F454807

General Info

Members Datasets Scaffolds Average Seq Length
495 268 990 122

Family's Representative Sequence

Representative Sequence 3300059423|Ga0590074_015723|Ga0590074_015723_352_744
Length 130
Sequence VVVPPAVRAALVEHASAEAPNEACGLVVLRDGVAERYEPGVNVSPSPYYFELEMPDPGVWFLEDDGYELAVFHSHLSSPPRPSRTDVENIGLWQGRPYLILTLRTGELAGWRIEGETIVSVPLFDGTTEV

Samples

Sample ID Description Type Environment
1 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
138 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
139 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
140 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
141 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
142 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
143 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
144 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
145 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
146 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
147 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
148 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
150 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
151 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
152 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
153 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
154 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
155 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
156 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
157 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
158 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
159 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
160 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
161 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
162 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
163 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
164 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
165 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
166 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
167 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
168 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
169 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
170 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
171 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
172 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
173 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
174 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
175 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
176 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
177 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
178 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
179 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
180 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
181 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
182 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
183 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
184 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
185 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
186 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
187 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
188 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
189 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
190 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
191 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
192 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
193 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
194 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
195 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
196 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
197 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
198 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
199 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
200 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
201 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
202 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
203 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
204 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
205 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
206 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
207 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
208 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
209 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
210 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
211 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
212 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
213 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
214 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
215 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
216 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
217 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
218 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
219 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
220 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
221 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
222 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
223 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
224 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
225 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
226 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
227 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
228 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
239 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
240 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
241 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
242 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
243 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
244 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
245 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
246 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
247 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
248 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
249 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
250 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
251 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
252 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
253 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
254 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
255 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
256 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
257 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
258 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
259 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
260 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
261 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
262 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
263 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
264 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
265 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
266 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
267 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
268 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.2
Nodule 0
Rhizoplane 4.04
Rhizosphere 95.76
Stem 0
Stem Tuber 0
Unclassified 13.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0590074_015723 3300059423 Bacteria 1286
2 JGI24751J29686_10036981 3300002459 Unclassified 1011
3 Ga0070676_10627271 3300005328 Bacteria 778
4 Ga0070683_100262333 3300005329 Bacteria 1643
5 Ga0070683_100922685 3300005329 Unclassified 838
6 Ga0070690_100118073 3300005330 Bacteria 1778
7 Ga0070670_100010510 3300005331 Bacteria 7902
8 Ga0070670_100053817 3300005331 Bacteria 3456
9 Ga0070677_10510157 3300005333 Bacteria 653
10 Ga0068869_100344939 3300005334 Bacteria 1213
11 Ga0068868_100100787 3300005338 Bacteria 2337
12 Ga0068868_100472571 3300005338 Bacteria 1094
13 Ga0070660_100463700 3300005339 Bacteria 1052
14 Ga0070689_100005351 3300005340 Bacteria 8754
15 Ga0070691_10083080 3300005341 Bacteria 1571
16 Ga0070687_100167388 3300005343 Bacteria 1305
17 Ga0070692_10015585 3300005345 Bacteria 3598
18 Ga0070692_10750238 3300005345 Bacteria 662
19 Ga0070668_100276590 3300005347 Bacteria 1401
20 Ga0070669_100029460 3300005353 Bacteria 3957
21 Ga0070675_100348501 3300005354 Unclassified 1313
22 Ga0070675_100507163 3300005354 Bacteria 1087
23 Ga0070675_100880769 3300005354 Unclassified 820
24 Ga0070671_100230764 3300005355 Bacteria 1571
25 Ga0070674_100002513 3300005356 Bacteria 10155
26 Ga0070674_100008660 3300005356 Bacteria 6066
27 Ga0070674_100016491 3300005356 Bacteria 4631
28 Ga0070674_100082862 3300005356 Bacteria 2295
29 Ga0070674_100123602 3300005356 Bacteria 1919
30 Ga0070674_100390101 3300005356 Bacteria 1135
31 Ga0070674_100696516 3300005356 Bacteria 868
32 Ga0070673_100086976 3300005364 Unclassified 2547
33 Ga0070673_101346443 3300005364 Unclassified 671
34 Ga0070659_100145954 3300005366 Bacteria 1927
35 Ga0070703_10169465 3300005406 Bacteria 835
36 Ga0070703_10486568 3300005406 Bacteria 553
37 Ga0070710_10427803 3300005437 Unclassified 893
38 Ga0070705_100008009 3300005440 Bacteria 5223
39 Ga0070705_100205707 3300005440 Bacteria 1353
40 Ga0070705_100414561 3300005440 Bacteria 1001
41 Ga0070705_101739248 3300005440 Unclassified 528
42 Ga0070700_100031084 3300005441 Bacteria 3196
43 Ga0070700_100038711 3300005441 Bacteria 2908
44 Ga0070700_100126416 3300005441 Bacteria 1719
45 Ga0070700_100195925 3300005441 Bacteria 1416
46 Ga0070694_100018183 3300005444 Bacteria 4458
47 Ga0070694_100318817 3300005444 Bacteria 1196
48 Ga0070694_100684403 3300005444 Bacteria 833
49 Ga0070708_100172404 3300005445 Bacteria 2020
50 Ga0070678_100016706 3300005456 Bacteria 4703
51 Ga0070678_100398663 3300005456 Bacteria 1195
52 Ga0070678_100487097 3300005456 Unclassified 1086
53 Ga0070678_100644747 3300005456 Bacteria 949
54 Ga0070678_100708424 3300005456 Bacteria 908
55 Ga0070662_100063393 3300005457 Bacteria 2703
56 Ga0070662_100471264 3300005457 Bacteria 1044
57 Ga0068867_100090161 3300005459 Bacteria 2325
58 Ga0068867_100090938 3300005459 Bacteria 2316
59 Ga0068867_100429886 3300005459 Bacteria 1120
60 Ga0068867_100991695 3300005459 Unclassified 761
61 Ga0070685_10006630 3300005466 Bacteria 5909
62 Ga0070685_10270400 3300005466 Bacteria 1134
63 Ga0070685_10782334 3300005466 Unclassified 702
64 Ga0070685_10895304 3300005466 Unclassified 660
65 Ga0070699_100022948 3300005518 Bacteria 5375
66 Ga0070699_100038902 3300005518 Bacteria 4118
67 Ga0070684_100338078 3300005535 Unclassified 1384
68 Ga0068853_100712776 3300005539 Unclassified 958
69 Ga0070672_100459336 3300005543 Bacteria 1098
70 Ga0070686_100280555 3300005544 Bacteria 1228
71 Ga0070695_100023591 3300005545 Bacteria 3783
72 Ga0070695_101577642 3300005545 Unclassified 547
73 Ga0070696_100034408 3300005546 Bacteria 3485
74 Ga0070696_100332222 3300005546 Bacteria 1173
75 Ga0070696_100454944 3300005546 Bacteria 1011
76 Ga0070696_100604193 3300005546 Bacteria 885
77 Ga0070693_100057317 3300005547 Bacteria 2251
78 Ga0070704_100090609 3300005549 Bacteria 2278
79 Ga0070704_100115721 3300005549 Bacteria 2049
80 Ga0070704_100717557 3300005549 Bacteria 888
81 Ga0070704_102052847 3300005549 Bacteria 531
82 Ga0068855_100051765 3300005563 Bacteria 4836
83 Ga0070664_100954815 3300005564 Bacteria 805
84 Ga0070664_102154317 3300005564 Unclassified 529
85 Ga0068857_100020968 3300005577 Bacteria 5750
86 Ga0068857_100797225 3300005577 Bacteria 902
87 Ga0068857_100808229 3300005577 Bacteria 896
88 Ga0068854_100283140 3300005578 Bacteria 1336
89 Ga0070702_100066767 3300005615 Bacteria 2111
90 Ga0070702_100093996 3300005615 Bacteria 1824
91 Ga0070702_100106531 3300005615 Bacteria 1729
92 Ga0068852_100368046 3300005616 Bacteria 1407
93 Ga0068864_100010806 3300005618 Bacteria 7542
94 Ga0068864_100244345 3300005618 Bacteria 1664
95 Ga0068866_10308768 3300005718 Bacteria 991
96 Ga0068861_100024366 3300005719 Bacteria 4376
97 Ga0068861_100593203 3300005719 Bacteria 1016
98 Ga0068861_100914203 3300005719 Bacteria 832
99 Ga0068870_10005799 3300005840 Bacteria 5417
100 Ga0068870_10544415 3300005840 Unclassified 780
101 Ga0068858_100554542 3300005842 Bacteria 1113
102 Ga0068860_100220530 3300005843 Bacteria 1842
103 Ga0068862_100826794 3300005844 Bacteria 906
104 Ga0081455_10036401 3300005937 Bacteria 4383
105 Ga0081455_10054177 3300005937 Bacteria 3420
106 Ga0081455_10082748 3300005937 Bacteria 2625
107 Ga0081455_10227169 3300005937 Unclassified 1380
108 Ga0081540_1000719 3300005983 Bacteria 30498
109 Ga0070717_10279017 3300006028 Bacteria 1482
110 Ga0075365_10823370 3300006038 Bacteria 655
111 Ga0070712_100532755 3300006175 Unclassified 988
112 Ga0097621_100334810 3300006237 Bacteria 1343
113 Ga0068871_100189522 3300006358 Bacteria 1771
114 Ga0075428_100031796 3300006844 Bacteria 5830
115 Ga0075428_100063212 3300006844 Bacteria 4052
116 Ga0075430_100141387 3300006846 Bacteria 2004
117 Ga0075430_100179757 3300006846 Bacteria 1760
118 Ga0075430_101276203 3300006846 Unclassified 604
119 Ga0075431_100013696 3300006847 Bacteria 8195
120 Ga0075431_100519090 3300006847 Bacteria 1181
121 Ga0075431_100967858 3300006847 Bacteria 819
122 Ga0075434_100676243 3300006871 Bacteria 1050
123 Ga0075429_100209384 3300006880 Bacteria 1708
124 Ga0075429_100276721 3300006880 Unclassified 1470
125 Ga0075429_100827466 3300006880 Bacteria 811
126 Ga0068865_100041652 3300006881 Bacteria 3126
127 Ga0068865_100088395 3300006881 Unclassified 2242
128 Ga0068865_101100458 3300006881 Unclassified 700
129 Ga0068865_101725638 3300006881 Unclassified 565
130 Ga0075435_100096953 3300007076 Bacteria 2440
131 Ga0105250_10169839 3300009092 Unclassified 913
132 Ga0105240_10355462 3300009093 Bacteria 1661
133 Ga0111539_10016551 3300009094 Bacteria 9141
134 Ga0111539_10055958 3300009094 Bacteria 4690
135 Ga0111539_10079152 3300009094 Bacteria 3866
136 Ga0111539_10298950 3300009094 Bacteria 1873
137 Ga0111539_10349677 3300009094 Bacteria 1720
138 Ga0105245_10012355 3300009098 Bacteria 7430
139 Ga0105245_10020578 3300009098 Bacteria 5787
140 Ga0105245_10331455 3300009098 Bacteria 1502
141 Ga0105245_11251676 3300009098 Bacteria 790
142 Ga0114129_10061555 3300009147 Bacteria 5246
143 Ga0114129_10132134 3300009147 Bacteria 3427
144 Ga0114129_10134673 3300009147 Bacteria 3391
145 Ga0114129_10236926 3300009147 Bacteria 2455
146 Ga0114129_10363778 3300009147 Bacteria 1913
147 Ga0114129_10364109 3300009147 Bacteria 1912
148 Ga0105243_10012176 3300009148 Bacteria 6503
149 Ga0105243_10387047 3300009148 Bacteria 1295
150 Ga0105243_11399472 3300009148 Bacteria 720
151 Ga0105243_12230758 3300009148 Bacteria 584
152 Ga0105243_12300023 3300009148 Unclassified 576
153 Ga0105243_12949596 3300009148 Bacteria 516
154 Ga0105241_10258073 3300009174 Bacteria 1480
155 Ga0105242_10026718 3300009176 Bacteria 4577
156 Ga0105242_10230259 3300009176 Bacteria 1660
157 Ga0105242_10380070 3300009176 Bacteria 1313
158 Ga0105242_10630815 3300009176 Bacteria 1039
159 Ga0105242_11478523 3300009176 Unclassified 709
160 Ga0105248_10192792 3300009177 Bacteria 2296
161 Ga0105237_10112869 3300009545 Bacteria 2710
162 Ga0105249_10098455 3300009553 Bacteria 2747
163 Ga0105249_10523143 3300009553 Bacteria 1234
164 Ga0105249_10534135 3300009553 Bacteria 1222
165 Ga0105239_10053963 3300010375 Bacteria 4407
166 Ga0105239_10656403 3300010375 Bacteria 1198
167 Ga0105246_10013591 3300011119 Bacteria 5107
168 Ga0105246_10548825 3300011119 Unclassified 990
169 Ga0105246_10594225 3300011119 Bacteria 955
170 Ga0157346_1022083 3300012480 Bacteria 563
171 Ga0157371_10162618 3300013102 Bacteria 1594
172 Ga0157374_10388601 3300013296 Bacteria 1391
173 Ga0157378_10135626 3300013297 Bacteria 2282
174 Ga0157378_11076254 3300013297 Bacteria 840
175 Ga0163162_10188234 3300013306 Bacteria 2191
176 Ga0163162_10265388 3300013306 Bacteria 1848
177 Ga0163162_10495953 3300013306 Bacteria 1352
178 Ga0157372_10133853 3300013307 Bacteria 2854
179 Ga0157372_12194401 3300013307 Unclassified 634
180 Ga0157375_12253151 3300013308 Unclassified 649
181 Ga0163163_10588202 3300014325 Bacteria 1176
182 Ga0163163_11665202 3300014325 Bacteria 699
183 Ga0163163_12106509 3300014325 Unclassified 624
184 Ga0157380_10038754 3300014326 Bacteria 3702
185 Ga0157377_10128063 3300014745 Unclassified 1547
186 Ga0157379_10575604 3300014968 Bacteria 1049
187 Ga0157376_10180334 3300014969 Unclassified 1930
188 Ga0157376_10511317 3300014969 Bacteria 1182
189 Ga0157376_10623972 3300014969 Bacteria 1075
190 Ga0163161_10024893 3300017792 Bacteria 4231
191 Ga0207653_10160759 3300025885 Bacteria 831
192 Ga0207642_10101272 3300025899 Bacteria 1446
193 Ga0207642_10245133 3300025899 Bacteria 1014
194 Ga0207642_10299063 3300025899 Bacteria 932
195 Ga0207688_10016551 3300025901 Bacteria 4000
196 Ga0207645_10737870 3300025907 Bacteria 670
197 Ga0207643_10004364 3300025908 Bacteria 7598
198 Ga0207643_10101734 3300025908 Bacteria 1685
199 Ga0207643_10211522 3300025908 Bacteria 1184
200 Ga0207684_10149354 3300025910 Bacteria 2010
201 Ga0207654_10094325 3300025911 Bacteria 1831
202 Ga0207693_10430380 3300025915 Bacteria 1031
203 Ga0207693_11064562 3300025915 Bacteria 615
204 Ga0207660_10020276 3300025917 Bacteria 4457
205 Ga0207662_10067899 3300025918 Bacteria 2151
206 Ga0207662_10278884 3300025918 Bacteria 1105
207 Ga0207657_10038460 3300025919 Bacteria 4259
208 Ga0207657_11122964 3300025919 Bacteria 600
209 Ga0207652_10398916 3300025921 Bacteria 1241
210 Ga0207681_10181994 3300025923 Bacteria 1602
211 Ga0207650_10008337 3300025925 Bacteria 7075
212 Ga0207650_10022104 3300025925 Bacteria 4501
213 Ga0207659_10223141 3300025926 Bacteria 1516
214 Ga0207687_10037823 3300025927 Bacteria 3295
215 Ga0207687_10038234 3300025927 Bacteria 3279
216 Ga0207687_10858822 3300025927 Unclassified 776
217 Ga0207664_10329749 3300025929 Bacteria 1348
218 Ga0207644_11770595 3300025931 Unclassified 517
219 Ga0207706_10013305 3300025933 Bacteria 7487
220 Ga0207706_10244239 3300025933 Bacteria 1569
221 Ga0207686_10151823 3300025934 Bacteria 1613
222 Ga0207686_10183917 3300025934 Bacteria 1484
223 Ga0207686_10241760 3300025934 Bacteria 1314
224 Ga0207709_10079591 3300025935 Bacteria 2108
225 Ga0207709_11826246 3300025935 Bacteria 506
226 Ga0207670_10192466 3300025936 Bacteria 1544
227 Ga0207669_10002960 3300025937 Bacteria 7293
228 Ga0207669_10066551 3300025937 Bacteria 2241
229 Ga0207669_10124499 3300025937 Bacteria 1758
230 Ga0207669_10158483 3300025937 Bacteria 1595
231 Ga0207669_10452703 3300025937 Bacteria 1017
232 Ga0207669_10497190 3300025937 Bacteria 975
233 Ga0207669_10780260 3300025937 Bacteria 791
234 Ga0207691_10019061 3300025940 Bacteria 6497
235 Ga0207691_10133589 3300025940 Bacteria 2190
236 Ga0207691_10555892 3300025940 Unclassified 973
237 Ga0207689_10055733 3300025942 Bacteria 3253
238 Ga0207661_10089273 3300025944 Bacteria 2564
239 Ga0207679_10182254 3300025945 Bacteria 1738
240 Ga0207667_10489965 3300025949 Unclassified 1247
241 Ga0207651_10501911 3300025960 Unclassified 1049
242 Ga0207651_10511360 3300025960 Unclassified 1040
243 Ga0207668_10441632 3300025972 Bacteria 1108
244 Ga0207668_10722503 3300025972 Unclassified 877
245 Ga0207640_10340499 3300025981 Bacteria 1201
246 Ga0207677_10055799 3300026023 Bacteria 2703
247 Ga0207677_10135020 3300026023 Bacteria 1879
248 Ga0207703_10171789 3300026035 Bacteria 1907
249 Ga0207708_10002457 3300026075 Bacteria 13625
250 Ga0207708_10014873 3300026075 Bacteria 5826
251 Ga0207708_10037783 3300026075 Bacteria 3678
252 Ga0207708_10150797 3300026075 Bacteria 1830
253 Ga0207708_10280738 3300026075 Bacteria 1349
254 Ga0207702_10273987 3300026078 Bacteria 1593
255 Ga0207702_10704041 3300026078 Unclassified 995
256 Ga0207648_10025185 3300026089 Bacteria 5304
257 Ga0207648_10037499 3300026089 Bacteria 4270
258 Ga0207648_10065898 3300026089 Bacteria 3158
259 Ga0207648_10118040 3300026089 Bacteria 2331
260 Ga0207648_10186653 3300026089 Bacteria 1837
261 Ga0207676_10028990 3300026095 Bacteria 4140
262 Ga0207674_10018962 3300026116 Bacteria 7458
263 Ga0207674_10170147 3300026116 Bacteria 2132
264 Ga0207674_10179880 3300026116 Bacteria 2066
265 Ga0207674_10459486 3300026116 Bacteria 1230
266 Ga0207675_100021776 3300026118 Bacteria 5967
267 Ga0207675_100476875 3300026118 Bacteria 1239
268 Ga0207675_101148384 3300026118 Bacteria 797
269 Ga0207683_10008375 3300026121 Bacteria 8843
270 Ga0207683_10018107 3300026121 Bacteria 6007
271 Ga0207683_10106895 3300026121 Bacteria 2503
272 Ga0207683_10129642 3300026121 Bacteria 2268
273 Ga0207683_10260350 3300026121 Bacteria 1584
274 Ga0207683_11276223 3300026121 Bacteria 680
275 Ga0207698_10187590 3300026142 Bacteria 1838
276 Ga0207698_11575622 3300026142 Bacteria 672
277 Ga0207428_10018022 3300027907 Bacteria 6047
278 Ga0207428_10116820 3300027907 Bacteria 2048
279 Ga0207428_11063095 3300027907 Bacteria 567
280 Ga0268265_10274280 3300028380 Bacteria 1506
281 Ga0268265_11346862 3300028380 Bacteria 715
282 Ga0307408_100034246 3300031548 Bacteria 3556
283 Ga0307408_100694954 3300031548 Bacteria 914
284 Ga0307410_11013263 3300031852 Bacteria 717
285 Ga0307407_10364285 3300031903 Bacteria 1027
286 Ga0307409_100426829 3300031995 Bacteria 1273
287 Ga0307409_100622403 3300031995 Bacteria 1070
288 Ga0307416_101703009 3300032002 Bacteria 735
289 Ga0307416_103122790 3300032002 Bacteria 554
290 Ga0373945_0028039 3300035116 Bacteria 1970
291 Ga0373943_0006293 3300035170 Bacteria 5330
292 Ga0373946_0019770 3300035171 Bacteria 2598
293 Ga0373962_0158313 3300035242 Bacteria 746
294 Ga0373927_0115971 3300035695 Bacteria 1746
295 Ga0373947_0001046 3300035725 Bacteria 16888
296 Ga0373925_0025256 3300037068 Bacteria 4339
297 Ga0395899_0099882 3300037312 Bacteria 2096
298 Ga0395899_0581921 3300037312 Bacteria 715
299 Ga0395900_0028736 3300037418 Bacteria 5700
300 Ga0395900_0520246 3300037418 Bacteria 1138
301 Ga0395898_0019929 3300037466 Bacteria 6821
302 Ga0395898_0856642 3300037466 Unclassified 848
303 Ga0395905_0015736 3300037471 Bacteria 7186
304 Ga0395905_1339966 3300037471 Unclassified 620
305 Ga0395901_0018722 3300038443 Bacteria 7074
306 Ga0395901_0546110 3300038443 Bacteria 1175
307 Ga0439438_022160 3300041405 Bacteria 1765
308 Ga0439439_0003224 3300041406 Bacteria 3577
309 Ga0439439_0258918 3300041406 Bacteria 517
310 Ga0439453_0001146 3300041408 Bacteria 3317
311 Ga0439461_0002183 3300041410 Bacteria 3101
312 Ga0439461_0011610 3300041410 Bacteria 1637
313 Ga0439466_0056169 3300041411 Bacteria 1278
314 Ga0439466_0133728 3300041411 Unclassified 763
315 Ga0439465_0069863 3300041413 Bacteria 1176
316 Ga0451800_1377566 3300041459 Bacteria 533
317 Ga0439433_0000509 3300041999 Bacteria 7280
318 Ga0439437_012838 3300042000 Bacteria 970
319 Ga0439445_0014442 3300042004 Bacteria 1923
320 Ga0439445_0027256 3300042004 Bacteria 1467
321 Ga0439449_0036411 3300042007 Bacteria 1831
322 Ga0439451_110956 3300042009 Unclassified 556
323 Ga0439454_007103 3300042011 Bacteria 1396
324 Ga0450923_015005 3300042125 Bacteria 1443
325 Ga0450904_039560 3300042139 Unclassified 504
326 Ga0450905_101376 3300042142 Unclassified 517
327 Ga0450906_097062 3300042145 Bacteria 537
328 Ga0450907_021207 3300042146 Bacteria 1092
329 Ga0439446_0008784 3300042156 Bacteria 2692
330 Ga0439446_0020117 3300042156 Bacteria 1878
331 Ga0439434_0011748 3300042435 Unclassified 2591
332 Ga0439434_0042397 3300042435 Bacteria 1399
333 Ga0439435_0134150 3300042436 Bacteria 784
334 Ga0439459_0070154 3300042438 Bacteria 809
335 Ga0439464_0130156 3300042439 Bacteria 779
336 Ga0450916_075016 3300042530 Bacteria 569
337 Ga0466963_0000137 3300044694 Bacteria 28326
338 Ga0466957_0019501 3300044842 Bacteria 3989
339 Ga0451576_0038038 3300045051 Bacteria 5094
340 Ga0466958_0069484 3300045836 Bacteria 2153
341 Ga0466967_0009652 3300045976 Bacteria 7177
342 Ga0466967_0174531 3300045976 Bacteria 2024
343 Ga0495592_0257135 3300046454 Unclassified 1152
344 Ga0495603_0001199 3300046455 Bacteria 15128
345 Ga0495590_0079706 3300046457 Bacteria 1153
346 Ga0495641_0005902 3300046461 Bacteria 8084
347 Ga0495605_0084483 3300046474 Bacteria 1480
348 Ga0495584_0256257 3300046491 Bacteria 889
349 Ga0495584_0346339 3300046491 Bacteria 755
350 Ga0495594_0001547 3300046499 Bacteria 11942
351 Ga0495596_0055952 3300046500 Bacteria 1541
352 Ga0495583_0099628 3300046506 Bacteria 1242
353 Ga0495610_0304122 3300046512 Unclassified 614
354 Ga0495616_0193493 3300046513 Bacteria 898
355 Ga0495631_0039051 3300046518 Bacteria 2108
356 Ga0495631_0141219 3300046518 Bacteria 1034
357 Ga0495644_0024693 3300046523 Bacteria 2286
358 Ga0495644_0204028 3300046523 Bacteria 762
359 Ga0495663_0030482 3300046525 Bacteria 1598
360 Ga0495666_0004989 3300046526 Bacteria 6716
361 Ga0495598_0012342 3300046537 Bacteria 2095
362 Ga0495609_0091913 3300046538 Bacteria 1320
363 Ga0495609_0132415 3300046538 Bacteria 1067
364 Ga0495609_0320337 3300046538 Unclassified 629
365 Ga0495597_0094521 3300046542 Bacteria 1266
366 Ga0495633_0109196 3300046558 Bacteria 1283
367 Ga0495656_0122445 3300046615 Bacteria 1229
368 Ga0495656_0761397 3300046615 Bacteria 522
369 Ga0495668_0670704 3300046616 Unclassified 573
370 Ga0495611_0036242 3300046648 Bacteria 2188
371 Ga0495659_0018334 3300046664 Bacteria 2331
372 Ga0495588_0001116 3300046674 Bacteria 11554
373 Ga0495658_0041211 3300046683 Bacteria 2571
374 Ga0495669_0211364 3300046684 Bacteria 929
375 Ga0495613_0261621 3300046689 Bacteria 1205
376 Ga0495670_0134105 3300046691 Bacteria 1292
377 Ga0495649_0267180 3300046694 Bacteria 876
378 Ga0495589_0233184 3300046794 Unclassified 863
379 Ga0495589_0276491 3300046794 Unclassified 781
380 Ga0495589_0397814 3300046794 Unclassified 632
381 Ga0495660_0360050 3300046810 Unclassified 645
382 Ga0495581_0111035 3300047315 Bacteria 1594
383 Ga0495676_0002134 3300047321 Bacteria 17473
384 Ga0495685_066319 3300047447 Bacteria 1213
385 Ga0496100_0149942 3300048903 Bacteria 1662
386 Ga0496102_0051002 3300048905 Bacteria 3769
387 Ga0496102_0085627 3300048905 Bacteria 2910
388 Ga0496102_0091324 3300048905 Bacteria 2818
389 Ga0496102_1543286 3300048905 Bacteria 583
390 Ga0496103_0111878 3300048906 Bacteria 1735
391 Ga0496103_0386192 3300048906 Unclassified 899
392 Ga0496106_0066372 3300048909 Bacteria 2748
393 Ga0496108_0141554 3300048911 Bacteria 2072
394 Ga0496108_0288657 3300048911 Bacteria 1428
395 Ga0496108_0704127 3300048911 Bacteria 876
396 Ga0496109_0225378 3300048912 Bacteria 1763
397 Ga0496110_0004296 3300048913 Bacteria 11029
398 Ga0496110_0307606 3300048913 Bacteria 1444
399 Ga0496111_0000981 3300048914 Bacteria 15613
400 Ga0496111_0321166 3300048914 Bacteria 1147
401 Ga0496112_0195555 3300048915 Bacteria 1983
402 Ga0496113_0085869 3300048916 Bacteria 2418
403 Ga0496114_0465628 3300048917 Bacteria 1119
404 Ga0501031_0045956 3300049568 Bacteria 2849
405 Ga0501036_0388283 3300049572 Unclassified 1165
406 Ga0501037_0178384 3300049573 Bacteria 1508
407 Ga0501038_0077071 3300049574 Bacteria 2815
408 Ga0501039_0030935 3300049575 Bacteria 4127
409 Ga0501040_0004247 3300049576 Bacteria 9325
410 Ga0501040_0355263 3300049576 Bacteria 1050
411 Ga0501040_0679430 3300049576 Bacteria 744
412 Ga0501040_0930333 3300049576 Unclassified 630
413 Ga0501041_0215799 3300049577 Bacteria 1204
414 Ga0501041_0461190 3300049577 Bacteria 807
415 Ga0501042_0019084 3300049578 Bacteria 4758
416 Ga0501042_0466416 3300049578 Bacteria 916
417 Ga0501042_1242138 3300049578 Bacteria 543
418 Ga0501046_0014055 3300049580 Bacteria 6761
419 Ga0501048_0065869 3300049582 Bacteria 2561
420 Ga0501048_1066369 3300049582 Unclassified 581
421 Ga0501067_0026399 3300049583 Bacteria 3217
422 Ga0501067_0104655 3300049583 Bacteria 1572
423 Ga0501067_0502899 3300049583 Bacteria 678
424 Ga0501067_0781548 3300049583 Viruses 538
425 Ga0501068_0021343 3300049584 Bacteria 3781
426 Ga0501068_0165351 3300049584 Bacteria 1395
427 Ga0501068_0190692 3300049584 Bacteria 1298
428 Ga0501068_0190832 3300049584 Bacteria 1298
429 Ga0501068_0743400 3300049584 Bacteria 642
430 Ga0501069_0133416 3300049585 Bacteria 1423
431 Ga0501069_0228977 3300049585 Bacteria 1082
432 Ga0501070_0729939 3300049586 Bacteria 782
433 Ga0501071_0012482 3300049587 Bacteria 5762
434 Ga0501071_0089316 3300049587 Bacteria 2261
435 Ga0501071_0182904 3300049587 Bacteria 1571
436 Ga0501072_0052066 3300049588 Bacteria 3223
437 Ga0501072_0125402 3300049588 Bacteria 2046
438 Ga0501072_0136915 3300049588 Bacteria 1952
439 Ga0501072_0458092 3300049588 Bacteria 1010
440 Ga0501072_0473070 3300049588 Bacteria 992
441 Ga0501072_0773462 3300049588 Unclassified 753
442 Ga0501074_0139695 3300049590 Bacteria 1733
443 Ga0501075_0012249 3300049591 Bacteria 6088
444 Ga0501075_0338334 3300049591 Bacteria 1147
445 Ga0501075_0422221 3300049591 Bacteria 1017
446 Ga0501075_0733751 3300049591 Bacteria 752
447 Ga0501076_0007997 3300049592 Bacteria 7722
448 Ga0501076_0059804 3300049592 Bacteria 3031
449 Ga0501077_0028975 3300049593 Bacteria 3519
450 Ga0501077_0094090 3300049593 Bacteria 1899
451 Ga0501233_285953 3300049668 Bacteria 505
452 Ga0501251_097251 3300049681 Unclassified 535
453 Ga0501261_107826 3300049690 Bacteria 538
454 Ga0501079_0034823 3300049741 Bacteria 3874
455 Ga0501079_0325423 3300049741 Bacteria 1204
456 Ga0501079_0449201 3300049741 Bacteria 1012
457 Ga0501079_1027105 3300049741 Bacteria 649
458 Ga0501080_0186256 3300049742 Bacteria 1908
459 Ga0501080_0582278 3300049742 Bacteria 995
460 Ga0501081_0193607 3300049743 Unclassified 1473
461 Ga0501081_1294898 3300049743 Bacteria 553
462 Ga0501081_1305136 3300049743 Unclassified 550
463 Ga0501083_0081703 3300049744 Bacteria 2142
464 Ga0501045_0002679 3300049824 Bacteria 12147
465 Ga0501045_0158558 3300049824 Unclassified 1684
466 nmdc:mga05p37_107381_c1 3300050507 Bacteria 2690
467 nmdc:mga05p37_583238_c1 3300050507 Unclassified 1266
468 nmdc:mga05p37_624246_c1 3300050507 Bacteria 1212
469 nmdc:mga05p37_816763_c1 3300050507 Bacteria 1018
470 nmdc:mga05p37_827759_c1 3300050507 Bacteria 1009
471 nmdc:mga09592_776141_c1 3300050508 Bacteria 812
472 nmdc:mga09592_88375_c1 3300050508 Bacteria 2647
473 nmdc:mga0qj67_1527957_c1 3300050509 Unclassified 513
474 nmdc:mga0qj67_368128_c1 3300050509 Bacteria 1161
475 nmdc:mga0qj67_78609_c1 3300050509 Bacteria 2641
476 nmdc:mga06r32_209925_c1 3300050510 Bacteria 1935
477 nmdc:mga06r32_367307_c1 3300050510 Bacteria 1422
478 nmdc:mga06r32_5957_c1 3300050510 Bacteria 10970
479 nmdc:mga08y16_104857_c1 3300050511 Bacteria 2943
480 nmdc:mga08y16_11234_c1 3300050511 Bacteria 9407
481 nmdc:mga08y16_283166_c1 3300050511 Bacteria 1710
482 nmdc:mga08y16_319384_c1 3300050511 Bacteria 1599
483 nmdc:mga08y16_420095_c1 3300050511 Bacteria 1367
484 nmdc:mga0n895_254832_c1 3300050512 Bacteria 1781
485 nmdc:mga0n895_517550_c1 3300050512 Bacteria 1201
486 nmdc:mga0rr50_397056_c1 3300050513 Bacteria 1164
487 nmdc:mga0a205_131394_c1 3300050515 Bacteria 2404
488 Ga0495655_0008661 3300053083 Bacteria 1942
489 Ga0501084_0064434 3300054114 Bacteria 3067
490 Ga0590075_074142 3300059424 Bacteria 880
491 Ga0501082_0014318 3300060353 Bacteria 6825
492 Ga0501082_0110391 3300060353 Bacteria 2381
493 Ga0501082_1436933 3300060353 Bacteria 602
494 Ga0530510_0028907 3300061734 Bacteria 3976
495 Ga0530510_0163893 3300061734 Bacteria 1645
496 Ga0590074_015723
497 JGI24751J29686_10036981
498 Ga0070676_10627271
499 Ga0070683_100262333
500 Ga0070683_100922685
501 Ga0070690_100118073
502 Ga0070670_100010510
503 Ga0070670_100053817
504 Ga0070677_10510157
505 Ga0068869_100344939
506 Ga0068868_100100787
507 Ga0068868_100472571
508 Ga0070660_100463700
509 Ga0070689_100005351
510 Ga0070691_10083080
511 Ga0070687_100167388
512 Ga0070692_10015585
513 Ga0070692_10750238
514 Ga0070668_100276590
515 Ga0070669_100029460
516 Ga0070675_100348501
517 Ga0070675_100507163
518 Ga0070675_100880769
519 Ga0070671_100230764
520 Ga0070674_100002513
521 Ga0070674_100008660
522 Ga0070674_100016491
523 Ga0070674_100082862
524 Ga0070674_100123602
525 Ga0070674_100390101
526 Ga0070674_100696516
527 Ga0070673_100086976
528 Ga0070673_101346443
529 Ga0070659_100145954
530 Ga0070703_10169465
531 Ga0070703_10486568
532 Ga0070710_10427803
533 Ga0070705_100008009
534 Ga0070705_100205707
535 Ga0070705_100414561
536 Ga0070705_101739248
537 Ga0070700_100031084
538 Ga0070700_100038711
539 Ga0070700_100126416
540 Ga0070700_100195925
541 Ga0070694_100018183
542 Ga0070694_100318817
543 Ga0070694_100684403
544 Ga0070708_100172404
545 Ga0070678_100016706
546 Ga0070678_100398663
547 Ga0070678_100487097
548 Ga0070678_100644747
549 Ga0070678_100708424
550 Ga0070662_100063393
551 Ga0070662_100471264
552 Ga0068867_100090161
553 Ga0068867_100090938
554 Ga0068867_100429886
555 Ga0068867_100991695
556 Ga0070685_10006630
557 Ga0070685_10270400
558 Ga0070685_10782334
559 Ga0070685_10895304
560 Ga0070699_100022948
561 Ga0070699_100038902
562 Ga0070684_100338078
563 Ga0068853_100712776
564 Ga0070672_100459336
565 Ga0070686_100280555
566 Ga0070695_100023591
567 Ga0070695_101577642
568 Ga0070696_100034408
569 Ga0070696_100332222
570 Ga0070696_100454944
571 Ga0070696_100604193
572 Ga0070693_100057317
573 Ga0070704_100090609
574 Ga0070704_100115721
575 Ga0070704_100717557
576 Ga0070704_102052847
577 Ga0068855_100051765
578 Ga0070664_100954815
579 Ga0070664_102154317
580 Ga0068857_100020968
581 Ga0068857_100797225
582 Ga0068857_100808229
583 Ga0068854_100283140
584 Ga0070702_100066767
585 Ga0070702_100093996
586 Ga0070702_100106531
587 Ga0068852_100368046
588 Ga0068864_100010806
589 Ga0068864_100244345
590 Ga0068866_10308768
591 Ga0068861_100024366
592 Ga0068861_100593203
593 Ga0068861_100914203
594 Ga0068870_10005799
595 Ga0068870_10544415
596 Ga0068858_100554542
597 Ga0068860_100220530
598 Ga0068862_100826794
599 Ga0081455_10036401
600 Ga0081455_10054177
601 Ga0081455_10082748
602 Ga0081455_10227169
603 Ga0081540_1000719
604 Ga0070717_10279017
605 Ga0075365_10823370
606 Ga0070712_100532755
607 Ga0097621_100334810
608 Ga0068871_100189522
609 Ga0075428_100031796
610 Ga0075428_100063212
611 Ga0075430_100141387
612 Ga0075430_100179757
613 Ga0075430_101276203
614 Ga0075431_100013696
615 Ga0075431_100519090
616 Ga0075431_100967858
617 Ga0075434_100676243
618 Ga0075429_100209384
619 Ga0075429_100276721
620 Ga0075429_100827466
621 Ga0068865_100041652
622 Ga0068865_100088395
623 Ga0068865_101100458
624 Ga0068865_101725638
625 Ga0075435_100096953
626 Ga0105250_10169839
627 Ga0105240_10355462
628 Ga0111539_10016551
629 Ga0111539_10055958
630 Ga0111539_10079152
631 Ga0111539_10298950
632 Ga0111539_10349677
633 Ga0105245_10012355
634 Ga0105245_10020578
635 Ga0105245_10331455
636 Ga0105245_11251676
637 Ga0114129_10061555
638 Ga0114129_10132134
639 Ga0114129_10134673
640 Ga0114129_10236926
641 Ga0114129_10363778
642 Ga0114129_10364109
643 Ga0105243_10012176
644 Ga0105243_10387047
645 Ga0105243_11399472
646 Ga0105243_12230758
647 Ga0105243_12300023
648 Ga0105243_12949596
649 Ga0105241_10258073
650 Ga0105242_10026718
651 Ga0105242_10230259
652 Ga0105242_10380070
653 Ga0105242_10630815
654 Ga0105242_11478523
655 Ga0105248_10192792
656 Ga0105237_10112869
657 Ga0105249_10098455
658 Ga0105249_10523143
659 Ga0105249_10534135
660 Ga0105239_10053963
661 Ga0105239_10656403
662 Ga0105246_10013591
663 Ga0105246_10548825
664 Ga0105246_10594225
665 Ga0157346_1022083
666 Ga0157371_10162618
667 Ga0157374_10388601
668 Ga0157378_10135626
669 Ga0157378_11076254
670 Ga0163162_10188234
671 Ga0163162_10265388
672 Ga0163162_10495953
673 Ga0157372_10133853
674 Ga0157372_12194401
675 Ga0157375_12253151
676 Ga0163163_10588202
677 Ga0163163_11665202
678 Ga0163163_12106509
679 Ga0157380_10038754
680 Ga0157377_10128063
681 Ga0157379_10575604
682 Ga0157376_10180334
683 Ga0157376_10511317
684 Ga0157376_10623972
685 Ga0163161_10024893
686 Ga0207653_10160759
687 Ga0207642_10101272
688 Ga0207642_10245133
689 Ga0207642_10299063
690 Ga0207688_10016551
691 Ga0207645_10737870
692 Ga0207643_10004364
693 Ga0207643_10101734
694 Ga0207643_10211522
695 Ga0207684_10149354
696 Ga0207654_10094325
697 Ga0207693_10430380
698 Ga0207693_11064562
699 Ga0207660_10020276
700 Ga0207662_10067899
701 Ga0207662_10278884
702 Ga0207657_10038460
703 Ga0207657_11122964
704 Ga0207652_10398916
705 Ga0207681_10181994
706 Ga0207650_10008337
707 Ga0207650_10022104
708 Ga0207659_10223141
709 Ga0207687_10037823
710 Ga0207687_10038234
711 Ga0207687_10858822
712 Ga0207664_10329749
713 Ga0207644_11770595
714 Ga0207706_10013305
715 Ga0207706_10244239
716 Ga0207686_10151823
717 Ga0207686_10183917
718 Ga0207686_10241760
719 Ga0207709_10079591
720 Ga0207709_11826246
721 Ga0207670_10192466
722 Ga0207669_10002960
723 Ga0207669_10066551
724 Ga0207669_10124499
725 Ga0207669_10158483
726 Ga0207669_10452703
727 Ga0207669_10497190
728 Ga0207669_10780260
729 Ga0207691_10019061
730 Ga0207691_10133589
731 Ga0207691_10555892
732 Ga0207689_10055733
733 Ga0207661_10089273
734 Ga0207679_10182254
735 Ga0207667_10489965
736 Ga0207651_10501911
737 Ga0207651_10511360
738 Ga0207668_10441632
739 Ga0207668_10722503
740 Ga0207640_10340499
741 Ga0207677_10055799
742 Ga0207677_10135020
743 Ga0207703_10171789
744 Ga0207708_10002457
745 Ga0207708_10014873
746 Ga0207708_10037783
747 Ga0207708_10150797
748 Ga0207708_10280738
749 Ga0207702_10273987
750 Ga0207702_10704041
751 Ga0207648_10025185
752 Ga0207648_10037499
753 Ga0207648_10065898
754 Ga0207648_10118040
755 Ga0207648_10186653
756 Ga0207676_10028990
757 Ga0207674_10018962
758 Ga0207674_10170147
759 Ga0207674_10179880
760 Ga0207674_10459486
761 Ga0207675_100021776
762 Ga0207675_100476875
763 Ga0207675_101148384
764 Ga0207683_10008375
765 Ga0207683_10018107
766 Ga0207683_10106895
767 Ga0207683_10129642
768 Ga0207683_10260350
769 Ga0207683_11276223
770 Ga0207698_10187590
771 Ga0207698_11575622
772 Ga0207428_10018022
773 Ga0207428_10116820
774 Ga0207428_11063095
775 Ga0268265_10274280
776 Ga0268265_11346862
777 Ga0307408_100034246
778 Ga0307408_100694954
779 Ga0307410_11013263
780 Ga0307407_10364285
781 Ga0307409_100426829
782 Ga0307409_100622403
783 Ga0307416_101703009
784 Ga0307416_103122790
785 Ga0373945_0028039
786 Ga0373943_0006293
787 Ga0373946_0019770
788 Ga0373962_0158313
789 Ga0373927_0115971
790 Ga0373947_0001046
791 Ga0373925_0025256
792 Ga0395899_0099882
793 Ga0395899_0581921
794 Ga0395900_0028736
795 Ga0395900_0520246
796 Ga0395898_0019929
797 Ga0395898_0856642
798 Ga0395905_0015736
799 Ga0395905_1339966
800 Ga0395901_0018722
801 Ga0395901_0546110
802 Ga0439438_022160
803 Ga0439439_0003224
804 Ga0439439_0258918
805 Ga0439453_0001146
806 Ga0439461_0002183
807 Ga0439461_0011610
808 Ga0439466_0056169
809 Ga0439466_0133728
810 Ga0439465_0069863
811 Ga0451800_1377566
812 Ga0439433_0000509
813 Ga0439437_012838
814 Ga0439445_0014442
815 Ga0439445_0027256
816 Ga0439449_0036411
817 Ga0439451_110956
818 Ga0439454_007103
819 Ga0450923_015005
820 Ga0450904_039560
821 Ga0450905_101376
822 Ga0450906_097062
823 Ga0450907_021207
824 Ga0439446_0008784
825 Ga0439446_0020117
826 Ga0439434_0011748
827 Ga0439434_0042397
828 Ga0439435_0134150
829 Ga0439459_0070154
830 Ga0439464_0130156
831 Ga0450916_075016
832 Ga0466963_0000137
833 Ga0466957_0019501
834 Ga0451576_0038038
835 Ga0466958_0069484
836 Ga0466967_0009652
837 Ga0466967_0174531
838 Ga0495592_0257135
839 Ga0495603_0001199
840 Ga0495590_0079706
841 Ga0495641_0005902
842 Ga0495605_0084483
843 Ga0495584_0256257
844 Ga0495584_0346339
845 Ga0495594_0001547
846 Ga0495596_0055952
847 Ga0495583_0099628
848 Ga0495610_0304122
849 Ga0495616_0193493
850 Ga0495631_0039051
851 Ga0495631_0141219
852 Ga0495644_0024693
853 Ga0495644_0204028
854 Ga0495663_0030482
855 Ga0495666_0004989
856 Ga0495598_0012342
857 Ga0495609_0091913
858 Ga0495609_0132415
859 Ga0495609_0320337
860 Ga0495597_0094521
861 Ga0495633_0109196
862 Ga0495656_0122445
863 Ga0495656_0761397
864 Ga0495668_0670704
865 Ga0495611_0036242
866 Ga0495659_0018334
867 Ga0495588_0001116
868 Ga0495658_0041211
869 Ga0495669_0211364
870 Ga0495613_0261621
871 Ga0495670_0134105
872 Ga0495649_0267180
873 Ga0495589_0233184
874 Ga0495589_0276491
875 Ga0495589_0397814
876 Ga0495660_0360050
877 Ga0495581_0111035
878 Ga0495676_0002134
879 Ga0495685_066319
880 Ga0496100_0149942
881 Ga0496102_0051002
882 Ga0496102_0085627
883 Ga0496102_0091324
884 Ga0496102_1543286
885 Ga0496103_0111878
886 Ga0496103_0386192
887 Ga0496106_0066372
888 Ga0496108_0141554
889 Ga0496108_0288657
890 Ga0496108_0704127
891 Ga0496109_0225378
892 Ga0496110_0004296
893 Ga0496110_0307606
894 Ga0496111_0000981
895 Ga0496111_0321166
896 Ga0496112_0195555
897 Ga0496113_0085869
898 Ga0496114_0465628
899 Ga0501031_0045956
900 Ga0501036_0388283
901 Ga0501037_0178384
902 Ga0501038_0077071
903 Ga0501039_0030935
904 Ga0501040_0004247
905 Ga0501040_0355263
906 Ga0501040_0679430
907 Ga0501040_0930333
908 Ga0501041_0215799
909 Ga0501041_0461190
910 Ga0501042_0019084
911 Ga0501042_0466416
912 Ga0501042_1242138
913 Ga0501046_0014055
914 Ga0501048_0065869
915 Ga0501048_1066369
916 Ga0501067_0026399
917 Ga0501067_0104655
918 Ga0501067_0502899
919 Ga0501067_0781548
920 Ga0501068_0021343
921 Ga0501068_0165351
922 Ga0501068_0190692
923 Ga0501068_0190832
924 Ga0501068_0743400
925 Ga0501069_0133416
926 Ga0501069_0228977
927 Ga0501070_0729939
928 Ga0501071_0012482
929 Ga0501071_0089316
930 Ga0501071_0182904
931 Ga0501072_0052066
932 Ga0501072_0125402
933 Ga0501072_0136915
934 Ga0501072_0458092
935 Ga0501072_0473070
936 Ga0501072_0773462
937 Ga0501074_0139695
938 Ga0501075_0012249
939 Ga0501075_0338334
940 Ga0501075_0422221
941 Ga0501075_0733751
942 Ga0501076_0007997
943 Ga0501076_0059804
944 Ga0501077_0028975
945 Ga0501077_0094090
946 Ga0501233_285953
947 Ga0501251_097251
948 Ga0501261_107826
949 Ga0501079_0034823
950 Ga0501079_0325423
951 Ga0501079_0449201
952 Ga0501079_1027105
953 Ga0501080_0186256
954 Ga0501080_0582278
955 Ga0501081_0193607
956 Ga0501081_1294898
957 Ga0501081_1305136
958 Ga0501083_0081703
959 Ga0501045_0002679
960 Ga0501045_0158558
961 nmdc:mga05p37_107381_c1
962 nmdc:mga05p37_583238_c1
963 nmdc:mga05p37_624246_c1
964 nmdc:mga05p37_816763_c1
965 nmdc:mga05p37_827759_c1
966 nmdc:mga09592_776141_c1
967 nmdc:mga09592_88375_c1
968 nmdc:mga0qj67_1527957_c1
969 nmdc:mga0qj67_368128_c1
970 nmdc:mga0qj67_78609_c1
971 nmdc:mga06r32_209925_c1
972 nmdc:mga06r32_367307_c1
973 nmdc:mga06r32_5957_c1
974 nmdc:mga08y16_104857_c1
975 nmdc:mga08y16_11234_c1
976 nmdc:mga08y16_283166_c1
977 nmdc:mga08y16_319384_c1
978 nmdc:mga08y16_420095_c1
979 nmdc:mga0n895_254832_c1
980 nmdc:mga0n895_517550_c1
981 nmdc:mga0rr50_397056_c1
982 nmdc:mga0a205_131394_c1
983 Ga0495655_0008661
984 Ga0501084_0064434
985 Ga0590075_074142
986 Ga0501082_0014318
987 Ga0501082_0110391
988 Ga0501082_1436933
989 Ga0530510_0028907
990 Ga0530510_0163893

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14464

Prok-JAB

Prokaryotic homologs of the JAB domain

4

114

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
2kks-assembly1.cif.gz_A solution structure of protein dsy2949 from desulfitobacterium hafniense. northeast structural genomics consortium target dhr27 0.8011 1 124
1oi0-assembly4.cif.gz_D crystal structure of af2198, a jab1/mpn domain protein from archaeoglobus fulgidus 0.7983 2 123
1oi0-assembly3.cif.gz_C crystal structure of af2198, a jab1/mpn domain protein from archaeoglobus fulgidus 0.796 2 124
2kks-assembly1.cif.gz_A solution structure of protein dsy2949 from desulfitobacterium hafniense. northeast structural genomics consortium target dhr27 0.7953 1 124
5ld9-assembly1.cif.gz_B structure of deubiquitinating enzyme homolog, pyrococcus furiosus jamm1. 0.7814 2 124
ID Description Score Start End Superfamily
af_P9WHS1_10_146_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.8136 2 124 3.40.140.10
af_P9WHS1_10_146_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.8019 2 124 3.40.140.10
2kksA00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.8011 1 124 3.40.140.10
2kksA00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.7953 1 124 3.40.140.10
3skvB01 Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like 0.7816 22 38 2.60.120.260
ID Description Score Start End GO Terms
AF-A0A7V9ZV34-F1-model_v4 Uncharacterized protein 0.9903 80 124
AF-A0A7W0ZG26-F1-model_v4 JAB domain-containing protein 0.9863 58 124
AF-A0A7W0ZG26-F1-model_v4 JAB domain-containing protein 0.9443 58 124
AF-A0A537ZUE3-F1-model_v4 M67 family metallopeptidase 0.9434 2 124 GO:0006508
GO:0008235
GO:0008270
AF-A0A7W0UQF9-F1-model_v4 Mov34/MPN/PAD-1 family protein 0.9433 1 108 GO:0006508
GO:0008235
GO:0008270

Map