687_10000020 Ga0207687_10000020125 156
248 3300025927 Ga0207687_10001467 Ga0207687_1000146712 156
249 3300025927 Ga0207687_10010029 Ga0207687_100100292 156
250 3300025929 Ga0207664_10229876 Ga0207664_102298762 156
251 3300025929 Ga0207664_10995519 Ga0207664_109955191 156
252 3300025932 Ga0207690_10240805 Ga0207690_102408052 156
253 3300025933 Ga0207706_10000001 Ga0207706_10000001289 156
254 3300025934 Ga0207686_10181970 Ga0207686_101819702 156
255 3300025935 Ga0207709_10013906 Ga0207709_100139067 156
256 3300025935 Ga0207709_10161357 Ga0207709_101613571 156
257 3300025936 Ga0207670_10010569 Ga0207670_100105697 156
258 3300025936 Ga0207670_10036018 Ga0207670_100360184 156
259 3300025937 Ga0207669_10000001 Ga0207669_10000001132 156
260 3300025937 Ga0207669_10000003 Ga0207669_1000000398 156
261 3300025938 Ga0207704_10000110 Ga0207704_1000011035 156
262 3300025939 Ga0207665_10063868 Ga0207665_100638684 156
263 3300025940 Ga0207691_10000641 Ga0207691_1000064116 156
264 3300025941 Ga0207711_10000006 Ga0207711_1000000699 156
265 3300025944 Ga0207661_10000867 Ga0207661_1000086710 156
266 3300025944 Ga0207661_10011021 Ga0207661_100110216 156
267 3300025944 Ga0207661_10018898 Ga0207661_100188981 156
268 3300025944 Ga0207661_10033030 Ga0207661_100330301 156
269 3300025945 Ga0207679_10327214 Ga0207679_103272142 156
270 3300025949 Ga0207667_10456553 Ga0207667_104565531 156
271 3300025960 Ga0207651_10037230 Ga0207651_100372303 156
272 3300025961 Ga0207712_10000019 Ga0207712_10000019184 156
273 3300025961 Ga0207712_10026616 Ga0207712_100266166 156
274 3300025961 Ga0207712_10395574 Ga0207712_103955741 156
275 3300025981 Ga0207640_10000110 Ga0207640_1000011058 156
276 3300025981 Ga0207640_10005989 Ga0207640_100059892 156
277 3300025986 Ga0207658_10000724 Ga0207658_100007249 156
278 3300025986 Ga0207658_10182655 Ga0207658_101826552 156
279 3300026023 Ga0207677_10000362 Ga0207677_1000036213 156
280 3300026023 Ga0207677_10004995 Ga0207677_100049958 156
281 3300026035 Ga0207703_10000018 Ga0207703_10000018185 156
282 3300026035 Ga0207703_10000170 Ga0207703_1000017031 156
283 3300026041 Ga0207639_10007449 Ga0207639_100074496 156
284 3300026041 Ga0207639_10087562 Ga0207639_100875622 156
285 3300026075 Ga0207708_10130501 Ga0207708_101305012 156
286 3300026078 Ga0207702_10000251 Ga0207702_100002516 156
287 3300026078 Ga0207702_10007011 Ga0207702_100070114 156
288 3300026088 Ga0207641_10000016 Ga0207641_1000001628 156
289 3300026116 Ga0207674_10280873 Ga0207674_102808732 156
290 3300026118 Ga0207675_100445021 Ga0207675_1004450211 156
291 3300026121 Ga0207683_10031544 Ga0207683_100315442 156
292 3300026121 Ga0207683_10432745 Ga0207683_104327452 156
293 3300026142 Ga0207698_10000004 Ga0207698_10000004211 156
294 3300026142 Ga0207698_10006867 Ga0207698_100068672 156
295 3300027907 Ga0207428_10558653 Ga0207428_105586532 156
296 3300028379 Ga0268266_10000045 Ga0268266_10000045127 156
297 3300028379 Ga0268266_10111412 Ga0268266_101114124 156
298 3300028379 Ga0268266_11201915 Ga0268266_112019151 156
299 3300028380 Ga0268265_10004189 Ga0268265_100041896 156
300 3300028381 Ga0268264_10012280 Ga0268264_100122804 156
301 3300028381 Ga0268264_10042357 Ga0268264_100423572 156
302 3300028381 Ga0268264_10253874 Ga0268264_102538742 156
303 3300028556 Ga0265337_1000034 Ga0265337_100003432 156
304 3300028558 Ga0265326_10000041 Ga0265326_1000004131 156
305 3300028577 Ga0265318_10218035 Ga0265318_102180352 156
306 3300028654 Ga0265322_10000004 Ga0265322_1000000431 156
307 3300028666 Ga0265336_10014153 Ga0265336_100141532 156
308 3300028800 Ga0265338_10158296 Ga0265338_101582962 156
309 3300029957 Ga0265324_10237727 Ga0265324_102377271 156
310 3300030521 Ga0307511_10045873 Ga0307511_100458735 156
311 3300031239 Ga0265328_10003370 Ga0265328_100033706 156
312 3300031240 Ga0265320_10000029 Ga0265320_1000002930 156
313 3300031242 Ga0265329_10003419 Ga0265329_100034194 156
314 3300031249 Ga0265339_10006278 Ga0265339_100062783 156
315 3300031250 Ga0265331_10000526 Ga0265331_1000052632 156
316 3300031251 Ga0265327_10000015 Ga0265327_1000001579 156
317 3300031344 Ga0265316_10016243 Ga0265316_100162434 156
318 3300031595 Ga0265313_10040058 Ga0265313_100400581 156
319 3300031711 Ga0265314_10000119 Ga0265314_1000011948 156
320 3300031731 Ga0307405_10483394 Ga0307405_104833942 156
321 3300032126 Ga0307415_100003139 Ga0307415_1000031398 156
322 3300035117 Ga0373953_0123258 Ga0373953_0123258_28_513 156
323 3300035692 Ga0373935_1056439 Ga0373935_1056439_101_592 156
324 3300036401 Ga0373937_0018727 Ga0373937_0018727_5330_5815 156
325 3300041486 Ga0451807_0042816 Ga0451807_0042816_169_639 156
326 3300041496 Ga0451839_0200805 Ga0451839_0200805_392_862 156
327 3300041501 Ga0451845_0860192 Ga0451845_0860192_45_515 156
328 3300041512 Ga0451853_2679834 Ga0451853_2679834_3661_4146 156
329 3300041512 Ga0451853_3964082 Ga0451853_3964082_388_858 156
330 3300044694 Ga0466963_0000043 Ga0466963_0000043_39155_39640 156
331 3300044694 Ga0466963_0076444 Ga0466963_0076444_573_1043 156
332 3300044694 Ga0466963_0331809 Ga0466963_0331809_115_585 156
333 3300044694 Ga0466963_0403703 Ga0466963_0403703_88_558 156
334 3300044842 Ga0466957_0000293 Ga0466957_0000293_17094_17564 156
335 3300045976 Ga0466967_0000006 Ga0466967_0000006_119555_120025 156
336 3300045976 Ga0466967_0268647 Ga0466967_0268647_764_1243 156
337 3300046455 Ga0495603_0000391 Ga0495603_0000391_2997_3482 156
338 3300046455 Ga0495603_0007880 Ga0495603_0007880_1500_1985 156
339 3300046455 Ga0495603_0204902 Ga0495603_0204902_462_947 156
340 3300046459 Ga0495629_0001657 Ga0495629_0001657_5439_5909 156
341 3300046460 Ga0495638_0015861 Ga0495638_0015861_699_1169 156
342 3300046461 Ga0495641_0000014 Ga0495641_0000014_53637_54122 156
343 3300046461 Ga0495641_0022653 Ga0495641_0022653_1417_1887 156
344 3300046461 Ga0495641_0170627 Ga0495641_0170627_128_613 156
345 3300046462 Ga0495651_0395099 Ga0495651_0395099_198_668 156
346 3300046463 Ga0495653_0015144 Ga0495653_0015144_681_1151 156
347 3300046463 Ga0495653_0599176 Ga0495653_0599176_127_612 156
348 3300046473 Ga0495582_0000009 Ga0495582_0000009_76405_76875 156
349 3300046473 Ga0495582_0738497 Ga0495582_0738497_62_538 156
350 3300046476 Ga0495662_0000001 Ga0495662_0000001_143637_144122 156
351 3300046476 Ga0495662_0002954 Ga0495662_0002954_5371_5841 156
352 3300046476 Ga0495662_0200633 Ga0495662_0200633_274_759 156
353 3300046476 Ga0495662_0381565 Ga0495662_0381565_87_557 156
354 3300046499 Ga0495594_0000006 Ga0495594_0000006_122984_123454 156
355 3300046499 Ga0495594_0585896 Ga0495594_0585896_88_558 156
356 3300046507 Ga0495606_0000463 Ga0495606_0000463_60845_61330 156
357 3300046511 Ga0495608_0000007 Ga0495608_0000007_306349_306819 156
358 3300046511 Ga0495608_0000361 Ga0495608_0000361_5340_5825 156
359 3300046515 Ga0495620_0000215 Ga0495620_0000215_7351_7836 156
360 3300046516 Ga0495628_0072311 Ga0495628_0072311_160_645 156
361 3300046516 Ga0495628_0197377 Ga0495628_0197377_756_1241 156
362 3300046516 Ga0495628_0240945 Ga0495628_0240945_67_552 156
363 3300046517 Ga0495630_0000060 Ga0495630_0000060_17436_17906 156
364 3300046517 Ga0495630_0002249 Ga0495630_0002249_5370_5855 156
365 3300046529 Ga0495652_0000010 Ga0495652_0000010_93879_94349 156
366 3300046533 Ga0495640_0031669 Ga0495640_0031669_3164_3649 156
367 3300046536 Ga0495587_0308331 Ga0495587_0308331_198_668 156
368 3300046537 Ga0495598_0004462 Ga0495598_0004462_702_1187 156
369 3300046543 Ga0495645_0045277 Ga0495645_0045277_478_963 156
370 3300046557 Ga0495622_0000297 Ga0495622_0000297_31487_31957 156
371 3300046559 Ga0495667_0037656 Ga0495667_0037656_1759_2244 156
372 3300046615 Ga0495656_0001136 Ga0495656_0001136_954_1439 156
373 3300046660 Ga0495625_0000032 Ga0495625_0000032_153046_153516 156
374 3300046660 Ga0495625_0288905 Ga0495625_0288905_333_806 156
375 3300046663 Ga0495635_0000074 Ga0495635_0000074_40904_41389 156
376 3300046663 Ga0495635_0093153 Ga0495635_0093153_765_1250 156
377 3300046674 Ga0495588_0001071 Ga0495588_0001071_5505_5975 156
378 3300046675 Ga0495657_0000001 Ga0495657_0000001_438495_438965 156
379 3300046675 Ga0495657_0004097 Ga0495657_0004097_9484_9969 156
380 3300046678 Ga0495599_0047195 Ga0495599_0047195_449_934 156
381 3300046679 Ga0495623_0385519 Ga0495623_0385519_182_667 156
382 3300046681 Ga0495647_0000063 Ga0495647_0000063_21068_21538 156
383 3300046683 Ga0495658_0000002 Ga0495658_0000002_76400_76870 156
384 3300046683 Ga0495658_0494867 Ga0495658_0494867_158_643 156
385 3300046684 Ga0495669_0000261 Ga0495669_0000261_22745_23230 156
386 3300046689 Ga0495613_0000032 Ga0495613_0000032_91803_92273 156
387 3300046690 Ga0495624_0000243 Ga0495624_0000243_14594_15064 156
388 3300046690 Ga0495624_0115319 Ga0495624_0115319_271_756 156
389 3300046691 Ga0495670_0017664 Ga0495670_0017664_1860_2351 156
390 3300046694 Ga0495649_0003945 Ga0495649_0003945_3883_4368 156
391 3300046809 Ga0495600_0003218 Ga0495600_0003218_8501_8986 156
392 3300046809 Ga0495600_0193856 Ga0495600_0193856_777_1262 156
393 3300047317 Ga0495604_0000927 Ga0495604_0000927_181_651 156
394 3300047317 Ga0495604_0001215 Ga0495604_0001215_20639_21109 156
395 3300047321 Ga0495676_0000136 Ga0495676_0000136_14822_15307 156
396 3300047321 Ga0495676_0005715 Ga0495676_0005715_3810_4280 156
397 3300047321 Ga0495676_0014346 Ga0495676_0014346_6058_6528 156
398 3300047322 Ga0495680_0000472 Ga0495680_0000472_41599_42084 156
399 3300047322 Ga0495680_0000486 Ga0495680_0000486_30799_31284 156
400 3300047322 Ga0495680_0116046 Ga0495680_0116046_1141_1611 156
401 3300047322 Ga0495680_0489018 Ga0495680_0489018_203_688 156
402 3300047444 Ga0495675_0000017 Ga0495675_0000017_6683_7153 156
403 3300047446 Ga0495679_019804 Ga0495679_019804_309_794 156
404 3300047447 Ga0495685_004050 Ga0495685_004050_1638_2123 156
405 3300047673 Ga0495593_0137049 Ga0495593_0137049_308_778 156
406 3300048088 Ga0495602_0000007 Ga0495602_0000007_7749_8219 156
407 3300048088 Ga0495602_0315934 Ga0495602_0315934_548_1033 156
408 3300048089 Ga0495614_0187051 Ga0495614_0187051_311_796 156
409 3300048903 Ga0496100_0000001 Ga0496100_0000001_257004_257474 156
410 3300048903 Ga0496100_0000014 Ga0496100_0000014_133018_133503 156
411 3300048904 Ga0496101_0000004 Ga0496101_0000004_58356_58826 156
412 3300048904 Ga0496101_0000036 Ga0496101_0000036_133622_134107 156
413 3300048904 Ga0496101_1204545 Ga0496101_1204545_24_500 156
414 3300048905 Ga0496102_0976081 Ga0496102_0976081_60_533 156
415 3300048906 Ga0496103_0000057 Ga0496103_0000057_53162_53632 156
416 3300048907 Ga0496104_0000024 Ga0496104_0000024_129213_129698 156
417 3300048907 Ga0496104_0000866 Ga0496104_0000866_9396_9866 156
418 3300048907 Ga0496104_0038236 Ga0496104_0038236_3826_4302 156
419 3300048908 Ga0496105_0000004 Ga0496105_0000004_400252_400722 156
420 3300048908 Ga0496105_0000013 Ga0496105_0000013_100216_100701 156
421 3300048908 Ga0496105_0000059 Ga0496105_0000059_29672_30142 156
422 3300048908 Ga0496105_0748067 Ga0496105_0748067_222_698 156
423 3300048909 Ga0496106_0000091 Ga0496106_0000091_50669_51139 156
424 3300048909 Ga0496106_0000111 Ga0496106_0000111_39333_39818 156
425 3300048909 Ga0496106_0000795 Ga0496106_0000795_5440_5925 156
426 3300048910 Ga0496107_0000005 Ga0496107_0000005_272774_273244 156
427 3300048910 Ga0496107_0000022 Ga0496107_0000022_87018_87503 156
428 3300048910 Ga0496107_0012674 Ga0496107_0012674_459_944 156
429 3300048911 Ga0496108_0000006 Ga0496108_0000006_98098_98583 156
430 3300048911 Ga0496108_0000026 Ga0496108_0000026_18965_19435 156
431 3300048911 Ga0496108_0001422 Ga0496108_0001422_14763_15248 156
432 3300048911 Ga0496108_1051529 Ga0496108_1051529_49_519 156
433 3300048912 Ga0496109_0000004 Ga0496109_0000004_270841_271326 156
434 3300048912 Ga0496109_0000012 Ga0496109_0000012_174818_175288 156
435 3300048912 Ga0496109_0000056 Ga0496109_0000056_35676_36146 156
436 3300048912 Ga0496109_0001040 Ga0496109_0001040_17377_17862 156
437 3300048912 Ga0496109_0642730 Ga0496109_0642730_101_571 156
438 3300048913 Ga0496110_0000750 Ga0496110_0000750_18822_19292 156
439 3300048913 Ga0496110_0013308 Ga0496110_0013308_2445_2930 156
440 3300048913 Ga0496110_0072871 Ga0496110_0072871_313_798 156
441 3300048913 Ga0496110_0282282 Ga0496110_0282282_499_969 156
442 3300048914 Ga0496111_0000047 Ga0496111_0000047_41946_42416 156
443 3300048914 Ga0496111_0050802 Ga0496111_0050802_1887_2357 156
444 3300048914 Ga0496111_0252334 Ga0496111_0252334_722_1213 156
445 3300048915 Ga0496112_0000566 Ga0496112_0000566_5214_5684 156
446 3300048915 Ga0496112_0213911 Ga0496112_0213911_691_1161 156
447 3300048916 Ga0496113_0000037 Ga0496113_0000037_15722_16192 156
448 3300048916 Ga0496113_0090841 Ga0496113_0090841_601_1071 156
449 3300048916 Ga0496113_0910694 Ga0496113_0910694_97_582 156
450 3300048917 Ga0496114_0012163 Ga0496114_0012163_2324_2809 156
451 3300048917 Ga0496114_0374111 Ga0496114_0374111_322_807 156
452 3300048918 Ga0496115_0000525 Ga0496115_0000525_8687_9172 156
453 3300048920 Ga0496117_0077842 Ga0496117_0077842_217_693 156
454 3300048920 Ga0496117_0191134 Ga0496117_0191134_371_844 156
455 3300048920 Ga0496117_0413237 Ga0496117_0413237_188_664 156
456 3300048921 Ga0496118_0317397 Ga0496118_0317397_165_638 156
457 3300048922 Ga0496119_0062828 Ga0496119_0062828_666_1142 156
458 3300048923 Ga0496120_0263833 Ga0496120_0263833_46_540 156
459 3300048924 Ga0496121_0008006 Ga0496121_0008006_11210_11686 156
460 3300048927 Ga0496124_0108892 Ga0496124_0108892_370_864 156
461 3300048927 Ga0496124_0518313 Ga0496124_0518313_149_622 156
462 3300048928 Ga0496125_0048312 Ga0496125_0048312_867_1352 156
463 3300048928 Ga0496125_0282058 Ga0496125_0282058_537_1013 156
464 3300048929 Ga0496126_0030735 Ga0496126_0030735_918_1412 156
465 3300049569 Ga0501032_0217894 Ga0501032_0217894_292_768 156
466 3300049578 Ga0501042_0030117 Ga0501042_0030117_1224_1709 156
467 3300049578 Ga0501042_0074672 Ga0501042_0074672_468_938 156
468 3300049578 Ga0501042_0258254 Ga0501042_0258254_105_590 156
469 3300049584 Ga0501068_0203026 Ga0501068_0203026_597_1067 156
470 3300049586 Ga0501070_0009917 Ga0501070_0009917_4113_4589 156
471 3300049586 Ga0501070_0169220 Ga0501070_0169220_1260_1730 156
472 3300049586 Ga0501070_0319069 Ga0501070_0319069_622_1092 156
473 3300049591 Ga0501075_0000699 Ga0501075_0000699_16360_16845 156
474 3300049741 Ga0501079_0773403 Ga0501079_0773403_12_482 156
475 3300049741 Ga0501079_1201216 Ga0501079_1201216_20_490 156
476 3300049744 Ga0501083_0029279 Ga0501083_0029279_3139_3615 156
477 3300050515 nmdc:mga0a205_13_c1 nmdc:mga0a205_13_c1_79357_79842 156
478 3300050515 nmdc:mga0a205_337_c1 nmdc:mga0a205_337_c1_16041_16526 156
479 3300053077 Ga0495601_0000099 Ga0495601_0000099_3739_4209 156
480 3300053077 Ga0495601_0000887 Ga0495601_0000887_10467_10952 156
481 3300053077 Ga0495601_0059700 Ga0495601_0059700_179_649 156
482 3300053080 Ga0500635_0272434 Ga0500635_0272434_74_550 156
483 3300053083 Ga0495655_0000005 Ga0495655_0000005_16050_16520 156
484 3300053083 Ga0495655_0000547 Ga0495655_0000547_5409_5879 156
485 3300053084 Ga0495595_0000002 Ga0495595_0000002_6677_7147 156
486 3300053084 Ga0495595_0001245 Ga0495595_0001245_8434_8919 156
487 3300053085 Ga0495619_0000082 Ga0495619_0000082_43557_44027 156
488 3300053085 Ga0495619_0000183 Ga0495619_0000183_6677_7147 156
489 3300053085 Ga0495619_0000376 Ga0495619_0000376_26986_27471 156
490 3300053094 Ga0500566_0005771 Ga0500566_0005771_5456_5926 156
491 3300053094 Ga0500566_0084297 Ga0500566_0084297_284_760 156
492 3300053119 Ga0500595_029677 Ga0500595_029677_387_863 156
493 3300053123 Ga0500614_000077 Ga0500614_000077_18613_19098 156
494 3300053129 Ga0500628_000001 Ga0500628_000001_72291_72761 156
495 3300054114 Ga0501084_0954844 Ga0501084_0954844_190_666 156
496 3300060353 Ga0501082_0380888 Ga0501082_0380888_283_753 156

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

25

134

0.93

PF08445

FR47

FR47-like protein

63

143

0.88

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

26

148

0.87

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

52

136

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
5isv-assembly2.cif.gz_B crystal structure of the ribosomal-protein-s18-alanine n-acetyltransferase from escherichia coli 0.9246 16 155
3v8h-assembly1.cif.gz_D crystal structure of thymidylate synthase from burkholderia thailandensis 0.9242 112 155
4qvt-assembly5.cif.gz_H crystal structure of predicted n-acyltransferase (ypea) in complex with acetyl-coa from escherichia coli 0.9121 17 136
2cnt-assembly4.cif.gz_D rimi - ribosomal s18 n-alpha-protein acetyltransferase in complex with coenzymea. 0.9117 16 155
4qvt-assembly2.cif.gz_D crystal structure of predicted n-acyltransferase (ypea) in complex with acetyl-coa from escherichia coli 0.9087 17 136
ID Description Score Start End Superfamily
af_I6YG32_8_156_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9574 17 156 3.40.630.30
af_C7IYZ1_1_59_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9403 112 154 3.40.630.30
af_Q58925_1_145_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.939 17 154 3.40.630.30
af_Q555H5_1389_1473_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9385 66 106 3.40.630.30
af_Q2FWL1_1_136_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9249 27 156 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A538LRL0-F1-model_v4 Ribosomal-protein-alanine N-acetyltransferase 0.989 17 155 GO:0008080
AF-A0A7V9LFD8-F1-model_v4 Ribosomal protein S18-alanine N-acetyltransferase 0.9852 16 155 GO:0005840
GO:0008080
AF-A0A6J4S7N2-F1-model_v4 Ribosomal-protein-S18p-alanine acetyltransferase (EC 2.3.1.128) 0.983 14 155 GO:0008999
AF-A0A419GN36-F1-model_v4 [Ribosomal protein bS18]-alanine N-acetyltransferase (EC 2.3.1.266) 0.9784 16 156 GO:0005737
GO:0008999
AF-A0A1C3FEG0-F1-model_v4 deleted 0.9754 16 156

Feature Viewer

pLDDT pTM Quality
88.24 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map