F454939

General Info

Members Datasets Scaffolds Average Seq Length
496 270 992 129

Family's Representative Sequence

Representative Sequence 3300046543|Ga0495645_0420037|Ga0495645_0420037_17_472
Length 151
Sequence VNKLAIRTEAAPAPFQGAPYSQAINANGFVFVSGQLGLLPDHSTVVDGGITAQTEQVFANLRAILDEAGSGLDRLVKTTVFLTDLGNFAAMNEVYAKHVGHGSSGRHRLARKSTDASSAVAFRGGVWHVCGASRDDEDRRPGLRPARKRAC

Samples

Sample ID Description Type Environment
1 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
148 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
149 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
150 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
151 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
152 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
153 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
154 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
155 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
156 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
157 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
158 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
159 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
160 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
161 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
162 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
163 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
164 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
165 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
166 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
169 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
170 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
171 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
172 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
173 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
174 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
175 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
176 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
177 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
178 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
179 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
180 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
181 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
182 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
183 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
184 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
185 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
186 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
187 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
188 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
189 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
190 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
191 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
192 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
193 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
194 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
195 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
196 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
197 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
198 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
199 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
200 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
201 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
202 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
203 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
204 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
205 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
206 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
207 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
208 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
209 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
210 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
211 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
212 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
213 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
214 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
215 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
216 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
217 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
218 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
219 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
220 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
221 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
222 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
223 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
224 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
225 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
226 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
227 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
228 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
229 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
230 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
231 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
232 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
233 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
234 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
235 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
236 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
237 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
238 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
239 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
240 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
241 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
242 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
243 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
244 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
245 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
248 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
249 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
250 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
251 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
252 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
253 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
254 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
255 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
256 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
257 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
258 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
259 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
260 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
261 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
262 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
263 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
264 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
265 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
266 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
267 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
268 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
269 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
270 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.6
Metatranscriptomes 0.4
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.61
Nodule 0
Rhizoplane 19.76
Rhizosphere 78.43
Stem 0
Stem Tuber 0
Unclassified 7.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495645_0420037 3300046543 Bacteria 849
2 Ga0070658_10412405 3300005327 Bacteria 1161
3 Ga0070683_100015609 3300005329 Bacteria 6676
4 Ga0070683_100103350 3300005329 Bacteria 2685
5 Ga0070683_100123145 3300005329 Bacteria 2450
6 Ga0070683_100177550 3300005329 Bacteria 2021
7 Ga0070683_101928219 3300005329 Bacteria 568
8 Ga0070683_102091580 3300005329 Bacteria 544
9 Ga0070690_100031699 3300005330 Bacteria 3295
10 Ga0068869_101432542 3300005334 Bacteria 612
11 Ga0070666_10487653 3300005335 Unclassified 893
12 Ga0070680_100051044 3300005336 Bacteria 3374
13 Ga0070682_100003925 3300005337 Bacteria 8252
14 Ga0070682_100260826 3300005337 Bacteria 1254
15 Ga0070682_101048481 3300005337 Unclassified 680
16 Ga0068868_100021366 3300005338 Bacteria 4873
17 Ga0068868_100161339 3300005338 Bacteria 1851
18 Ga0070691_10217038 3300005341 Unclassified 1012
19 Ga0070687_100021412 3300005343 Bacteria 3039
20 Ga0070668_101262395 3300005347 Unclassified 671
21 Ga0070669_100211029 3300005353 Bacteria 1532
22 Ga0070671_100424426 3300005355 Bacteria 1139
23 Ga0070671_101916958 3300005355 Bacteria 527
24 Ga0070674_100427006 3300005356 Bacteria 1089
25 Ga0070673_102177582 3300005364 Bacteria 527
26 Ga0070688_100105275 3300005365 Bacteria 1867
27 Ga0070659_100806208 3300005366 Bacteria 817
28 Ga0070703_10289409 3300005406 Unclassified 679
29 Ga0070709_10009705 3300005434 Bacteria 5317
30 Ga0070714_100012426 3300005435 Bacteria 6799
31 Ga0070713_100212905 3300005436 Bacteria 1750
32 Ga0070713_100225688 3300005436 Bacteria 1701
33 Ga0070713_100423369 3300005436 Bacteria 1247
34 Ga0070710_10663138 3300005437 Bacteria 732
35 Ga0070701_10342371 3300005438 Unclassified 932
36 Ga0070711_100149630 3300005439 Bacteria 1759
37 Ga0070711_100226004 3300005439 Bacteria 1457
38 Ga0070711_100479917 3300005439 Bacteria 1022
39 Ga0070711_100653963 3300005439 Bacteria 881
40 Ga0070705_100113744 3300005440 Bacteria 1734
41 Ga0070705_100161650 3300005440 Bacteria 1498
42 Ga0070705_100421374 3300005440 Bacteria 994
43 Ga0070700_100268967 3300005441 Bacteria 1230
44 Ga0070700_100595307 3300005441 Bacteria 865
45 Ga0070694_100020493 3300005444 Bacteria 4215
46 Ga0070708_100030236 3300005445 Bacteria 4681
47 Ga0070708_100261122 3300005445 Bacteria 1628
48 Ga0070708_100513627 3300005445 Bacteria 1130
49 Ga0070663_100387254 3300005455 Bacteria 1140
50 Ga0070678_100015166 3300005456 Bacteria 4890
51 Ga0070678_100184013 3300005456 Bacteria 1713
52 Ga0070662_100119302 3300005457 Bacteria 2020
53 Ga0070685_10625810 3300005466 Bacteria 777
54 Ga0070706_100047295 3300005467 Bacteria 3970
55 Ga0070707_100538224 3300005468 Bacteria 1130
56 Ga0070679_100110173 3300005530 Bacteria 2739
57 Ga0070679_100259890 3300005530 Bacteria 1692
58 Ga0070684_100019717 3300005535 Bacteria 5582
59 Ga0070684_100140510 3300005535 Bacteria 2183
60 Ga0070684_101564062 3300005535 Bacteria 622
61 Ga0070686_100060955 3300005544 Bacteria 2436
62 Ga0070695_100610891 3300005545 Bacteria 857
63 Ga0070696_100100932 3300005546 Bacteria 2068
64 Ga0070696_100197366 3300005546 Bacteria 1500
65 Ga0070693_100025570 3300005547 Bacteria 3180
66 Ga0070693_100081160 3300005547 Bacteria 1933
67 Ga0070693_100181995 3300005547 Bacteria 1353
68 Ga0070665_100881137 3300005548 Bacteria 908
69 Ga0070704_100066980 3300005549 Bacteria 2591
70 Ga0068855_100071334 3300005563 Bacteria 4039
71 Ga0068855_100417177 3300005563 Bacteria 1469
72 Ga0068855_101066653 3300005563 Unclassified 846
73 Ga0068854_100122046 3300005578 Bacteria 1980
74 Ga0068854_100225185 3300005578 Bacteria 1486
75 Ga0068856_100275378 3300005614 Bacteria 1699
76 Ga0068856_100686038 3300005614 Bacteria 1045
77 Ga0068856_102375846 3300005614 Bacteria 538
78 Ga0068856_102613718 3300005614 Unclassified 511
79 Ga0070702_100027011 3300005615 Bacteria 3092
80 Ga0068852_102687541 3300005616 Bacteria 517
81 Ga0068859_101768101 3300005617 Bacteria 683
82 Ga0068864_100026913 3300005618 Bacteria 4851
83 Ga0068866_10151467 3300005718 Bacteria 1343
84 Ga0068861_100328176 3300005719 Bacteria 1335
85 Ga0068870_10892984 3300005840 Bacteria 627
86 Ga0068860_100634964 3300005843 Unclassified 1075
87 Ga0081455_10077739 3300005937 Bacteria 2729
88 Ga0081455_10341307 3300005937 Bacteria 1060
89 Ga0081538_10000286 3300005981 Bacteria 57937
90 Ga0070717_10176542 3300006028 Bacteria 1860
91 Ga0070717_10282735 3300006028 Bacteria 1472
92 Ga0070717_10935558 3300006028 Bacteria 789
93 Ga0075364_10017096 3300006051 Bacteria 4525
94 Ga0075364_10165948 3300006051 Unclassified 1492
95 Ga0070715_10014642 3300006163 Bacteria 2908
96 Ga0070715_10785103 3300006163 Bacteria 577
97 Ga0070716_100006503 3300006173 Bacteria 5711
98 Ga0070716_100144044 3300006173 Bacteria 1524
99 Ga0070712_100014439 3300006175 Bacteria 5069
100 Ga0070712_100323407 3300006175 Bacteria 1255
101 Ga0070712_100818209 3300006175 Bacteria 800
102 Ga0070712_101004578 3300006175 Bacteria 722
103 Ga0075367_10495038 3300006178 Bacteria 775
104 Ga0075427_10019528 3300006194 Unclassified 1069
105 Ga0075366_10139674 3300006195 Unclassified 1464
106 Ga0097621_100053819 3300006237 Bacteria 3280
107 Ga0097621_100446140 3300006237 Bacteria 1165
108 Ga0097621_100734591 3300006237 Bacteria 911
109 Ga0068871_100023679 3300006358 Bacteria 4753
110 Ga0068871_100732264 3300006358 Unclassified 908
111 Ga0075430_100310742 3300006846 Unclassified 1303
112 Ga0075431_101394404 3300006847 Unclassified 660
113 Ga0075433_10494292 3300006852 Bacteria 1077
114 Ga0075434_100043506 3300006871 Bacteria 4454
115 Ga0075434_100083174 3300006871 Bacteria 3198
116 Ga0075434_100558991 3300006871 Bacteria 1164
117 Ga0075434_102307109 3300006871 Unclassified 541
118 Ga0075429_100120378 3300006880 Bacteria 2294
119 Ga0075429_101661271 3300006880 Bacteria 555
120 Ga0068865_100085256 3300006881 Bacteria 2278
121 Ga0075436_100319699 3300006914 Bacteria 1115
122 Ga0097620_101767952 3300006931 Bacteria 683
123 Ga0075435_100042253 3300007076 Bacteria 3647
124 Ga0075435_100097593 3300007076 Bacteria 2432
125 Ga0075435_100311819 3300007076 Bacteria 1346
126 Ga0075435_101118718 3300007076 Bacteria 689
127 Ga0105240_10066619 3300009093 Bacteria 4466
128 Ga0105240_11545277 3300009093 Bacteria 695
129 Ga0105240_12019966 3300009093 Bacteria 599
130 Ga0105245_10013881 3300009098 Bacteria 7017
131 Ga0105245_10356664 3300009098 Bacteria 1450
132 Ga0105245_10866910 3300009098 Bacteria 943
133 Ga0105245_11539071 3300009098 Bacteria 716
134 Ga0105247_10671995 3300009101 Bacteria 776
135 Ga0114129_11175658 3300009147 Bacteria 957
136 Ga0114129_12873189 3300009147 Bacteria 570
137 Ga0114129_13481632 3300009147 Bacteria 504
138 Ga0105243_10235091 3300009148 Bacteria 1628
139 Ga0105241_10046462 3300009174 Bacteria 3297
140 Ga0105241_10161977 3300009174 Bacteria 1840
141 Ga0105241_10762034 3300009174 Bacteria 888
142 Ga0105242_10391446 3300009176 Bacteria 1294
143 Ga0105242_10631530 3300009176 Bacteria 1039
144 Ga0105248_10191057 3300009177 Bacteria 2307
145 Ga0105248_10570345 3300009177 Bacteria 1277
146 Ga0105248_10813615 3300009177 Bacteria 1054
147 Ga0105248_10975717 3300009177 Bacteria 957
148 Ga0105237_10306289 3300009545 Bacteria 1592
149 Ga0105249_10227968 3300009553 Bacteria 1836
150 Ga0105249_10377884 3300009553 Bacteria 1442
151 Ga0105249_12597039 3300009553 Bacteria 579
152 Ga0105239_10399185 3300010375 Bacteria 1556
153 Ga0105246_10785279 3300011119 Bacteria 843
154 Ga0157343_1013194 3300012488 Bacteria 664
155 Ga0157373_10683718 3300013100 Bacteria 751
156 Ga0157371_10229339 3300013102 Bacteria 1334
157 Ga0157371_10490669 3300013102 Bacteria 906
158 Ga0157370_10051822 3300013104 Bacteria 3919
159 Ga0157370_10972638 3300013104 Unclassified 769
160 Ga0157369_10003170 3300013105 Bacteria 19626
161 Ga0157378_10087974 3300013297 Bacteria 2818
162 Ga0157372_10227491 3300013307 Bacteria 2162
163 Ga0157375_10119951 3300013308 Bacteria 2738
164 Ga0157375_10122785 3300013308 Bacteria 2709
165 Ga0157375_10222440 3300013308 Bacteria 2046
166 Ga0157375_10350425 3300013308 Bacteria 1642
167 Ga0163163_10003631 3300014325 Bacteria 13119
168 Ga0163163_10717672 3300014325 Bacteria 1063
169 Ga0157380_10050402 3300014326 Bacteria 3288
170 Ga0157376_10012385 3300014969 Bacteria 6329
171 Ga0163161_10669378 3300017792 Bacteria 862
172 Ga0206356_10268726 3300020070 Bacteria 941
173 Ga0206354_11515628 3300020081 Bacteria 1053
174 Ga0207692_10092368 3300025898 Bacteria 1644
175 Ga0207692_10278533 3300025898 Bacteria 1011
176 Ga0207692_10608539 3300025898 Unclassified 703
177 Ga0207642_10067380 3300025899 Bacteria 1689
178 Ga0207680_10739001 3300025903 Bacteria 705
179 Ga0207680_10881015 3300025903 Bacteria 642
180 Ga0207685_10680244 3300025905 Bacteria 559
181 Ga0207699_10008907 3300025906 Bacteria 4975
182 Ga0207645_10855623 3300025907 Bacteria 618
183 Ga0207643_10689003 3300025908 Bacteria 660
184 Ga0207705_10060608 3300025909 Bacteria 2733
185 Ga0207705_10104892 3300025909 Bacteria 2083
186 Ga0207654_10668624 3300025911 Bacteria 745
187 Ga0207695_10151257 3300025913 Bacteria 2260
188 Ga0207693_10001862 3300025915 Bacteria 18464
189 Ga0207693_10003040 3300025915 Bacteria 14500
190 Ga0207693_10235290 3300025915 Bacteria 1438
191 Ga0207693_10640883 3300025915 Bacteria 826
192 Ga0207663_10043994 3300025916 Bacteria 2738
193 Ga0207663_10065658 3300025916 Bacteria 2320
194 Ga0207663_10204234 3300025916 Bacteria 1428
195 Ga0207663_10593748 3300025916 Bacteria 869
196 Ga0207660_10283545 3300025917 Bacteria 1315
197 Ga0207660_11495589 3300025917 Unclassified 546
198 Ga0207662_10029036 3300025918 Bacteria 3201
199 Ga0207657_10249664 3300025919 Bacteria 1415
200 Ga0207657_10280397 3300025919 Bacteria 1323
201 Ga0207652_10302618 3300025921 Bacteria 1443
202 Ga0207687_10153266 3300025927 Bacteria 1761
203 Ga0207687_10322610 3300025927 Bacteria 1251
204 Ga0207687_11203661 3300025927 Bacteria 651
205 Ga0207700_10208029 3300025928 Bacteria 1652
206 Ga0207664_10020198 3300025929 Bacteria 4933
207 Ga0207664_10101443 3300025929 Bacteria 2378
208 Ga0207644_10712189 3300025931 Bacteria 837
209 Ga0207706_10033389 3300025933 Bacteria 4581
210 Ga0207709_10249451 3300025935 Bacteria 1296
211 Ga0207670_10470944 3300025936 Unclassified 1016
212 Ga0207670_11750443 3300025936 Unclassified 529
213 Ga0207669_10369653 3300025937 Bacteria 1114
214 Ga0207669_10867262 3300025937 Unclassified 752
215 Ga0207704_10454159 3300025938 Unclassified 1023
216 Ga0207665_10000344 3300025939 Bacteria 32292
217 Ga0207665_10227564 3300025939 Bacteria 1369
218 Ga0207711_10580316 3300025941 Bacteria 1046
219 Ga0207711_10840738 3300025941 Bacteria 854
220 Ga0207711_11258949 3300025941 Bacteria 682
221 Ga0207711_11513165 3300025941 Unclassified 614
222 Ga0207661_10182674 3300025944 Bacteria 1833
223 Ga0207661_10239492 3300025944 Bacteria 1609
224 Ga0207661_10277052 3300025944 Bacteria 1498
225 Ga0207661_10426397 3300025944 Bacteria 1205
226 Ga0207661_10450541 3300025944 Bacteria 1172
227 Ga0207661_10599909 3300025944 Bacteria 1011
228 Ga0207661_11266584 3300025944 Bacteria 678
229 Ga0207679_10249509 3300025945 Bacteria 1508
230 Ga0207667_10030954 3300025949 Bacteria 5782
231 Ga0207667_11145505 3300025949 Bacteria 759
232 Ga0207667_11192960 3300025949 Unclassified 741
233 Ga0207651_10536266 3300025960 Bacteria 1016
234 Ga0207712_10092212 3300025961 Bacteria 2233
235 Ga0207640_10291206 3300025981 Bacteria 1287
236 Ga0207640_10379337 3300025981 Bacteria 1145
237 Ga0207677_10065558 3300026023 Bacteria 2534
238 Ga0207677_10093372 3300026023 Bacteria 2193
239 Ga0207677_11311542 3300026023 Bacteria 665
240 Ga0207703_10897500 3300026035 Bacteria 848
241 Ga0207678_10071431 3300026067 Bacteria 2976
242 Ga0207708_10092817 3300026075 Bacteria 2330
243 Ga0207708_10367835 3300026075 Bacteria 1183
244 Ga0207702_10457211 3300026078 Unclassified 1239
245 Ga0207702_11005935 3300026078 Bacteria 827
246 Ga0207702_11572290 3300026078 Bacteria 651
247 Ga0207702_12014356 3300026078 Bacteria 568
248 Ga0207648_10009856 3300026089 Bacteria 9110
249 Ga0207675_100521706 3300026118 Bacteria 1184
250 Ga0207683_10001247 3300026121 Bacteria 23079
251 Ga0207683_10056306 3300026121 Bacteria 3448
252 Ga0207428_10003005 3300027907 Bacteria 16638
253 Ga0268266_11111343 3300028379 Bacteria 765
254 Ga0268265_10192235 3300028380 Bacteria 1764
255 Ga0268264_10478001 3300028381 Bacteria 1211
256 Ga0265338_10220324 3300028800 Bacteria 1418
257 Ga0265340_10178579 3300031247 Bacteria 960
258 Ga0265331_10262497 3300031250 Bacteria 774
259 Ga0307409_100036472 3300031995 Bacteria 3615
260 Ga0307409_102177998 3300031995 Bacteria 584
261 Ga0307416_100038053 3300032002 Bacteria 3708
262 Ga0307416_100487995 3300032002 Bacteria 1293
263 Ga0307415_100130075 3300032126 Bacteria 1904
264 Ga0373959_0057529 3300034820 Bacteria 853
265 Ga0373938_0107849 3300034957 Bacteria 706
266 Ga0373929_0017813 3300035085 Bacteria 1406
267 Ga0373932_0140683 3300035112 Unclassified 820
268 Ga0373939_0148721 3300035114 Bacteria 851
269 Ga0373960_0056953 3300035121 Bacteria 1175
270 Ga0373943_0299944 3300035170 Bacteria 912
271 Ga0373942_0027295 3300035207 Bacteria 1484
272 Ga0373942_0270049 3300035207 Bacteria 583
273 Ga0373961_0054591 3300035241 Bacteria 1195
274 Ga0373962_0069627 3300035242 Unclassified 1049
275 Ga0373931_0073462 3300035691 Bacteria 1871
276 Ga0373933_0333793 3300035724 Bacteria 984
277 Ga0373947_0039838 3300035725 Bacteria 2797
278 Ga0373937_0312933 3300036401 Bacteria 1485
279 Ga0373937_0678989 3300036401 Bacteria 976
280 Ga0373925_1131968 3300037068 Bacteria 644
281 Ga0395899_0137147 3300037312 Bacteria 1743
282 Ga0395899_0162536 3300037312 Bacteria 1577
283 Ga0395900_0029356 3300037418 Bacteria 5642
284 Ga0395900_0140107 3300037418 Bacteria 2477
285 Ga0395900_0539155 3300037418 Bacteria 1113
286 Ga0395900_0900884 3300037418 Unclassified 808
287 Ga0395900_1910218 3300037418 Bacteria 504
288 Ga0395898_0165439 3300037466 Bacteria 2115
289 Ga0395898_0785638 3300037466 Bacteria 893
290 Ga0395905_0023549 3300037471 Bacteria 5817
291 Ga0395905_0633344 3300037471 Bacteria 971
292 Ga0395901_0183827 3300038443 Bacteria 2192
293 Ga0395901_0439922 3300038443 Bacteria 1335
294 Ga0451800_0367868 3300041459 Bacteria 628
295 Ga0451802_1278824 3300041460 Unclassified 616
296 Ga0451807_2685024 3300041486 Unclassified 559
297 Ga0451839_1019884 3300041496 Bacteria 603
298 Ga0439448_0036575 3300042005 Bacteria 1575
299 Ga0439454_043309 3300042011 Bacteria 742
300 Ga0439455_0158519 3300042012 Bacteria 646
301 Ga0450888_021049 3300042126 Bacteria 831
302 Ga0439464_0094040 3300042439 Bacteria 906
303 Ga0466969_0008346 3300044656 Bacteria 5492
304 Ga0466966_0061507 3300044684 Bacteria 2368
305 Ga0466961_0004773 3300044693 Bacteria 8533
306 Ga0466963_0234193 3300044694 Bacteria 1287
307 Ga0466964_0020346 3300044706 Bacteria 2556
308 Ga0466971_0002775 3300044719 Bacteria 7406
309 Ga0466957_0004563 3300044842 Bacteria 7734
310 Ga0466959_0161941 3300045049 Bacteria 1572
311 Ga0451576_0490784 3300045051 Bacteria 1290
312 Ga0466958_0002164 3300045836 Bacteria 9786
313 Ga0466967_0146204 3300045976 Bacteria 2205
314 Ga0495603_0037788 3300046455 Bacteria 2896
315 Ga0495603_0465408 3300046455 Bacteria 724
316 Ga0495629_0007457 3300046459 Bacteria 8059
317 Ga0495629_0141958 3300046459 Bacteria 1671
318 Ga0495641_0199797 3300046461 Bacteria 896
319 Ga0495651_0161930 3300046462 Bacteria 1602
320 Ga0495651_0533513 3300046462 Bacteria 747
321 Ga0495605_0109524 3300046474 Bacteria 1262
322 Ga0495639_0059603 3300046475 Bacteria 1747
323 Ga0495662_0037004 3300046476 Bacteria 2356
324 Ga0495664_0807145 3300046477 Bacteria 551
325 Ga0495608_0056587 3300046511 Bacteria 2589
326 Ga0495618_0588158 3300046514 Bacteria 663
327 Ga0495631_0426357 3300046518 Bacteria 565
328 Ga0495652_0843501 3300046529 Bacteria 608
329 Ga0495665_0179824 3300046531 Bacteria 1099
330 Ga0495586_0173599 3300046535 Bacteria 1218
331 Ga0495586_0196059 3300046535 Bacteria 1144
332 Ga0495587_0385798 3300046536 Bacteria 779
333 Ga0495645_0063732 3300046543 Bacteria 2668
334 Ga0495645_0097414 3300046543 Bacteria 2095
335 Ga0495667_0002397 3300046559 Bacteria 12532
336 Ga0495668_0474661 3300046616 Unclassified 689
337 Ga0495634_0324425 3300046642 Bacteria 926
338 Ga0495634_0413214 3300046642 Unclassified 800
339 Ga0495635_0012567 3300046663 Bacteria 5934
340 Ga0495588_0355099 3300046674 Bacteria 770
341 Ga0495657_0156548 3300046675 Bacteria 1412
342 Ga0495657_0212021 3300046675 Bacteria 1177
343 Ga0495599_0440268 3300046678 Bacteria 773
344 Ga0495623_0411305 3300046679 Bacteria 726
345 Ga0495646_0274785 3300046680 Bacteria 897
346 Ga0495647_0076233 3300046681 Bacteria 1351
347 Ga0495658_0018275 3300046683 Bacteria 3642
348 Ga0495658_0081739 3300046683 Bacteria 1897
349 Ga0495613_0044964 3300046689 Bacteria 3266
350 Ga0495624_0400493 3300046690 Bacteria 824
351 Ga0495600_0118872 3300046809 Bacteria 1719
352 Ga0495604_0042705 3300047317 Bacteria 3552
353 Ga0495604_0136986 3300047317 Bacteria 1753
354 Ga0495674_0112185 3300047319 Bacteria 2310
355 Ga0495674_0159259 3300047319 Bacteria 1889
356 Ga0495674_0411770 3300047319 Bacteria 1090
357 Ga0495676_0077422 3300047321 Bacteria 2536
358 Ga0495676_0087292 3300047321 Bacteria 2345
359 Ga0495676_0126520 3300047321 Bacteria 1851
360 Ga0495676_0295472 3300047321 Bacteria 1094
361 Ga0495680_0408911 3300047322 Bacteria 935
362 Ga0495675_0194535 3300047444 Bacteria 1237
363 Ga0495684_0001855 3300047471 Bacteria 16919
364 Ga0495684_0225393 3300047471 Bacteria 1373
365 Ga0495602_0254622 3300048088 Bacteria 1306
366 Ga0496100_0004851 3300048903 Bacteria 7183
367 Ga0496100_0021541 3300048903 Bacteria 3884
368 Ga0496100_0021929 3300048903 Bacteria 3855
369 Ga0496100_0079831 3300048903 Bacteria 2206
370 Ga0496100_0307456 3300048903 Bacteria 1188
371 Ga0496100_1595333 3300048903 Unclassified 516
372 Ga0496101_0009591 3300048904 Bacteria 6367
373 Ga0496101_0049484 3300048904 Bacteria 3023
374 Ga0496101_0060095 3300048904 Bacteria 2757
375 Ga0496101_0379310 3300048904 Bacteria 1112
376 Ga0496102_0027537 3300048905 Bacteria 5076
377 Ga0496102_0037557 3300048905 Bacteria 4369
378 Ga0496102_0088362 3300048905 Bacteria 2865
379 Ga0496102_0106773 3300048905 Bacteria 2606
380 Ga0496102_0184781 3300048905 Bacteria 1964
381 Ga0496103_0005695 3300048906 Bacteria 7447
382 Ga0496103_0030280 3300048906 Bacteria 3293
383 Ga0496103_0039505 3300048906 Bacteria 2900
384 Ga0496103_0184724 3300048906 Bacteria 1340
385 Ga0496104_0000606 3300048907 Bacteria 30748
386 Ga0496104_0004503 3300048907 Bacteria 12141
387 Ga0496104_0072148 3300048907 Bacteria 3283
388 Ga0496104_0111224 3300048907 Bacteria 2626
389 Ga0496104_0259610 3300048907 Bacteria 1650
390 Ga0496104_0333409 3300048907 Bacteria 1430
391 Ga0496104_0691804 3300048907 Bacteria 927
392 Ga0496104_0988236 3300048907 Bacteria 746
393 Ga0496105_0000182 3300048908 Bacteria 41923
394 Ga0496105_0008293 3300048908 Bacteria 8075
395 Ga0496105_0044984 3300048908 Bacteria 3642
396 Ga0496105_0089854 3300048908 Bacteria 2537
397 Ga0496106_0018010 3300048909 Bacteria 5222
398 Ga0496106_0018850 3300048909 Bacteria 5112
399 Ga0496106_0273871 3300048909 Bacteria 1352
400 Ga0496106_0285038 3300048909 Bacteria 1324
401 Ga0496107_0056551 3300048910 Bacteria 2835
402 Ga0496107_0280461 3300048910 Bacteria 1240
403 Ga0496107_0376775 3300048910 Bacteria 1055
404 Ga0496107_1167526 3300048910 Bacteria 554
405 Ga0496108_0000777 3300048911 Bacteria 24915
406 Ga0496108_0012918 3300048911 Bacteria 6805
407 Ga0496108_0074871 3300048911 Bacteria 2859
408 Ga0496108_0560296 3300048911 Bacteria 997
409 Ga0496109_0000403 3300048912 Bacteria 39012
410 Ga0496109_0000626 3300048912 Bacteria 29449
411 Ga0496109_0013557 3300048912 Bacteria 7077
412 Ga0496109_0014816 3300048912 Bacteria 6785
413 Ga0496109_0026915 3300048912 Bacteria 5130
414 Ga0496109_0141802 3300048912 Bacteria 2247
415 Ga0496109_0330079 3300048912 Bacteria 1440
416 Ga0496109_0522203 3300048912 Bacteria 1121
417 Ga0496109_0601916 3300048912 Bacteria 1035
418 Ga0496110_0000261 3300048913 Bacteria 34222
419 Ga0496110_0000581 3300048913 Bacteria 25064
420 Ga0496110_0043948 3300048913 Bacteria 3901
421 Ga0496110_0055219 3300048913 Bacteria 3494
422 Ga0496110_0100568 3300048913 Bacteria 2592
423 Ga0496110_0526765 3300048913 Bacteria 1075
424 Ga0496110_0708254 3300048913 Bacteria 909
425 Ga0496110_0777307 3300048913 Bacteria 861
426 Ga0496110_0835182 3300048913 Bacteria 826
427 Ga0496111_0000076 3300048914 Bacteria 40931
428 Ga0496111_0000086 3300048914 Bacteria 39141
429 Ga0496111_0015183 3300048914 Bacteria 5280
430 Ga0496111_0032911 3300048914 Bacteria 3696
431 Ga0496111_0086003 3300048914 Bacteria 2300
432 Ga0496111_0544706 3300048914 Bacteria 852
433 Ga0496111_0763470 3300048914 Bacteria 701
434 Ga0496112_0000832 3300048915 Bacteria 21960
435 Ga0496112_0158426 3300048915 Bacteria 2230
436 Ga0496112_0371185 3300048915 Bacteria 1372
437 Ga0496112_0619245 3300048915 Bacteria 1014
438 Ga0496113_0000424 3300048916 Bacteria 20576
439 Ga0496113_0060671 3300048916 Bacteria 2852
440 Ga0496113_0222330 3300048916 Bacteria 1505
441 Ga0496113_0437709 3300048916 Bacteria 1050
442 Ga0496113_0762272 3300048916 Bacteria 770
443 Ga0496113_0919762 3300048916 Unclassified 691
444 Ga0496114_0012160 3300048917 Bacteria 6888
445 Ga0496114_0012463 3300048917 Bacteria 6806
446 Ga0496114_0062446 3300048917 Bacteria 3117
447 Ga0496114_0068878 3300048917 Bacteria 2971
448 Ga0496114_0103854 3300048917 Bacteria 2429
449 Ga0496114_0139045 3300048917 Bacteria 2101
450 Ga0496114_0170959 3300048917 Bacteria 1894
451 Ga0496114_0177741 3300048917 Bacteria 1857
452 Ga0496114_0447064 3300048917 Bacteria 1145
453 Ga0496114_0465425 3300048917 Bacteria 1119
454 Ga0496115_0006958 3300048918 Bacteria 8308
455 Ga0496115_0061459 3300048918 Bacteria 3028
456 Ga0496115_0101135 3300048918 Bacteria 2363
457 Ga0496115_0295558 3300048918 Bacteria 1328
458 Ga0496115_0404457 3300048918 Unclassified 1107
459 Ga0496115_0525327 3300048918 Bacteria 948
460 Ga0496115_1002843 3300048918 Bacteria 638
461 Ga0501034_0047265 3300049571 Bacteria 4347
462 Ga0501047_0009800 3300049581 Bacteria 9053
463 Ga0501067_0016713 3300049583 Bacteria 4054
464 Ga0501069_0007483 3300049585 Bacteria 5734
465 Ga0501069_0197999 3300049585 Bacteria 1164
466 Ga0501069_0326487 3300049585 Bacteria 902
467 Ga0501073_1157040 3300049589 Bacteria 531
468 Ga0501074_0214989 3300049590 Bacteria 1369
469 Ga0501080_0313409 3300049742 Bacteria 1422
470 nmdc:mga00v17_274421_c1 3300050491 Bacteria 1094
471 nmdc:mga0yw44_49337_c1 3300050492 Unclassified 2540
472 nmdc:mga0k408_511745_c1 3300050493 Bacteria 711
473 nmdc:mga06z11_454141_c1 3300050494 Bacteria 774
474 nmdc:mga05p37_1336006_c1 3300050507 Unclassified 728
475 nmdc:mga05p37_2000348_c1 3300050507 Bacteria 548
476 nmdc:mga09592_808755_c1 3300050508 Bacteria 792
477 nmdc:mga09592_894594_c1 3300050508 Bacteria 747
478 nmdc:mga0qj67_90760_c1 3300050509 Bacteria 2455
479 nmdc:mga06r32_159774_c1 3300050510 Unclassified 2236
480 nmdc:mga0n895_390497_c1 3300050512 Bacteria 1408
481 nmdc:mga0n895_526187_c1 3300050512 Bacteria 1190
482 nmdc:mga0n895_909874_c1 3300050512 Bacteria 865
483 nmdc:mga0rr50_1775334_c1 3300050513 Bacteria 519
484 nmdc:mga0rr50_30051_c1 3300050513 Bacteria 3841
485 nmdc:mga0rr50_805928_c1 3300050513 Bacteria 801
486 nmdc:mga08x19_109621_c1 3300050514 Bacteria 1840
487 nmdc:mga0a205_496782_c1 3300050515 Bacteria 1077
488 nmdc:mga0a205_555113_c1 3300050515 Bacteria 1003
489 Ga0495601_0315227 3300053077 Bacteria 1018
490 Ga0495612_0060255 3300053078 Bacteria 1571
491 Ga0495655_0037649 3300053083 Bacteria 1216
492 Ga0495595_0014748 3300053084 Bacteria 3321
493 Ga0495595_0032696 3300053084 Bacteria 2344
494 Ga0495619_0005166 3300053085 Bacteria 8284
495 Ga0466962_0005628 3300061719 Bacteria 6017
496 Ga0530510_0016356 3300061734 Bacteria 5249
497 Ga0495645_0420037
498 Ga0070658_10412405
499 Ga0070683_100015609
500 Ga0070683_100103350
501 Ga0070683_100123145
502 Ga0070683_100177550
503 Ga0070683_101928219
504 Ga0070683_102091580
505 Ga0070690_100031699
506 Ga0068869_101432542
507 Ga0070666_10487653
508 Ga0070680_100051044
509 Ga0070682_100003925
510 Ga0070682_100260826
511 Ga0070682_101048481
512 Ga0068868_100021366
513 Ga0068868_100161339
514 Ga0070691_10217038
515 Ga0070687_100021412
516 Ga0070668_101262395
517 Ga0070669_100211029
518 Ga0070671_100424426
519 Ga0070671_101916958
520 Ga0070674_100427006
521 Ga0070673_102177582
522 Ga0070688_100105275
523 Ga0070659_100806208
524 Ga0070703_10289409
525 Ga0070709_10009705
526 Ga0070714_100012426
527 Ga0070713_100212905
528 Ga0070713_100225688
529 Ga0070713_100423369
530 Ga0070710_10663138
531 Ga0070701_10342371
532 Ga0070711_100149630
533 Ga0070711_100226004
534 Ga0070711_100479917
535 Ga0070711_100653963
536 Ga0070705_100113744
537 Ga0070705_100161650
538 Ga0070705_100421374
539 Ga0070700_100268967
540 Ga0070700_100595307
541 Ga0070694_100020493
542 Ga0070708_100030236
543 Ga0070708_100261122
544 Ga0070708_100513627
545 Ga0070663_100387254
546 Ga0070678_100015166
547 Ga0070678_100184013
548 Ga0070662_100119302
549 Ga0070685_10625810
550 Ga0070706_100047295
551 Ga0070707_100538224
552 Ga0070679_100110173
553 Ga0070679_100259890
554 Ga0070684_100019717
555 Ga0070684_100140510
556 Ga0070684_101564062
557 Ga0070686_100060955
558 Ga0070695_100610891
559 Ga0070696_100100932
560 Ga0070696_100197366
561 Ga0070693_100025570
562 Ga0070693_100081160
563 Ga0070693_100181995
564 Ga0070665_100881137
565 Ga0070704_100066980
566 Ga0068855_100071334
567 Ga0068855_100417177
568 Ga0068855_101066653
569 Ga0068854_100122046
570 Ga0068854_100225185
571 Ga0068856_100275378
572 Ga0068856_100686038
573 Ga0068856_102375846
574 Ga0068856_102613718
575 Ga0070702_100027011
576 Ga0068852_102687541
577 Ga0068859_101768101
578 Ga0068864_100026913
579 Ga0068866_10151467
580 Ga0068861_100328176
581 Ga0068870_10892984
582 Ga0068860_100634964
583 Ga0081455_10077739
584 Ga0081455_10341307
585 Ga0081538_10000286
586 Ga0070717_10176542
587 Ga0070717_10282735
588 Ga0070717_10935558
589 Ga0075364_10017096
590 Ga0075364_10165948
591 Ga0070715_10014642
592 Ga0070715_10785103
593 Ga0070716_100006503
594 Ga0070716_100144044
595 Ga0070712_100014439
596 Ga0070712_100323407
597 Ga0070712_100818209
598 Ga0070712_101004578
599 Ga0075367_10495038
600 Ga0075427_10019528
601 Ga0075366_10139674
602 Ga0097621_100053819
603 Ga0097621_100446140
604 Ga0097621_100734591
605 Ga0068871_100023679
606 Ga0068871_100732264
607 Ga0075430_100310742
608 Ga0075431_101394404
609 Ga0075433_10494292
610 Ga0075434_100043506
611 Ga0075434_100083174
612 Ga0075434_100558991
613 Ga0075434_102307109
614 Ga0075429_100120378
615 Ga0075429_101661271
616 Ga0068865_100085256
617 Ga0075436_100319699
618 Ga0097620_101767952
619 Ga0075435_100042253
620 Ga0075435_100097593
621 Ga0075435_100311819
622 Ga0075435_101118718
623 Ga0105240_10066619
624 Ga0105240_11545277
625 Ga0105240_12019966
626 Ga0105245_10013881
627 Ga0105245_10356664
628 Ga0105245_10866910
629 Ga0105245_11539071
630 Ga0105247_10671995
631 Ga0114129_11175658
632 Ga0114129_12873189
633 Ga0114129_13481632
634 Ga0105243_10235091
635 Ga0105241_10046462
636 Ga0105241_10161977
637 Ga0105241_10762034
638 Ga0105242_10391446
639 Ga0105242_10631530
640 Ga0105248_10191057
641 Ga0105248_10570345
642 Ga0105248_10813615
643 Ga0105248_10975717
644 Ga0105237_10306289
645 Ga0105249_10227968
646 Ga0105249_10377884
647 Ga0105249_12597039
648 Ga0105239_10399185
649 Ga0105246_10785279
650 Ga0157343_1013194
651 Ga0157373_10683718
652 Ga0157371_10229339
653 Ga0157371_10490669
654 Ga0157370_10051822
655 Ga0157370_10972638
656 Ga0157369_10003170
657 Ga0157378_10087974
658 Ga0157372_10227491
659 Ga0157375_10119951
660 Ga0157375_10122785
661 Ga0157375_10222440
662 Ga0157375_10350425
663 Ga0163163_10003631
664 Ga0163163_10717672
665 Ga0157380_10050402
666 Ga0157376_10012385
667 Ga0163161_10669378
668 Ga0206356_10268726
669 Ga0206354_11515628
670 Ga0207692_10092368
671 Ga0207692_10278533
672 Ga0207692_10608539
673 Ga0207642_10067380
674 Ga0207680_10739001
675 Ga0207680_10881015
676 Ga0207685_10680244
677 Ga0207699_10008907
678 Ga0207645_10855623
679 Ga0207643_10689003
680 Ga0207705_10060608
681 Ga0207705_10104892
682 Ga0207654_10668624
683 Ga0207695_10151257
684 Ga0207693_10001862
685 Ga0207693_10003040
686 Ga0207693_10235290
687 Ga0207693_10640883
688 Ga0207663_10043994
689 Ga0207663_10065658
690 Ga0207663_10204234
691 Ga0207663_10593748
692 Ga0207660_10283545
693 Ga0207660_11495589
694 Ga0207662_10029036
695 Ga0207657_10249664
696 Ga0207657_10280397
697 Ga0207652_10302618
698 Ga0207687_10153266
699 Ga0207687_10322610
700 Ga0207687_11203661
701 Ga0207700_10208029
702 Ga0207664_10020198
703 Ga0207664_10101443
704 Ga0207644_10712189
705 Ga0207706_10033389
706 Ga0207709_10249451
707 Ga0207670_10470944
708 Ga0207670_11750443
709 Ga0207669_10369653
710 Ga0207669_10867262
711 Ga0207704_10454159
712 Ga0207665_10000344
713 Ga0207665_10227564
714 Ga0207711_10580316
715 Ga0207711_10840738
716 Ga0207711_11258949
717 Ga0207711_11513165
718 Ga0207661_10182674
719 Ga0207661_10239492
720 Ga0207661_10277052
721 Ga0207661_10426397
722 Ga0207661_10450541
723 Ga0207661_10599909
724 Ga0207661_11266584
725 Ga0207679_10249509
726 Ga0207667_10030954
727 Ga0207667_11145505
728 Ga0207667_11192960
729 Ga0207651_10536266
730 Ga0207712_10092212
731 Ga0207640_10291206
732 Ga0207640_10379337
733 Ga0207677_10065558
734 Ga0207677_10093372
735 Ga0207677_11311542
736 Ga0207703_10897500
737 Ga0207678_10071431
738 Ga0207708_10092817
739 Ga0207708_10367835
740 Ga0207702_10457211
741 Ga0207702_11005935
742 Ga0207702_11572290
743 Ga0207702_12014356
744 Ga0207648_10009856
745 Ga0207675_100521706
746 Ga0207683_10001247
747 Ga0207683_10056306
748 Ga0207428_10003005
749 Ga0268266_11111343
750 Ga0268265_10192235
751 Ga0268264_10478001
752 Ga0265338_10220324
753 Ga0265340_10178579
754 Ga0265331_10262497
755 Ga0307409_100036472
756 Ga0307409_102177998
757 Ga0307416_100038053
758 Ga0307416_100487995
759 Ga0307415_100130075
760 Ga0373959_0057529
761 Ga0373938_0107849
762 Ga0373929_0017813
763 Ga0373932_0140683
764 Ga0373939_0148721
765 Ga0373960_0056953
766 Ga0373943_0299944
767 Ga0373942_0027295
768 Ga0373942_0270049
769 Ga0373961_0054591
770 Ga0373962_0069627
771 Ga0373931_0073462
772 Ga0373933_0333793
773 Ga0373947_0039838
774 Ga0373937_0312933
775 Ga0373937_0678989
776 Ga0373925_1131968
777 Ga0395899_0137147
778 Ga0395899_0162536
779 Ga0395900_0029356
780 Ga0395900_0140107
781 Ga0395900_0539155
782 Ga0395900_0900884
783 Ga0395900_1910218
784 Ga0395898_0165439
785 Ga0395898_0785638
786 Ga0395905_0023549
787 Ga0395905_0633344
788 Ga0395901_0183827
789 Ga0395901_0439922
790 Ga0451800_0367868
791 Ga0451802_1278824
792 Ga0451807_2685024
793 Ga0451839_1019884
794 Ga0439448_0036575
795 Ga0439454_043309
796 Ga0439455_0158519
797 Ga0450888_021049
798 Ga0439464_0094040
799 Ga0466969_0008346
800 Ga0466966_0061507
801 Ga0466961_0004773
802 Ga0466963_0234193
803 Ga0466964_0020346
804 Ga0466971_0002775
805 Ga0466957_0004563
806 Ga0466959_0161941
807 Ga0451576_0490784
808 Ga0466958_0002164
809 Ga0466967_0146204
810 Ga0495603_0037788
811 Ga0495603_0465408
812 Ga0495629_0007457
813 Ga0495629_0141958
814 Ga0495641_0199797
815 Ga0495651_0161930
816 Ga0495651_0533513
817 Ga0495605_0109524
818 Ga0495639_0059603
819 Ga0495662_0037004
820 Ga0495664_0807145
821 Ga0495608_0056587
822 Ga0495618_0588158
823 Ga0495631_0426357
824 Ga0495652_0843501
825 Ga0495665_0179824
826 Ga0495586_0173599
827 Ga0495586_0196059
828 Ga0495587_0385798
829 Ga0495645_0063732
830 Ga0495645_0097414
831 Ga0495667_0002397
832 Ga0495668_0474661
833 Ga0495634_0324425
834 Ga0495634_0413214
835 Ga0495635_0012567
836 Ga0495588_0355099
837 Ga0495657_0156548
838 Ga0495657_0212021
839 Ga0495599_0440268
840 Ga0495623_0411305
841 Ga0495646_0274785
842 Ga0495647_0076233
843 Ga0495658_0018275
844 Ga0495658_0081739
845 Ga0495613_0044964
846 Ga0495624_0400493
847 Ga0495600_0118872
848 Ga0495604_0042705
849 Ga0495604_0136986
850 Ga0495674_0112185
851 Ga0495674_0159259
852 Ga0495674_0411770
853 Ga0495676_0077422
854 Ga0495676_0087292
855 Ga0495676_0126520
856 Ga0495676_0295472
857 Ga0495680_0408911
858 Ga0495675_0194535
859 Ga0495684_0001855
860 Ga0495684_0225393
861 Ga0495602_0254622
862 Ga0496100_0004851
863 Ga0496100_0021541
864 Ga0496100_0021929
865 Ga0496100_0079831
866 Ga0496100_0307456
867 Ga0496100_1595333
868 Ga0496101_0009591
869 Ga0496101_0049484
870 Ga0496101_0060095
871 Ga0496101_0379310
872 Ga0496102_0027537
873 Ga0496102_0037557
874 Ga0496102_0088362
875 Ga0496102_0106773
876 Ga0496102_0184781
877 Ga0496103_0005695
878 Ga0496103_0030280
879 Ga0496103_0039505
880 Ga0496103_0184724
881 Ga0496104_0000606
882 Ga0496104_0004503
883 Ga0496104_0072148
884 Ga0496104_0111224
885 Ga0496104_0259610
886 Ga0496104_0333409
887 Ga0496104_0691804
888 Ga0496104_0988236
889 Ga0496105_0000182
890 Ga0496105_0008293
891 Ga0496105_0044984
892 Ga0496105_0089854
893 Ga0496106_0018010
894 Ga0496106_0018850
895 Ga0496106_0273871
896 Ga0496106_0285038
897 Ga0496107_0056551
898 Ga0496107_0280461
899 Ga0496107_0376775
900 Ga0496107_1167526
901 Ga0496108_0000777
902 Ga0496108_0012918
903 Ga0496108_0074871
904 Ga0496108_0560296
905 Ga0496109_0000403
906 Ga0496109_0000626
907 Ga0496109_0013557
908 Ga0496109_0014816
909 Ga0496109_0026915
910 Ga0496109_0141802
911 Ga0496109_0330079
912 Ga0496109_0522203
913 Ga0496109_0601916
914 Ga0496110_0000261
915 Ga0496110_0000581
916 Ga0496110_0043948
917 Ga0496110_0055219
918 Ga0496110_0100568
919 Ga0496110_0526765
920 Ga0496110_0708254
921 Ga0496110_0777307
922 Ga0496110_0835182
923 Ga0496111_0000076
924 Ga0496111_0000086
925 Ga0496111_0015183
926 Ga0496111_0032911
927 Ga0496111_0086003
928 Ga0496111_0544706
929 Ga0496111_0763470
930 Ga0496112_0000832
931 Ga0496112_0158426
932 Ga0496112_0371185
933 Ga0496112_0619245
934 Ga0496113_0000424
935 Ga0496113_0060671
936 Ga0496113_0222330
937 Ga0496113_0437709
938 Ga0496113_0762272
939 Ga0496113_0919762
940 Ga0496114_0012160
941 Ga0496114_0012463
942 Ga0496114_0062446
943 Ga0496114_0068878
944 Ga0496114_0103854
945 Ga0496114_0139045
946 Ga0496114_0170959
947 Ga0496114_0177741
948 Ga0496114_0447064
949 Ga0496114_0465425
950 Ga0496115_0006958
951 Ga0496115_0061459
952 Ga0496115_0101135
953 Ga0496115_0295558
954 Ga0496115_0404457
955 Ga0496115_0525327
956 Ga0496115_1002843
957 Ga0501034_0047265
958 Ga0501047_0009800
959 Ga0501067_0016713
960 Ga0501069_0007483
961 Ga0501069_0197999
962 Ga0501069_0326487
963 Ga0501073_1157040
964 Ga0501074_0214989
965 Ga0501080_0313409
966 nmdc:mga00v17_274421_c1
967 nmdc:mga0yw44_49337_c1
968 nmdc:mga0k408_511745_c1
969 nmdc:mga06z11_454141_c1
970 nmdc:mga05p37_1336006_c1
971 nmdc:mga05p37_2000348_c1
972 nmdc:mga09592_808755_c1
973 nmdc:mga09592_894594_c1
974 nmdc:mga0qj67_90760_c1
975 nmdc:mga06r32_159774_c1
976 nmdc:mga0n895_390497_c1
977 nmdc:mga0n895_526187_c1
978 nmdc:mga0n895_909874_c1
979 nmdc:mga0rr50_1775334_c1
980 nmdc:mga0rr50_30051_c1
981 nmdc:mga0rr50_805928_c1
982 nmdc:mga08x19_109621_c1
983 nmdc:mga0a205_496782_c1
984 nmdc:mga0a205_555113_c1
985 Ga0495601_0315227
986 Ga0495612_0060255
987 Ga0495655_0037649
988 Ga0495595_0014748
989 Ga0495595_0032696
990 Ga0495619_0005166
991 Ga0466962_0005628
992 Ga0530510_0016356

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01042

Ribonuc_L-PSP

Endoribonuclease L-PSP

8

121

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2csl-assembly1.cif.gz_B crystal structure of ttha0137 from thermus thermophilus hb8 0.9571 4 127
1oni-assembly2.cif.gz_D crystal structure of a human p14.5, a translational inhibitor reveals different mode of ligand binding near the invariant residues of the yjgf/uk114 protein family 0.9563 2 127
7zs6-assembly1.cif.gz_CCC crystal structure of apis mellifera rida 0.9534 2 127
1qah-assembly1.cif.gz_B crystal structure of perchloric acid soluble protein-a translational inhibitor 0.9531 1 128
2dyy-assembly2.cif.gz_F crystal structure of putative translation initiation inhibitor ph0854 from pyrococcus horikoshii 0.9529 4 128
ID Description Score Start End Superfamily
5hp8A00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9542 21 128 3.30.1330.40
3k0tB00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.952 4 128 3.30.1330.40
1nq3C00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9478 2 127 3.30.1330.40
2dyyG00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9474 4 128 3.30.1330.40
5hp8A00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9458 21 128 3.30.1330.40
ID Description Score Start End GO Terms
AF-A0A538L8Q5-F1-model_v4 RidA family protein 0.9727 2 128 GO:0005829
GO:0019239
AF-A0A450S8A2-F1-model_v4 Reactive intermediate/imine deaminase 0.9614 2 128 GO:0005829
GO:0019239
AF-A0A1I2Z8R6-F1-model_v4 2-iminobutanoate/2-iminopropanoate deaminase 0.9613 2 128 GO:0005829
GO:0019239
AF-A0A3D0R7J1-F1-model_v4 Reactive intermediate/imine deaminase 0.961 2 128 GO:0005829
GO:0019239
AF-A0A2E8KI52-F1-model_v4 Reactive intermediate/imine deaminase 0.9596 2 127 GO:0005829
GO:0019239

Map