F454774

General Info

Members Datasets Scaffolds Average Seq Length
495 298 487 227

Family's Representative Sequence

Representative Sequence 3300046615|Ga0495656_0003965|Ga0495656_0003965_1055_1723
Length 222
Sequence MSLKEKLDAFRADVESGTRIPSSVVEKLHRSTEELVASGQAERAKKAGDRAPTFALEDTDGQTIDLADLLANGPVVLTFYRGVWCPYCNMELQALEEARSDIAARGAQLVAISMQTAPNSRKSIRENKLGFPILIDPHGTVADAYGLRFALPDYLIDTYKTVFKNDLAVINDDPAWTLPMPARYVIEQNGMIVYAEVNPDYTRRPEPAELLPVLDRLGTPIA

Samples

Sample ID Description Type Environment
1 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
2 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
3 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
4 2919085039 Luteibacter sp. 1214 Isolate Unclassified
5 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
6 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
11 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
12 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
13 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
60 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
73 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
100 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
101 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
103 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
105 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
107 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
143 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
147 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
148 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
149 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
150 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
151 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
152 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
153 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
154 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
155 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
156 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
157 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
158 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
159 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
160 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
161 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
162 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
163 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
164 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
165 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
166 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
167 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
168 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
169 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
170 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
171 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
172 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
173 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
174 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
175 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
176 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
177 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
178 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
179 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
180 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
181 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
182 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
183 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
184 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
185 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
186 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
187 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
188 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
189 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
190 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
191 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
192 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
193 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
194 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
195 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
196 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
197 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
198 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
199 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
200 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
201 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
202 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
203 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
204 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
205 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
206 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
207 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
208 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
209 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
210 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
211 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
212 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
213 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
214 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
215 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
216 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
217 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
218 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
219 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
220 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
221 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
222 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
223 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
224 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
225 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
226 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
227 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
228 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
229 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
230 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
231 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
232 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
233 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
234 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
235 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
236 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
237 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
238 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
239 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
240 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
241 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
242 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
243 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
244 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
256 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
257 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
258 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
259 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
260 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
261 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
262 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
263 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
264 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
266 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
267 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
268 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
269 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
270 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
271 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
272 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
273 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
274 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
275 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
276 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
277 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
278 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
279 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
280 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
281 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
282 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
283 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
284 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
285 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
286 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
287 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
288 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
289 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
290 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
291 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
292 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
293 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
294 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
295 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
296 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
297 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
298 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.58
Metatranscriptomes 0
Isolates 1.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.98
Nodule 0.81
Rhizoplane 5.05
Rhizosphere 67.68
Stem 0
Stem Tuber 0
Unclassified 8.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1006292 3300002705 Bacteria 3265
2 JGI25153J46596_10002033 3300003215 Bacteria 11912
3 JGI25153J46596_10005494 3300003215 Bacteria 6637
4 rootH1_10010866 3300003323 Bacteria 10616
5 JGI25160J50197_1000643 3300003354 Bacteria 19445
6 JGI25404J52841_10000962 3300003659 Bacteria 4699
7 JGI25404J52841_10003934 3300003659 Bacteria 2977
8 JGI25404J52841_10035612 3300003659 Bacteria 1060
9 JGI25404J52841_10036666 3300003659 Bacteria 1043
10 Ga0055535_1000098 3300003761 Bacteria 94622
11 Ga0055535_1000116 3300003761 Bacteria 85902
12 Ga0055529_1000143 3300003763 Bacteria 101808
13 Ga0055529_1001669 3300003763 Bacteria 5783
14 Ga0055529_1006616 3300003763 Bacteria 1610
15 Ga0055524_1020443 3300003775 Bacteria 2230
16 Ga0055531_10014048 3300003794 Bacteria 3638
17 Ga0065165_1000919 3300005262 Bacteria 37849
18 Ga0070658_10313706 3300005327 Bacteria 1338
19 Ga0070683_100014030 3300005329 Bacteria 6998
20 Ga0068869_100051811 3300005334 Bacteria 2978
21 Ga0068868_100039416 3300005338 Bacteria 3670
22 Ga0068868_100185542 3300005338 Bacteria 1728
23 Ga0070660_100020107 3300005339 Bacteria 4902
24 Ga0070689_100073041 3300005340 Bacteria 2682
25 Ga0070668_100059728 3300005347 Bacteria 2951
26 Ga0070669_100345565 3300005353 Bacteria 1206
27 Ga0070675_100071751 3300005354 Bacteria 2874
28 Ga0070659_100182315 3300005366 Bacteria 1724
29 Ga0070709_10009422 3300005434 Bacteria 5387
30 Ga0070709_10031363 3300005434 Bacteria 3196
31 Ga0070714_100006531 3300005435 Bacteria 9016
32 Ga0070714_100016694 3300005435 Bacteria 5935
33 Ga0070714_100162044 3300005435 Bacteria 2024
34 Ga0070713_100070573 3300005436 Bacteria 2949
35 Ga0070713_100238541 3300005436 Bacteria 1655
36 Ga0070713_100538441 3300005436 Bacteria 1105
37 Ga0070713_100600886 3300005436 Bacteria 1045
38 Ga0070713_100618502 3300005436 Bacteria 1030
39 Ga0070710_10002003 3300005437 Bacteria 9651
40 Ga0070710_10009243 3300005437 Bacteria 4817
41 Ga0070710_10021472 3300005437 Bacteria 3365
42 Ga0070710_10034062 3300005437 Bacteria 2768
43 Ga0070710_10286179 3300005437 Bacteria 1071
44 Ga0070711_100002848 3300005439 Bacteria 9946
45 Ga0070711_100012764 3300005439 Bacteria 5259
46 Ga0070711_100041464 3300005439 Bacteria 3109
47 Ga0070711_100133426 3300005439 Bacteria 1852
48 Ga0070711_100288661 3300005439 Bacteria 1300
49 Ga0070711_100778680 3300005439 Bacteria 810
50 Ga0070694_100817552 3300005444 Bacteria 765
51 Ga0070708_100019158 3300005445 Bacteria 5744
52 Ga0070663_100017473 3300005455 Bacteria 4682
53 Ga0070663_100054904 3300005455 Bacteria 2849
54 Ga0070663_100135814 3300005455 Bacteria 1872
55 Ga0068867_100180887 3300005459 Bacteria 1676
56 Ga0070706_100158100 3300005467 Bacteria 2116
57 Ga0070706_100614526 3300005467 Bacteria 1010
58 Ga0070706_100696152 3300005467 Bacteria 943
59 Ga0070707_100041208 3300005468 Bacteria 4419
60 Ga0070707_100485926 3300005468 Bacteria 1196
61 Ga0070698_100004761 3300005471 Bacteria 14895
62 Ga0070684_100004163 3300005535 Bacteria 10959
63 Ga0070697_100111474 3300005536 Bacteria 2280
64 Ga0070697_100420222 3300005536 Bacteria 1162
65 Ga0068853_100374282 3300005539 Bacteria 1329
66 Ga0068853_100712640 3300005539 Bacteria 958
67 Ga0070693_100032955 3300005547 Bacteria 2855
68 Ga0070693_100106987 3300005547 Bacteria 1713
69 Ga0070665_100151665 3300005548 Bacteria 2320
70 Ga0068855_100031481 3300005563 Bacteria 6335
71 Ga0070664_100477094 3300005564 Bacteria 1147
72 Ga0068857_100038617 3300005577 Bacteria 4228
73 Ga0068857_100170950 3300005577 Bacteria 1976
74 Ga0068854_100181666 3300005578 Bacteria 1644
75 Ga0068856_100000522 3300005614 Bacteria 42457
76 Ga0068856_100467993 3300005614 Unclassified 1281
77 Ga0068856_100956733 3300005614 Bacteria 875
78 Ga0070702_100050329 3300005615 Bacteria 2379
79 Ga0068864_100047873 3300005618 Bacteria 3674
80 Ga0068866_10019390 3300005718 Bacteria 3095
81 Ga0068863_100434157 3300005841 Bacteria 1287
82 Ga0068858_100047310 3300005842 Bacteria 3988
83 Ga0068858_100073703 3300005842 Bacteria 3169
84 Ga0068860_100150036 3300005843 Bacteria 2244
85 Ga0081455_10035416 3300005937 Bacteria 4461
86 Ga0081455_10065820 3300005937 Bacteria 3029
87 Ga0081540_1002017 3300005983 Bacteria 16953
88 Ga0081540_1002988 3300005983 Bacteria 13554
89 Ga0081540_1039704 3300005983 Bacteria 2464
90 Ga0081540_1119337 3300005983 Bacteria 1098
91 Ga0081540_1120132 3300005983 Bacteria 1092
92 Ga0081539_10023394 3300005985 Bacteria 4049
93 Ga0070717_10013682 3300006028 Bacteria 6225
94 Ga0070717_10016569 3300006028 Bacteria 5716
95 Ga0070717_10162329 3300006028 Bacteria 1939
96 Ga0075365_10079402 3300006038 Bacteria 2220
97 Ga0075368_10019986 3300006042 Bacteria 2532
98 Ga0075368_10031491 3300006042 Bacteria 2057
99 Ga0075363_100019428 3300006048 Bacteria 3398
100 Ga0075364_10061484 3300006051 Bacteria 2464
101 Ga0075364_10072404 3300006051 Bacteria 2271
102 Ga0070715_10010011 3300006163 Bacteria 3364
103 Ga0070715_10077274 3300006163 Bacteria 1502
104 Ga0070716_100286984 3300006173 Bacteria 1138
105 Ga0070716_100305979 3300006173 Bacteria 1108
106 Ga0070716_100440551 3300006173 Bacteria 947
107 Ga0070712_100003366 3300006175 Bacteria 9827
108 Ga0070712_100004279 3300006175 Bacteria 8789
109 Ga0070712_100016349 3300006175 Bacteria 4792
110 Ga0070712_100092676 3300006175 Unclassified 2216
111 Ga0070712_100117863 3300006175 Bacteria 1993
112 Ga0070712_100981528 3300006175 Bacteria 730
113 Ga0075362_10011815 3300006177 Bacteria 3449
114 Ga0075367_10000485 3300006178 Bacteria 14906
115 Ga0075367_10109457 3300006178 Bacteria 1695
116 Ga0075367_10314605 3300006178 Bacteria 986
117 Ga0075369_10026563 3300006186 Bacteria 2414
118 Ga0075369_10053467 3300006186 Bacteria 1753
119 Ga0075369_10180285 3300006186 Bacteria 972
120 Ga0075366_10024017 3300006195 Bacteria 3554
121 Ga0097621_100105348 3300006237 Bacteria 2377
122 Ga0075370_10121565 3300006353 Bacteria 1520
123 Ga0075428_100568881 3300006844 Bacteria 1211
124 Ga0105244_10063206 3300009036 Bacteria 1859
125 Ga0105250_10143838 3300009092 Bacteria 989
126 Ga0105240_10014007 3300009093 Bacteria 10969
127 Ga0105240_10220696 3300009093 Bacteria 2209
128 Ga0111539_10009914 3300009094 Bacteria 12018
129 Ga0105245_10265757 3300009098 Bacteria 1671
130 Ga0105247_10068953 3300009101 Bacteria 2205
131 Ga0105241_10025759 3300009174 Bacteria 4372
132 Ga0105241_10119233 3300009174 Bacteria 2122
133 Ga0105242_10007840 3300009176 Bacteria 8217
134 Ga0105242_10081264 3300009176 Bacteria 2710
135 Ga0105242_10824379 3300009176 Bacteria 920
136 Ga0105248_10096077 3300009177 Bacteria 3337
137 Ga0105248_10214958 3300009177 Bacteria 2166
138 Ga0105237_10116159 3300009545 Bacteria 2669
139 Ga0105238_10080223 3300009551 Bacteria 3253
140 Ga0105238_10692969 3300009551 Bacteria 1030
141 Ga0105249_11344669 3300009553 Bacteria 786
142 Ga0105239_10404386 3300010375 Bacteria 1545
143 Ga0105246_10017342 3300011119 Bacteria 4575
144 Ga0157370_10081628 3300013104 Bacteria 3042
145 Ga0157374_10073465 3300013296 Bacteria 3228
146 Ga0157378_10522483 3300013297 Bacteria 1189
147 Ga0157378_10577530 3300013297 Bacteria 1133
148 Ga0163162_10362302 3300013306 Bacteria 1583
149 Ga0163162_10664770 3300013306 Bacteria 1165
150 Ga0157372_11099605 3300013307 Bacteria 920
151 Ga0163163_10097472 3300014325 Bacteria 2960
152 Ga0157379_10000451 3300014968 Bacteria 33228
153 Ga0157379_10086550 3300014968 Bacteria 2810
154 Ga0157379_10115522 3300014968 Bacteria 2413
155 Ga0157376_10073838 3300014969 Bacteria 2906
156 Ga0182005_1000019 3300015265 Bacteria 296232
157 Ga0163161_10263346 3300017792 Bacteria 1347
158 Ga0209258_100202 3300025242 Bacteria 121896
159 Ga0209677_100323 3300025253 Bacteria 30849
160 Ga0209148_1007089 3300025254 Bacteria 2359
161 Ga0209759_1000540 3300025256 Bacteria 39757
162 Ga0209233_1000326 3300025261 Bacteria 50250
163 Ga0209455_1000181 3300025272 Bacteria 101875
164 Ga0209455_1000456 3300025272 Bacteria 31128
165 Ga0209455_1017166 3300025272 Bacteria 1530
166 Ga0209025_1000114 3300025294 Bacteria 218921
167 Ga0209564_1018669 3300025295 Bacteria 2631
168 Ga0209758_1000106 3300025297 Bacteria 218450
169 Ga0209758_1000946 3300025297 Bacteria 39106
170 Ga0209758_1001741 3300025297 Bacteria 24230
171 Ga0209758_1003180 3300025297 Bacteria 15366
172 Ga0209758_1029297 3300025297 Bacteria 2306
173 Ga0209256_1000470 3300025299 Bacteria 60553
174 Ga0207426_1000374 3300025302 Bacteria 78498
175 Ga0207426_1000440 3300025302 Bacteria 66997
176 Ga0207426_1025073 3300025302 Bacteria 2013
177 Ga0209257_1001596 3300025304 Bacteria 25962
178 Ga0207692_10001373 3300025898 Bacteria 9100
179 Ga0207692_10004848 3300025898 Bacteria 5354
180 Ga0207692_10052250 3300025898 Bacteria 2076
181 Ga0207692_10406308 3300025898 Bacteria 850
182 Ga0207710_10071879 3300025900 Bacteria 1588
183 Ga0207688_10027078 3300025901 Bacteria 3153
184 Ga0207685_10019414 3300025905 Bacteria 2240
185 Ga0207685_10040585 3300025905 Bacteria 1735
186 Ga0207699_10008967 3300025906 Bacteria 4960
187 Ga0207699_10107915 3300025906 Bacteria 1779
188 Ga0207645_10043080 3300025907 Bacteria 2888
189 Ga0207684_10046360 3300025910 Bacteria 3688
190 Ga0207684_10058819 3300025910 Bacteria 3262
191 Ga0207684_10099309 3300025910 Bacteria 2486
192 Ga0207684_10211086 3300025910 Bacteria 1675
193 Ga0207654_10115080 3300025911 Bacteria 1679
194 Ga0207695_10108721 3300025913 Bacteria 2756
195 Ga0207695_10179375 3300025913 Bacteria 2039
196 Ga0207693_10005283 3300025915 Bacteria 10796
197 Ga0207693_10016926 3300025915 Bacteria 5822
198 Ga0207693_10022155 3300025915 Bacteria 5051
199 Ga0207693_10045234 3300025915 Bacteria 3459
200 Ga0207693_10266771 3300025915 Bacteria 1342
201 Ga0207663_10003724 3300025916 Bacteria 7510
202 Ga0207663_10005267 3300025916 Bacteria 6511
203 Ga0207663_10009740 3300025916 Bacteria 5087
204 Ga0207663_10053789 3300025916 Bacteria 2517
205 Ga0207657_10027041 3300025919 Bacteria 5260
206 Ga0207659_10122963 3300025926 Bacteria 1991
207 Ga0207687_10151643 3300025927 Bacteria 1769
208 Ga0207700_10018648 3300025928 Bacteria 4669
209 Ga0207700_10046094 3300025928 Bacteria 3222
210 Ga0207700_10256495 3300025928 Bacteria 1496
211 Ga0207664_10007824 3300025929 Bacteria 7424
212 Ga0207664_10011744 3300025929 Bacteria 6242
213 Ga0207664_10376067 3300025929 Bacteria 1260
214 Ga0207706_10177543 3300025933 Bacteria 1871
215 Ga0207706_10741522 3300025933 Bacteria 837
216 Ga0207686_10072379 3300025934 Bacteria 2221
217 Ga0207686_10093629 3300025934 Bacteria 1990
218 Ga0207686_10416420 3300025934 Bacteria 1027
219 Ga0207665_10009097 3300025939 Bacteria 6521
220 Ga0207665_10091789 3300025939 Bacteria 2106
221 Ga0207665_10435005 3300025939 Bacteria 1004
222 Ga0207689_10046253 3300025942 Bacteria 3596
223 Ga0207661_10000109 3300025944 Bacteria 52179
224 Ga0207679_10762338 3300025945 Bacteria 880
225 Ga0207667_10147229 3300025949 Bacteria 2424
226 Ga0207668_10029851 3300025972 Bacteria 3578
227 Ga0207668_10112587 3300025972 Bacteria 2044
228 Ga0207640_10070768 3300025981 Bacteria 2347
229 Ga0207677_10026797 3300026023 Bacteria 3620
230 Ga0207677_10092912 3300026023 Bacteria 2198
231 Ga0207639_10099214 3300026041 Bacteria 2349
232 Ga0207678_10018200 3300026067 Bacteria 6169
233 Ga0207678_10029084 3300026067 Bacteria 4822
234 Ga0207702_10000014 3300026078 Bacteria 253304
235 Ga0207702_10691244 3300026078 Unclassified 1005
236 Ga0207648_10108432 3300026089 Bacteria 2437
237 Ga0207674_10022235 3300026116 Bacteria 6814
238 Ga0207674_10548929 3300026116 Bacteria 1116
239 Ga0207675_100043261 3300026118 Bacteria 4206
240 Ga0207675_100132445 3300026118 Bacteria 2364
241 Ga0207683_10023473 3300026121 Bacteria 5307
242 Ga0209588_1094163 3300027671 Bacteria 965
243 Ga0209813_10006587 3300027866 Bacteria 2874
244 Ga0209813_10022953 3300027866 Bacteria 1770
245 Ga0209813_10052633 3300027866 Bacteria 1277
246 Ga0207428_10003161 3300027907 Bacteria 16135
247 Ga0268266_10057485 3300028379 Bacteria 3347
248 Ga0268264_10360289 3300028381 Bacteria 1387
249 Ga0268264_10735036 3300028381 Bacteria 982
250 Ga0307517_10113234 3300028786 Bacteria 2049
251 Ga0265339_10011041 3300031249 Bacteria 5582
252 Ga0265331_10002994 3300031250 Bacteria 11115
253 Ga0265327_10009570 3300031251 Bacteria 6966
254 Ga0265316_10091453 3300031344 Bacteria 2321
255 Ga0265313_10000149 3300031595 Bacteria 73203
256 Ga0265314_10074503 3300031711 Bacteria 2261
257 Ga0265342_10013530 3300031712 Bacteria 5468
258 Ga0265342_10124200 3300031712 Bacteria 1451
259 Ga0307510_10057689 3300033180 Bacteria 4027
260 Ga0316215_1002215 3300033544 Bacteria 1838
261 Ga0373927_0095140 3300035695 Unclassified 1936
262 Ga0373947_0382056 3300035725 Bacteria 948
263 Ga0395900_0162757 3300037418 Bacteria 2275
264 Ga0395898_0629453 3300037466 Bacteria 1015
265 Ga0395905_0009881 3300037471 Bacteria 9300
266 Ga0395905_0013955 3300037471 Bacteria 7683
267 Ga0436365_1864084 3300039437 Bacteria 3215
268 Ga0436360_0094327 3300039438 Bacteria 7851
269 Ga0436361_0242200 3300039447 Unclassified 1459
270 Ga0495617_000173 3300046452 Bacteria 40755
271 Ga0495617_025054 3300046452 Bacteria 2012
272 Ga0495591_000132 3300046458 Bacteria 81947
273 Ga0495651_0022333 3300046462 Bacteria 4918
274 Ga0495651_0103783 3300046462 Bacteria 2112
275 Ga0495653_0103819 3300046463 Bacteria 2055
276 Ga0495580_0702920 3300046472 Bacteria 661
277 Ga0495585_0013437 3300046492 Bacteria 4791
278 Ga0495594_0171166 3300046499 Bacteria 1236
279 Ga0495596_0003753 3300046500 Bacteria 7580
280 Ga0495607_0000632 3300046501 Bacteria 34163
281 Ga0495607_0009613 3300046501 Bacteria 6536
282 Ga0495583_0002281 3300046506 Bacteria 16780
283 Ga0495583_0005521 3300046506 Bacteria 8561
284 Ga0495583_0013992 3300046506 Bacteria 4444
285 Ga0495606_0060845 3300046507 Bacteria 2417
286 Ga0495606_0067895 3300046507 Bacteria 2257
287 Ga0495606_0114466 3300046507 Bacteria 1622
288 Ga0495610_0000413 3300046512 Bacteria 43813
289 Ga0495610_0036727 3300046512 Bacteria 2501
290 Ga0495616_0000001 3300046513 Bacteria 780061
291 Ga0495616_0002236 3300046513 Bacteria 12958
292 Ga0495616_0022981 3300046513 Bacteria 3360
293 Ga0495631_0002060 3300046518 Bacteria 11721
294 Ga0495631_0012314 3300046518 Bacteria 4183
295 Ga0495632_0017200 3300046519 Bacteria 3998
296 Ga0495637_0000028 3300046520 Bacteria 144203
297 Ga0495643_0027060 3300046522 Bacteria 3228
298 Ga0495643_0183932 3300046522 Bacteria 1013
299 Ga0495644_0004247 3300046523 Bacteria 5626
300 Ga0495644_0004431 3300046523 Bacteria 5515
301 Ga0495648_0171380 3300046524 Bacteria 1112
302 Ga0495648_0278348 3300046524 Bacteria 794
303 Ga0495642_0004126 3300046528 Bacteria 5668
304 Ga0495652_0022351 3300046529 Bacteria 5611
305 Ga0495654_0001796 3300046530 Bacteria 14287
306 Ga0495587_0083546 3300046536 Bacteria 1850
307 Ga0495609_0005864 3300046538 Bacteria 6367
308 Ga0495622_0022290 3300046557 Bacteria 2951
309 Ga0495622_0038237 3300046557 Bacteria 2234
310 Ga0495633_0004054 3300046558 Bacteria 9468
311 Ga0495656_0003965 3300046615 Bacteria 5030
312 Ga0495668_0010449 3300046616 Bacteria 5617
313 Ga0495634_0106975 3300046642 Bacteria 1802
314 Ga0495625_0120809 3300046660 Bacteria 1783
315 Ga0495625_0243126 3300046660 Bacteria 1171
316 Ga0495635_0021133 3300046663 Bacteria 4535
317 Ga0495661_0024170 3300046665 Bacteria 3933
318 Ga0495588_0004950 3300046674 Bacteria 5912
319 Ga0495588_0113732 3300046674 Bacteria 1426
320 Ga0495657_0020310 3300046675 Bacteria 4777
321 Ga0495646_0126780 3300046680 Bacteria 1440
322 Ga0495669_0080604 3300046684 Bacteria 1493
323 Ga0495613_0012819 3300046689 Bacteria 6234
324 Ga0495624_0266668 3300046690 Bacteria 1034
325 Ga0495670_0182929 3300046691 Bacteria 1107
326 Ga0495671_0024192 3300046692 Bacteria 3166
327 Ga0495649_0010785 3300046694 Bacteria 5383
328 Ga0495649_0101842 3300046694 Bacteria 1526
329 Ga0495589_0028756 3300046794 Bacteria 2804
330 Ga0495589_0031470 3300046794 Bacteria 2670
331 Ga0495604_0043325 3300047317 Bacteria 3523
332 Ga0495674_0664394 3300047319 Bacteria 821
333 Ga0495672_0000305 3300047320 Bacteria 66204
334 Ga0495672_0029163 3300047320 Bacteria 3480
335 Ga0495672_0059960 3300047320 Bacteria 2200
336 Ga0495676_0472448 3300047321 Bacteria 825
337 Ga0495683_0000263 3300047323 Bacteria 47152
338 Ga0495683_0008731 3300047323 Bacteria 5407
339 Ga0495677_0000193 3300047445 Bacteria 28150
340 Ga0495679_011811 3300047446 Bacteria 3354
341 Ga0495685_060145 3300047447 Bacteria 1281
342 Ga0495681_0009582 3300047470 Bacteria 5948
343 Ga0495681_0015824 3300047470 Bacteria 4256
344 Ga0495686_0000080 3300047472 Bacteria 201665
345 Ga0495686_0010881 3300047472 Bacteria 6442
346 Ga0495686_0016433 3300047472 Bacteria 5018
347 Ga0495686_0048691 3300047472 Bacteria 2671
348 Ga0495686_0101508 3300047472 Bacteria 1734
349 Ga0495686_0191432 3300047472 Bacteria 1179
350 Ga0495686_0345800 3300047472 Bacteria 809
351 Ga0495602_0058473 3300048088 Bacteria 3374
352 Ga0495614_0092435 3300048089 Bacteria 1317
353 Ga0495626_0014343 3300048091 Bacteria 4092
354 Ga0495626_0019565 3300048091 Bacteria 3385
355 Ga0496100_0387208 3300048903 Bacteria 1063
356 Ga0496101_0089396 3300048904 Bacteria 2289
357 Ga0496101_0335099 3300048904 Unclassified 1188
358 Ga0496104_0240022 3300048907 Bacteria 1724
359 Ga0496104_0587987 3300048907 Bacteria 1024
360 Ga0496105_0000279 3300048908 Bacteria 33711
361 Ga0496105_0009018 3300048908 Bacteria 7783
362 Ga0496105_0045700 3300048908 Bacteria 3614
363 Ga0496105_0646293 3300048908 Bacteria 817
364 Ga0496106_0011980 3300048909 Bacteria 6400
365 Ga0496106_0509761 3300048909 Bacteria 966
366 Ga0496108_0029177 3300048911 Bacteria 4568
367 Ga0496108_0403419 3300048911 Bacteria 1194
368 Ga0496109_0028701 3300048912 Bacteria 4980
369 Ga0496110_0035219 3300048913 Bacteria 4342
370 Ga0496111_0191092 3300048914 Bacteria 1522
371 Ga0496112_0011261 3300048915 Bacteria 8159
372 Ga0496112_0455309 3300048915 Bacteria 1217
373 Ga0496113_0000565 3300048916 Bacteria 18412
374 Ga0496113_0093870 3300048916 Bacteria 2317
375 Ga0496113_0326712 3300048916 Bacteria 1230
376 Ga0496113_0384282 3300048916 Bacteria 1127
377 Ga0496114_0157379 3300048917 Bacteria 1973
378 Ga0496115_0074903 3300048918 Bacteria 2749
379 Ga0496117_0000426 3300048920 Bacteria 70784
380 Ga0496117_0103104 3300048920 Bacteria 1799
381 Ga0496118_0005023 3300048921 Bacteria 15269
382 Ga0496118_0005180 3300048921 Bacteria 14921
383 Ga0496118_0050750 3300048921 Bacteria 3180
384 Ga0496118_0097661 3300048921 Bacteria 1998
385 Ga0496119_0004761 3300048922 Bacteria 13335
386 Ga0496119_0033341 3300048922 Bacteria 3416
387 Ga0496120_0029062 3300048923 Bacteria 3378
388 Ga0496120_0033023 3300048923 Bacteria 3113
389 Ga0496121_0001529 3300048924 Bacteria 38730
390 Ga0496121_0002248 3300048924 Bacteria 30091
391 Ga0496121_0011243 3300048924 Bacteria 9975
392 Ga0496121_0043430 3300048924 Bacteria 3892
393 Ga0496121_0140096 3300048924 Bacteria 1796
394 Ga0496122_0001697 3300048925 Bacteria 34173
395 Ga0496123_0001172 3300048926 Bacteria 38728
396 Ga0496123_0218179 3300048926 Bacteria 964
397 Ga0496124_0028461 3300048927 Bacteria 4998
398 Ga0496124_0035058 3300048927 Bacteria 4394
399 Ga0496124_0346702 3300048927 Bacteria 1052
400 Ga0496125_0128563 3300048928 Bacteria 1789
401 Ga0496125_0168201 3300048928 Bacteria 1478
402 Ga0496126_0000032 3300048929 Bacteria 372456
403 Ga0496126_0001434 3300048929 Bacteria 37437
404 Ga0496126_0012982 3300048929 Bacteria 8503
405 Ga0496126_0013704 3300048929 Bacteria 8228
406 Ga0496126_0028376 3300048929 Bacteria 5335
407 Ga0496126_0060732 3300048929 Bacteria 3398
408 Ga0496126_0136335 3300048929 Bacteria 2117
409 Ga0496126_0195484 3300048929 Bacteria 1711
410 Ga0496126_0503520 3300048929 Bacteria 967
411 Ga0495678_001769 3300049459 Bacteria 16004
412 Ga0495682_0001392 3300049460 Bacteria 13194
413 Ga0495682_0025454 3300049460 Bacteria 2202
414 Ga0495682_0051036 3300049460 Bacteria 1505
415 Ga0501032_0002223 3300049569 Bacteria 15280
416 Ga0501033_0003373 3300049570 Bacteria 13182
417 Ga0501034_0031546 3300049571 Bacteria 5382
418 Ga0501034_0999203 3300049571 Bacteria 721
419 Ga0501036_0001993 3300049572 Bacteria 15857
420 Ga0501037_0005174 3300049573 Bacteria 9492
421 Ga0501038_0000593 3300049574 Bacteria 32116
422 Ga0501039_0001108 3300049575 Bacteria 19803
423 Ga0501043_0003248 3300049579 Bacteria 13402
424 Ga0501046_0054765 3300049580 Bacteria 3136
425 Ga0501047_0156979 3300049581 Bacteria 2148
426 Ga0501048_0051706 3300049582 Bacteria 2924
427 Ga0501067_0002242 3300049583 Bacteria 10670
428 Ga0501069_0019042 3300049585 Bacteria 3708
429 Ga0501070_0001703 3300049586 Bacteria 19487
430 Ga0501071_0224797 3300049587 Bacteria 1413
431 Ga0501072_0016707 3300049588 Bacteria 5638
432 Ga0501072_0067566 3300049588 Bacteria 2820
433 Ga0501073_0007636 3300049589 Bacteria 8027
434 Ga0501074_0032185 3300049590 Bacteria 3799
435 Ga0501080_0002544 3300049742 Bacteria 15953
436 Ga0501083_0003415 3300049744 Bacteria 11104
437 Ga0501035_0018350 3300049822 Bacteria 6447
438 Ga0501035_0065976 3300049822 Bacteria 3212
439 Ga0501035_0122933 3300049822 Bacteria 2267
440 Ga0501044_0000045 3300049823 Bacteria 148353
441 Ga0501044_0045198 3300049823 Bacteria 4564
442 nmdc:mga00v17_166555_c1 3300050491 Bacteria 1420
443 nmdc:mga00v17_94648_c1 3300050491 Bacteria 1880
444 nmdc:mga0yw44_30587_c1 3300050492 Bacteria 3122
445 nmdc:mga0yw44_3356_c1 3300050492 Bacteria 7097
446 nmdc:mga0k408_220849_c1 3300050493 Bacteria 1131
447 nmdc:mga06z11_129526_c1 3300050494 Bacteria 1416
448 nmdc:mga06z11_489_c1 3300050494 Bacteria 14602
449 nmdc:mga06z11_97360_c1 3300050494 Bacteria 1608
450 nmdc:mga04h51_1669_c1 3300050495 Bacteria 5177
451 nmdc:mga04h51_62780_c1 3300050495 Bacteria 1277
452 nmdc:mga07m45_286579_c1 3300050496 Bacteria 958
453 nmdc:mga08y16_514_c1 3300050511 Bacteria 35764
454 Ga0495619_0050699 3300053085 Bacteria 2741
455 Ga0500643_000052 3300053087 Bacteria 144656
456 Ga0500651_0214878 3300053093 Bacteria 1130
457 Ga0500566_0105883 3300053094 Bacteria 1535
458 Ga0500595_008846 3300053119 Bacteria 4092
459 Ga0500608_000162 3300053122 Bacteria 27771
460 Ga0500608_079047 3300053122 Bacteria 1554
461 Ga0500618_000070 3300053125 Bacteria 86080
462 Ga0500618_000101 3300053125 Bacteria 69860
463 Ga0500658_0057131 3300053134 Bacteria 1612
464 Ga0500658_0085797 3300053134 Bacteria 1354
465 Ga0500559_0000996 3300053136 Bacteria 17679
466 Ga0500559_0007739 3300053136 Bacteria 4746
467 Ga0500559_0046202 3300053136 Bacteria 1908
468 Ga0500559_0087407 3300053136 Bacteria 1423
469 Ga0500564_010539 3300053138 Bacteria 4056
470 Ga0500568_0088630 3300053139 Bacteria 1169
471 Ga0500603_003366 3300053150 Bacteria 3435
472 Ga0500604_0108413 3300053151 Bacteria 921
473 Ga0500616_0006664 3300053153 Bacteria 7510
474 Ga0500616_0211530 3300053153 Bacteria 852
475 Ga0500619_030223 3300053154 Bacteria 1644
476 Ga0500638_036942 3300053162 Bacteria 2369
477 Ga0500636_0000136 3300053177 Bacteria 38111
478 Ga0500636_0010643 3300053177 Bacteria 5369
479 Ga0500637_0251407 3300053178 Bacteria 986
480 Ga0500645_091927 3300053730 Bacteria 860
481 Ga0500596_006831 3300053735 Bacteria 1900
482 Ga0500601_000037 3300053737 Bacteria 27779
483 Ga0500601_001329 3300053737 Bacteria 2727
484 Ga0501084_0005877 3300054114 Bacteria 10101
485 Ga0500661_033101 3300055283 Bacteria 912
486 Ga0501082_0042447 3300060353 Bacteria 3921
487 Ga0501082_0217500 3300060353 Bacteria 1662

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046472 Ga0495580_0702920 Ga0495580_0702920_44_625 193
2 3300047320 Ga0495672_0029163 Ga0495672_0029163_2854_3435 193
3 3300048916 Ga0496113_0384282 Ga0496113_0384282_501_1085 194
4 3300047472 Ga0495686_0101508 Ga0495686_0101508_1129_1716 195
5 iso_pu_bacteria 2935883170 2935883188 215
6 3300046506 Ga0495583_0005521 Ga0495583_0005521_3722_4378 218
7 3300046530 Ga0495654_0001796 Ga0495654_0001796_3727_4383 218
8 3300046452 Ga0495617_000173 Ga0495617_000173_22534_23196 219
9 3300049460 Ga0495682_0025454 Ga0495682_0025454_393_1055 219
10 iso_pu_bacteria 2524023228 2524536708 220
11 iso_pu_bacteria 2904699407 2904704574 220
12 iso_pu_bacteria 8006933436 8006939820 220
13 iso_pu_bacteria 8006973647 8006979589 220
14 3300009036 Ga0105244_10063206 Ga0105244_100632062 221
15 3300046615 Ga0495656_0003965 Ga0495656_0003965_1055_1723 221
16 iso_pu_bacteria 2599185307 2599971941 221
17 3300006175 Ga0070712_100092676 Ga0070712_1000926762 222
18 3300025915 Ga0207693_10266771 Ga0207693_102667712 222
19 3300046513 Ga0495616_0000001 Ga0495616_0000001_392108_392776 222
20 3300046694 Ga0495649_0101842 Ga0495649_0101842_356_1024 222
21 3300047320 Ga0495672_0059960 Ga0495672_0059960_399_1124 222
22 3300048920 Ga0496117_0000426 Ga0496117_0000426_23475_24143 222
23 3300048920 Ga0496117_0103104 Ga0496117_0103104_1049_1717 222
24 3300048921 Ga0496118_0005023 Ga0496118_0005023_6240_6908 222
25 3300048921 Ga0496118_0005180 Ga0496118_0005180_12550_13218 222
26 3300048929 Ga0496126_0000032 Ga0496126_0000032_44113_44781 222
27 3300049460 Ga0495682_0051036 Ga0495682_0051036_540_1208 222
28 3300053153 Ga0500616_0006664 Ga0500616_0006664_424_1092 222
29 iso_pu_bacteria 2919085039 2919088599 222
30 3300037418 Ga0395900_0162757 Ga0395900_0162757_1491_2162 223
31 3300037471 Ga0395905_0013955 Ga0395905_0013955_6448_7119 223
32 3300046501 Ga0495607_0009613 Ga0495607_0009613_3255_3926 223
33 3300046506 Ga0495583_0013992 Ga0495583_0013992_3041_3730 223
34 3300046507 Ga0495606_0114466 Ga0495606_0114466_771_1460 223
35 3300046513 Ga0495616_0002236 Ga0495616_0002236_9768_10457 223
36 3300046518 Ga0495631_0002060 Ga0495631_0002060_8519_9208 223
37 3300046523 Ga0495644_0004247 Ga0495644_0004247_3608_4297 223
38 3300046616 Ga0495668_0010449 Ga0495668_0010449_2396_3085 223
39 3300046692 Ga0495671_0024192 Ga0495671_0024192_2301_2972 223
40 3300046694 Ga0495649_0010785 Ga0495649_0010785_2390_3079 223
41 3300046794 Ga0495589_0028756 Ga0495589_0028756_927_1616 223
42 3300047323 Ga0495683_0008731 Ga0495683_0008731_2255_2926 223
43 3300047470 Ga0495681_0009582 Ga0495681_0009582_2843_3532 223
44 3300047472 Ga0495686_0191432 Ga0495686_0191432_333_1004 223
45 3300048091 Ga0495626_0014343 Ga0495626_0014343_2042_2713 223
46 3300048908 Ga0496105_0646293 Ga0496105_0646293_47_718 223
47 3300048924 Ga0496121_0043430 Ga0496121_0043430_386_1057 223
48 3300048924 Ga0496121_0140096 Ga0496121_0140096_231_902 223
49 3300049459 Ga0495678_001769 Ga0495678_001769_8786_9475 223
50 3300049460 Ga0495682_0001392 Ga0495682_0001392_3733_4422 223
51 3300003323 rootH1_10010866 rootH1_100108667 224
52 3300003659 JGI25404J52841_10036666 JGI25404J52841_100366661 224
53 3300005334 Ga0068869_100051811 Ga0068869_1000518111 224
54 3300005338 Ga0068868_100039416 Ga0068868_1000394162 224
55 3300005340 Ga0070689_100073041 Ga0070689_1000730411 224
56 3300005347 Ga0070668_100059728 Ga0070668_1000597284 224
57 3300005353 Ga0070669_100345565 Ga0070669_1003455652 224
58 3300005354 Ga0070675_100071751 Ga0070675_1000717512 224
59 3300005366 Ga0070659_100182315 Ga0070659_1001823151 224
60 3300005436 Ga0070713_100538441 Ga0070713_1005384412 224
61 3300005437 Ga0070710_10034062 Ga0070710_100340622 224
62 3300005439 Ga0070711_100041464 Ga0070711_1000414644 224
63 3300005439 Ga0070711_100288661 Ga0070711_1002886612 224
64 3300005444 Ga0070694_100817552 Ga0070694_1008175521 224
65 3300005445 Ga0070708_100019158 Ga0070708_1000191584 224
66 3300005455 Ga0070663_100054904 Ga0070663_1000549042 224
67 3300005459 Ga0068867_100180887 Ga0068867_1001808872 224
68 3300005467 Ga0070706_100158100 Ga0070706_1001581002 224
69 3300005467 Ga0070706_100614526 Ga0070706_1006145261 224
70 3300005468 Ga0070707_100485926 Ga0070707_1004859262 224
71 3300005536 Ga0070697_100420222 Ga0070697_1004202221 224
72 3300005539 Ga0068853_100374282 Ga0068853_1003742822 224
73 3300005547 Ga0070693_100032955 Ga0070693_1000329551 224
74 3300005547 Ga0070693_100106987 Ga0070693_1001069872 224
75 3300005548 Ga0070665_100151665 Ga0070665_1001516652 224
76 3300005564 Ga0070664_100477094 Ga0070664_1004770941 224
77 3300005577 Ga0068857_100170950 Ga0068857_1001709502 224
78 3300005578 Ga0068854_100181666 Ga0068854_1001816662 224
79 3300005614 Ga0068856_100467993 Ga0068856_1004679932 224
80 3300005615 Ga0070702_100050329 Ga0070702_1000503292 224
81 3300005618 Ga0068864_100047873 Ga0068864_1000478735 224
82 3300005718 Ga0068866_10019390 Ga0068866_100193902 224
83 3300005841 Ga0068863_100434157 Ga0068863_1004341571 224
84 3300005842 Ga0068858_100047310 Ga0068858_1000473106 224
85 3300005842 Ga0068858_100073703 Ga0068858_1000737032 224
86 3300005843 Ga0068860_100150036 Ga0068860_1001500362 224
87 3300005937 Ga0081455_10065820 Ga0081455_100658202 224
88 3300005983 Ga0081540_1002988 Ga0081540_10029885 224
89 3300005983 Ga0081540_1120132 Ga0081540_11201322 224
90 3300005985 Ga0081539_10023394 Ga0081539_100233944 224
91 3300006042 Ga0075368_10019986 Ga0075368_100199863 224
92 3300006042 Ga0075368_10031491 Ga0075368_100314912 224
93 3300006048 Ga0075363_100019428 Ga0075363_1000194284 224
94 3300006051 Ga0075364_10072404 Ga0075364_100724042 224
95 3300006173 Ga0070716_100305979 Ga0070716_1003059792 224
96 3300006175 Ga0070712_100016349 Ga0070712_1000163492 224
97 3300006175 Ga0070712_100117863 Ga0070712_1001178632 224
98 3300006177 Ga0075362_10011815 Ga0075362_100118151 224
99 3300006178 Ga0075367_10000485 Ga0075367_100004859 224
100 3300006178 Ga0075367_10314605 Ga0075367_103146051 224
101 3300006195 Ga0075366_10024017 Ga0075366_100240172 224
102 3300006237 Ga0097621_100105348 Ga0097621_1001053482 224
103 3300006844 Ga0075428_100568881 Ga0075428_1005688811 224
104 3300009092 Ga0105250_10143838 Ga0105250_101438382 224
105 3300009094 Ga0111539_10009914 Ga0111539_100099147 224
106 3300009098 Ga0105245_10265757 Ga0105245_102657572 224
107 3300009101 Ga0105247_10068953 Ga0105247_100689532 224
108 3300009174 Ga0105241_10025759 Ga0105241_100257592 224
109 3300009174 Ga0105241_10119233 Ga0105241_101192333 224
110 3300009176 Ga0105242_10007840 Ga0105242_100078404 224
111 3300009176 Ga0105242_10081264 Ga0105242_100812642 224
112 3300009176 Ga0105242_10824379 Ga0105242_108243792 224
113 3300009177 Ga0105248_10096077 Ga0105248_100960774 224
114 3300009545 Ga0105237_10116159 Ga0105237_101161593 224
115 3300009551 Ga0105238_10080223 Ga0105238_100802234 224
116 3300009551 Ga0105238_10692969 Ga0105238_106929691 224
117 3300009553 Ga0105249_11344669 Ga0105249_113446691 224
118 3300011119 Ga0105246_10017342 Ga0105246_100173422 224
119 3300013296 Ga0157374_10073465 Ga0157374_100734652 224
120 3300013297 Ga0157378_10522483 Ga0157378_105224832 224
121 3300013297 Ga0157378_10577530 Ga0157378_105775302 224
122 3300013306 Ga0163162_10362302 Ga0163162_103623022 224
123 3300014325 Ga0163163_10097472 Ga0163163_100974723 224
124 3300014968 Ga0157379_10000451 Ga0157379_100004518 224
125 3300014968 Ga0157379_10086550 Ga0157379_100865503 224
126 3300014969 Ga0157376_10073838 Ga0157376_100738382 224
127 3300017792 Ga0163161_10263346 Ga0163161_102633462 224
128 3300025297 Ga0209758_1000946 Ga0209758_100094626 224
129 3300025898 Ga0207692_10406308 Ga0207692_104063081 224
130 3300025900 Ga0207710_10071879 Ga0207710_100718792 224
131 3300025901 Ga0207688_10027078 Ga0207688_100270782 224
132 3300025906 Ga0207699_10107915 Ga0207699_101079152 224
133 3300025907 Ga0207645_10043080 Ga0207645_100430801 224
134 3300025910 Ga0207684_10058819 Ga0207684_100588193 224
135 3300025910 Ga0207684_10099309 Ga0207684_100993093 224
136 3300025910 Ga0207684_10211086 Ga0207684_102110862 224
137 3300025911 Ga0207654_10115080 Ga0207654_101150802 224
138 3300025915 Ga0207693_10022155 Ga0207693_100221553 224
139 3300025916 Ga0207663_10003724 Ga0207663_100037244 224
140 3300025926 Ga0207659_10122963 Ga0207659_101229632 224
141 3300025927 Ga0207687_10151643 Ga0207687_101516432 224
142 3300025928 Ga0207700_10256495 Ga0207700_102564952 224
143 3300025933 Ga0207706_10177543 Ga0207706_101775432 224
144 3300025934 Ga0207686_10072379 Ga0207686_100723792 224
145 3300025934 Ga0207686_10093629 Ga0207686_100936291 224
146 3300025934 Ga0207686_10416420 Ga0207686_104164202 224
147 3300025939 Ga0207665_10091789 Ga0207665_100917892 224
148 3300025942 Ga0207689_10046253 Ga0207689_100462532 224
149 3300025945 Ga0207679_10762338 Ga0207679_107623381 224
150 3300025972 Ga0207668_10112587 Ga0207668_101125872 224
151 3300025981 Ga0207640_10070768 Ga0207640_100707682 224
152 3300026023 Ga0207677_10026797 Ga0207677_100267971 224
153 3300026041 Ga0207639_10099214 Ga0207639_100992142 224
154 3300026078 Ga0207702_10691244 Ga0207702_106912441 224
155 3300026089 Ga0207648_10108432 Ga0207648_101084322 224
156 3300026116 Ga0207674_10548929 Ga0207674_105489292 224
157 3300026118 Ga0207675_100043261 Ga0207675_1000432612 224
158 3300026118 Ga0207675_100132445 Ga0207675_1001324452 224
159 3300026121 Ga0207683_10023473 Ga0207683_100234737 224
160 3300027671 Ga0209588_1094163 Ga0209588_10941632 224
161 3300027866 Ga0209813_10006587 Ga0209813_100065873 224
162 3300027866 Ga0209813_10022953 Ga0209813_100229532 224
163 3300027907 Ga0207428_10003161 Ga0207428_1000316116 224
164 3300028379 Ga0268266_10057485 Ga0268266_100574854 224
165 3300028381 Ga0268264_10360289 Ga0268264_103602892 224
166 3300028381 Ga0268264_10735036 Ga0268264_107350361 224
167 3300035695 Ga0373927_0095140 Ga0373927_0095140_113_787 224
168 3300035725 Ga0373947_0382056 Ga0373947_0382056_136_810 224
169 3300037466 Ga0395898_0629453 Ga0395898_0629453_170_844 224
170 3300037471 Ga0395905_0009881 Ga0395905_0009881_6463_7137 224
171 3300039438 Ga0436360_0094327 Ga0436360_0094327_2951_3625 224
172 3300039447 Ga0436361_0242200 Ga0436361_0242200_583_1257 224
173 3300046524 Ga0495648_0278348 Ga0495648_0278348_38_712 224
174 3300046660 Ga0495625_0243126 Ga0495625_0243126_365_1045 224
175 3300047319 Ga0495674_0664394 Ga0495674_0664394_30_704 224
176 3300047472 Ga0495686_0016433 Ga0495686_0016433_1023_1697 224
177 3300047472 Ga0495686_0048691 Ga0495686_0048691_1274_1954 224
178 3300047472 Ga0495686_0345800 Ga0495686_0345800_117_791 224
179 3300048903 Ga0496100_0387208 Ga0496100_0387208_247_921 224
180 3300048904 Ga0496101_0089396 Ga0496101_0089396_1203_1877 224
181 3300048907 Ga0496104_0587987 Ga0496104_0587987_176_1000 224
182 3300048909 Ga0496106_0509761 Ga0496106_0509761_144_818 224
183 3300048911 Ga0496108_0403419 Ga0496108_0403419_335_1009 224
184 3300048912 Ga0496109_0028701 Ga0496109_0028701_176_1000 224
185 3300048913 Ga0496110_0035219 Ga0496110_0035219_49_873 224
186 3300048921 Ga0496118_0097661 Ga0496118_0097661_201_1025 224
187 3300048924 Ga0496121_0002248 Ga0496121_0002248_20801_21475 224
188 3300048927 Ga0496124_0346702 Ga0496124_0346702_74_898 224
189 3300048928 Ga0496125_0168201 Ga0496125_0168201_556_1230 224
190 3300048929 Ga0496126_0013704 Ga0496126_0013704_4513_5247 224
191 3300049571 Ga0501034_0999203 Ga0501034_0999203_32_706 224
192 3300050491 nmdc:mga00v17_94648_c1 nmdc:mga00v17_94648_c1_320_1144 224
193 3300050494 nmdc:mga06z11_129526_c1 nmdc:mga06z11_129526_c1_342_1166 224
194 3300050494 nmdc:mga06z11_489_c1 nmdc:mga06z11_489_c1_8080_8754 224
195 3300050495 nmdc:mga04h51_1669_c1 nmdc:mga04h51_1669_c1_826_1500 224
196 3300050511 nmdc:mga08y16_514_c1 nmdc:mga08y16_514_c1_20925_21599 224
197 3300053125 Ga0500618_000070 Ga0500618_000070_871_1551 224
198 3300053134 Ga0500658_0057131 Ga0500658_0057131_86_829 224
199 3300053136 Ga0500559_0000996 Ga0500559_0000996_11830_12621 224
200 3300053730 Ga0500645_091927 Ga0500645_091927_42_716 224
201 3300053735 Ga0500596_006831 Ga0500596_006831_13_804 224
202 iso_pu_bacteria 2908756301 2908759718 224
203 3300003215 JGI25153J46596_10002033 JGI25153J46596_1000203311 225
204 3300003215 JGI25153J46596_10005494 JGI25153J46596_100054943 225
205 3300003354 JGI25160J50197_1000643 JGI25160J50197_10006437 225
206 3300003659 JGI25404J52841_10000962 JGI25404J52841_100009622 225
207 3300003659 JGI25404J52841_10003934 JGI25404J52841_100039343 225
208 3300003659 JGI25404J52841_10035612 JGI25404J52841_100356122 225
209 3300003763 Ga0055529_1001669 Ga0055529_10016693 225
210 3300003763 Ga0055529_1006616 Ga0055529_10066163 225
211 3300003775 Ga0055524_1020443 Ga0055524_10204431 225
212 3300003794 Ga0055531_10014048 Ga0055531_100140483 225
213 3300005262 Ga0065165_1000919 Ga0065165_10009198 225
214 3300005329 Ga0070683_100014030 Ga0070683_1000140307 225
215 3300005338 Ga0068868_100185542 Ga0068868_1001855422 225
216 3300005434 Ga0070709_10009422 Ga0070709_100094222 225
217 3300005434 Ga0070709_10031363 Ga0070709_100313632 225
218 3300005435 Ga0070714_100006531 Ga0070714_10000653110 225
219 3300005435 Ga0070714_100016694 Ga0070714_1000166943 225
220 3300005435 Ga0070714_100162044 Ga0070714_1001620442 225
221 3300005436 Ga0070713_100070573 Ga0070713_1000705732 225
222 3300005436 Ga0070713_100238541 Ga0070713_1002385412 225
223 3300005436 Ga0070713_100600886 Ga0070713_1006008862 225
224 3300005436 Ga0070713_100618502 Ga0070713_1006185022 225
225 3300005437 Ga0070710_10002003 Ga0070710_100020036 225
226 3300005437 Ga0070710_10009243 Ga0070710_100092435 225
227 3300005437 Ga0070710_10021472 Ga0070710_100214722 225
228 3300005437 Ga0070710_10286179 Ga0070710_102861791 225
229 3300005439 Ga0070711_100002848 Ga0070711_1000028489 225
230 3300005439 Ga0070711_100012764 Ga0070711_1000127642 225
231 3300005439 Ga0070711_100133426 Ga0070711_1001334262 225
232 3300005439 Ga0070711_100778680 Ga0070711_1007786801 225
233 3300005455 Ga0070663_100135814 Ga0070663_1001358141 225
234 3300005467 Ga0070706_100696152 Ga0070706_1006961521 225
235 3300005468 Ga0070707_100041208 Ga0070707_1000412082 225
236 3300005471 Ga0070698_100004761 Ga0070698_10000476112 225
237 3300005535 Ga0070684_100004163 Ga0070684_1000041634 225
238 3300005536 Ga0070697_100111474 Ga0070697_1001114743 225
239 3300005539 Ga0068853_100712640 Ga0068853_1007126401 225
240 3300005577 Ga0068857_100038617 Ga0068857_1000386175 225
241 3300005614 Ga0068856_100000522 Ga0068856_10000052210 225
242 3300005614 Ga0068856_100956733 Ga0068856_1009567331 225
243 3300005937 Ga0081455_10035416 Ga0081455_100354162 225
244 3300005983 Ga0081540_1002017 Ga0081540_100201711 225
245 3300005983 Ga0081540_1039704 Ga0081540_10397043 225
246 3300005983 Ga0081540_1119337 Ga0081540_11193371 225
247 3300006028 Ga0070717_10013682 Ga0070717_100136824 225
248 3300006028 Ga0070717_10016569 Ga0070717_100165696 225
249 3300006028 Ga0070717_10162329 Ga0070717_101623292 225
250 3300006038 Ga0075365_10079402 Ga0075365_100794023 225
251 3300006051 Ga0075364_10061484 Ga0075364_100614842 225
252 3300006163 Ga0070715_10010011 Ga0070715_100100112 225
253 3300006163 Ga0070715_10077274 Ga0070715_100772742 225
254 3300006173 Ga0070716_100286984 Ga0070716_1002869842 225
255 3300006173 Ga0070716_100440551 Ga0070716_1004405512 225
256 3300006175 Ga0070712_100003366 Ga0070712_1000033662 225
257 3300006175 Ga0070712_100004279 Ga0070712_1000042796 225
258 3300006175 Ga0070712_100981528 Ga0070712_1009815281 225
259 3300006178 Ga0075367_10109457 Ga0075367_101094572 225
260 3300006186 Ga0075369_10026563 Ga0075369_100265632 225
261 3300006186 Ga0075369_10053467 Ga0075369_100534672 225
262 3300006186 Ga0075369_10180285 Ga0075369_101802851 225
263 3300006353 Ga0075370_10121565 Ga0075370_101215652 225
264 3300009093 Ga0105240_10220696 Ga0105240_102206963 225
265 3300009177 Ga0105248_10214958 Ga0105248_102149583 225
266 3300010375 Ga0105239_10404386 Ga0105239_104043862 225
267 3300013306 Ga0163162_10664770 Ga0163162_106647702 225
268 3300013307 Ga0157372_11099605 Ga0157372_110996051 225
269 3300014968 Ga0157379_10115522 Ga0157379_101155222 225
270 3300025253 Ga0209677_100323 Ga0209677_1003236 225
271 3300025261 Ga0209233_1000326 Ga0209233_100032633 225
272 3300025272 Ga0209455_1000456 Ga0209455_10004565 225
273 3300025272 Ga0209455_1017166 Ga0209455_10171662 225
274 3300025294 Ga0209025_1000114 Ga0209025_1000114186 225
275 3300025295 Ga0209564_1018669 Ga0209564_10186693 225
276 3300025297 Ga0209758_1000106 Ga0209758_100010699 225
277 3300025297 Ga0209758_1001741 Ga0209758_100174115 225
278 3300025297 Ga0209758_1003180 Ga0209758_10031805 225
279 3300025297 Ga0209758_1029297 Ga0209758_10292972 225
280 3300025299 Ga0209256_1000470 Ga0209256_100047027 225
281 3300025302 Ga0207426_1000374 Ga0207426_100037436 225
282 3300025302 Ga0207426_1000440 Ga0207426_100044014 225
283 3300025302 Ga0207426_1025073 Ga0207426_10250732 225
284 3300025304 Ga0209257_1001596 Ga0209257_100159614 225
285 3300025898 Ga0207692_10001373 Ga0207692_1000137310 225
286 3300025898 Ga0207692_10004848 Ga0207692_100048482 225
287 3300025898 Ga0207692_10052250 Ga0207692_100522502 225
288 3300025905 Ga0207685_10019414 Ga0207685_100194142 225
289 3300025905 Ga0207685_10040585 Ga0207685_100405852 225
290 3300025906 Ga0207699_10008967 Ga0207699_100089672 225
291 3300025910 Ga0207684_10046360 Ga0207684_100463603 225
292 3300025913 Ga0207695_10179375 Ga0207695_101793753 225
293 3300025915 Ga0207693_10005283 Ga0207693_1000528314 225
294 3300025915 Ga0207693_10016926 Ga0207693_100169266 225
295 3300025915 Ga0207693_10045234 Ga0207693_100452341 225
296 3300025916 Ga0207663_10005267 Ga0207663_100052676 225
297 3300025916 Ga0207663_10009740 Ga0207663_100097402 225
298 3300025916 Ga0207663_10053789 Ga0207663_100537892 225
299 3300025928 Ga0207700_10018648 Ga0207700_100186482 225
300 3300025928 Ga0207700_10046094 Ga0207700_100460942 225
301 3300025929 Ga0207664_10007824 Ga0207664_100078247 225
302 3300025929 Ga0207664_10011744 Ga0207664_100117447 225
303 3300025929 Ga0207664_10376067 Ga0207664_103760672 225
304 3300025933 Ga0207706_10741522 Ga0207706_107415222 225
305 3300025939 Ga0207665_10009097 Ga0207665_100090971 225
306 3300025939 Ga0207665_10435005 Ga0207665_104350052 225
307 3300025944 Ga0207661_10000109 Ga0207661_1000010949 225
308 3300025972 Ga0207668_10029851 Ga0207668_100298512 225
309 3300026023 Ga0207677_10092912 Ga0207677_100929122 225
310 3300026067 Ga0207678_10018200 Ga0207678_100182002 225
311 3300026078 Ga0207702_10000014 Ga0207702_10000014208 225
312 3300026116 Ga0207674_10022235 Ga0207674_100222354 225
313 3300027866 Ga0209813_10052633 Ga0209813_100526332 225
314 3300028786 Ga0307517_10113234 Ga0307517_101132341 225
315 3300031249 Ga0265339_10011041 Ga0265339_100110416 225
316 3300031250 Ga0265331_10002994 Ga0265331_100029945 225
317 3300031344 Ga0265316_10091453 Ga0265316_100914533 225
318 3300031595 Ga0265313_10000149 Ga0265313_1000014947 225
319 3300031711 Ga0265314_10074503 Ga0265314_100745032 225
320 3300031712 Ga0265342_10013530 Ga0265342_100135306 225
321 3300031712 Ga0265342_10124200 Ga0265342_101242001 225
322 3300033180 Ga0307510_10057689 Ga0307510_100576893 225
323 3300033544 Ga0316215_1002215 Ga0316215_10022152 225
324 3300039437 Ga0436365_1864084 Ga0436365_1864084_2502_3194 225
325 3300046462 Ga0495651_0022333 Ga0495651_0022333_4178_4867 225
326 3300046462 Ga0495651_0103783 Ga0495651_0103783_1279_1968 225
327 3300046463 Ga0495653_0103819 Ga0495653_0103819_401_1090 225
328 3300046499 Ga0495594_0171166 Ga0495594_0171166_428_1117 225
329 3300046507 Ga0495606_0067895 Ga0495606_0067895_819_1496 225
330 3300046512 Ga0495610_0036727 Ga0495610_0036727_1030_1707 225
331 3300046522 Ga0495643_0183932 Ga0495643_0183932_294_971 225
332 3300046524 Ga0495648_0171380 Ga0495648_0171380_173_850 225
333 3300046529 Ga0495652_0022351 Ga0495652_0022351_1588_2277 225
334 3300046536 Ga0495587_0083546 Ga0495587_0083546_689_1378 225
335 3300046557 Ga0495622_0022290 Ga0495622_0022290_934_1611 225
336 3300046557 Ga0495622_0038237 Ga0495622_0038237_1031_1720 225
337 3300046642 Ga0495634_0106975 Ga0495634_0106975_120_809 225
338 3300046660 Ga0495625_0120809 Ga0495625_0120809_1046_1723 225
339 3300046663 Ga0495635_0021133 Ga0495635_0021133_3025_3714 225
340 3300046674 Ga0495588_0004950 Ga0495588_0004950_4913_5590 225
341 3300046674 Ga0495588_0113732 Ga0495588_0113732_21_710 225
342 3300046675 Ga0495657_0020310 Ga0495657_0020310_3059_3748 225
343 3300046680 Ga0495646_0126780 Ga0495646_0126780_165_854 225
344 3300046689 Ga0495613_0012819 Ga0495613_0012819_788_1477 225
345 3300046690 Ga0495624_0266668 Ga0495624_0266668_307_996 225
346 3300047317 Ga0495604_0043325 Ga0495604_0043325_470_1159 225
347 3300047321 Ga0495676_0472448 Ga0495676_0472448_40_717 225
348 3300047472 Ga0495686_0010881 Ga0495686_0010881_4313_4990 225
349 3300048088 Ga0495602_0058473 Ga0495602_0058473_256_945 225
350 3300048089 Ga0495614_0092435 Ga0495614_0092435_89_778 225
351 3300048904 Ga0496101_0335099 Ga0496101_0335099_431_1108 225
352 3300048907 Ga0496104_0240022 Ga0496104_0240022_579_1268 225
353 3300048908 Ga0496105_0009018 Ga0496105_0009018_5104_5793 225
354 3300048908 Ga0496105_0045700 Ga0496105_0045700_630_1307 225
355 3300048909 Ga0496106_0011980 Ga0496106_0011980_5233_5910 225
356 3300048914 Ga0496111_0191092 Ga0496111_0191092_329_1006 225
357 3300048915 Ga0496112_0011261 Ga0496112_0011261_4822_5499 225
358 3300048915 Ga0496112_0455309 Ga0496112_0455309_487_1164 225
359 3300048916 Ga0496113_0093870 Ga0496113_0093870_792_1481 225
360 3300048916 Ga0496113_0326712 Ga0496113_0326712_316_993 225
361 3300048917 Ga0496114_0157379 Ga0496114_0157379_995_1672 225
362 3300048921 Ga0496118_0050750 Ga0496118_0050750_1398_2075 225
363 3300048922 Ga0496119_0004761 Ga0496119_0004761_9271_9960 225
364 3300048922 Ga0496119_0033341 Ga0496119_0033341_1715_2392 225
365 3300048923 Ga0496120_0029062 Ga0496120_0029062_216_905 225
366 3300048923 Ga0496120_0033023 Ga0496120_0033023_1406_2083 225
367 3300048924 Ga0496121_0001529 Ga0496121_0001529_24277_24954 225
368 3300048924 Ga0496121_0011243 Ga0496121_0011243_8966_9643 225
369 3300048925 Ga0496122_0001697 Ga0496122_0001697_29080_29763 225
370 3300048926 Ga0496123_0001172 Ga0496123_0001172_4636_5319 225
371 3300048926 Ga0496123_0218179 Ga0496123_0218179_95_784 225
372 3300048927 Ga0496124_0028461 Ga0496124_0028461_1372_2055 225
373 3300048927 Ga0496124_0035058 Ga0496124_0035058_3445_4134 225
374 3300048928 Ga0496125_0128563 Ga0496125_0128563_191_868 225
375 3300048929 Ga0496126_0001434 Ga0496126_0001434_22117_22794 225
376 3300048929 Ga0496126_0012982 Ga0496126_0012982_3225_3917 225
377 3300048929 Ga0496126_0028376 Ga0496126_0028376_3761_4438 225
378 3300048929 Ga0496126_0060732 Ga0496126_0060732_2141_2830 225
379 3300048929 Ga0496126_0136335 Ga0496126_0136335_302_1024 225
380 3300048929 Ga0496126_0195484 Ga0496126_0195484_844_1521 225
381 3300048929 Ga0496126_0503520 Ga0496126_0503520_188_865 225
382 3300049569 Ga0501032_0002223 Ga0501032_0002223_3853_4530 225
383 3300049570 Ga0501033_0003373 Ga0501033_0003373_6488_7165 225
384 3300049571 Ga0501034_0031546 Ga0501034_0031546_968_1645 225
385 3300049572 Ga0501036_0001993 Ga0501036_0001993_14933_15610 225
386 3300049573 Ga0501037_0005174 Ga0501037_0005174_7250_7927 225
387 3300049574 Ga0501038_0000593 Ga0501038_0000593_3630_4307 225
388 3300049575 Ga0501039_0001108 Ga0501039_0001108_12070_12747 225
389 3300049579 Ga0501043_0003248 Ga0501043_0003248_6135_6812 225
390 3300049580 Ga0501046_0054765 Ga0501046_0054765_1292_1969 225
391 3300049581 Ga0501047_0156979 Ga0501047_0156979_376_1053 225
392 3300049582 Ga0501048_0051706 Ga0501048_0051706_1317_1994 225
393 3300049583 Ga0501067_0002242 Ga0501067_0002242_5371_6048 225
394 3300049585 Ga0501069_0019042 Ga0501069_0019042_162_839 225
395 3300049586 Ga0501070_0001703 Ga0501070_0001703_8060_8737 225
396 3300049587 Ga0501071_0224797 Ga0501071_0224797_287_964 225
397 3300049588 Ga0501072_0016707 Ga0501072_0016707_123_800 225
398 3300049588 Ga0501072_0067566 Ga0501072_0067566_1983_2660 225
399 3300049589 Ga0501073_0007636 Ga0501073_0007636_4802_5479 225
400 3300049590 Ga0501074_0032185 Ga0501074_0032185_106_783 225
401 3300049742 Ga0501080_0002544 Ga0501080_0002544_3981_4658 225
402 3300049744 Ga0501083_0003415 Ga0501083_0003415_4312_4989 225
403 3300049822 Ga0501035_0065976 Ga0501035_0065976_257_934 225
404 3300049822 Ga0501035_0122933 Ga0501035_0122933_302_979 225
405 3300049823 Ga0501044_0045198 Ga0501044_0045198_3853_4530 225
406 3300050491 nmdc:mga00v17_166555_c1 nmdc:mga00v17_166555_c1_200_922 225
407 3300050492 nmdc:mga0yw44_30587_c1 nmdc:mga0yw44_30587_c1_958_1635 225
408 3300050492 nmdc:mga0yw44_3356_c1 nmdc:mga0yw44_3356_c1_4160_4837 225
409 3300050493 nmdc:mga0k408_220849_c1 nmdc:mga0k408_220849_c1_340_1017 225
410 3300050494 nmdc:mga06z11_97360_c1 nmdc:mga06z11_97360_c1_513_1235 225
411 3300050495 nmdc:mga04h51_62780_c1 nmdc:mga04h51_62780_c1_273_950 225
412 3300050496 nmdc:mga07m45_286579_c1 nmdc:mga07m45_286579_c1_155_877 225
413 3300053085 Ga0495619_0050699 Ga0495619_0050699_1624_2313 225
414 3300053087 Ga0500643_000052 Ga0500643_000052_26005_26682 225
415 3300053093 Ga0500651_0214878 Ga0500651_0214878_341_1018 225
416 3300053094 Ga0500566_0105883 Ga0500566_0105883_576_1298 225
417 3300053119 Ga0500595_008846 Ga0500595_008846_928_1605 225
418 3300053122 Ga0500608_000162 Ga0500608_000162_1393_2076 225
419 3300053122 Ga0500608_079047 Ga0500608_079047_23_745 225
420 3300053125 Ga0500618_000101 Ga0500618_000101_50700_51377 225
421 3300053134 Ga0500658_0085797 Ga0500658_0085797_104_823 225
422 3300053136 Ga0500559_0007739 Ga0500559_0007739_3239_3922 225
423 3300053136 Ga0500559_0046202 Ga0500559_0046202_475_1164 225
424 3300053136 Ga0500559_0087407 Ga0500559_0087407_25_747 225
425 3300053138 Ga0500564_010539 Ga0500564_010539_1363_2085 225
426 3300053139 Ga0500568_0088630 Ga0500568_0088630_130_819 225
427 3300053150 Ga0500603_003366 Ga0500603_003366_1540_2223 225
428 3300053151 Ga0500604_0108413 Ga0500604_0108413_124_801 225
429 3300053153 Ga0500616_0211530 Ga0500616_0211530_19_696 225
430 3300053154 Ga0500619_030223 Ga0500619_030223_161_883 225
431 3300053162 Ga0500638_036942 Ga0500638_036942_1537_2259 225
432 3300053177 Ga0500636_0000136 Ga0500636_0000136_15924_16646 225
433 3300053177 Ga0500636_0010643 Ga0500636_0010643_3638_4321 225
434 3300053178 Ga0500637_0251407 Ga0500637_0251407_108_830 225
435 3300053737 Ga0500601_000037 Ga0500601_000037_10362_11039 225
436 3300053737 Ga0500601_001329 Ga0500601_001329_158_841 225
437 3300054114 Ga0501084_0005877 Ga0501084_0005877_4062_4739 225
438 3300055283 Ga0500661_033101 Ga0500661_033101_194_871 225
439 3300060353 Ga0501082_0042447 Ga0501082_0042447_376_1053 225
440 3300060353 Ga0501082_0217500 Ga0501082_0217500_71_748 225
441 3300002705 JGI25156J39149_1006292 JGI25156J39149_10062924 226
442 3300003761 Ga0055535_1000098 Ga0055535_100009840 226
443 3300003761 Ga0055535_1000116 Ga0055535_100011632 226
444 3300003763 Ga0055529_1000143 Ga0055529_100014351 226
445 3300005327 Ga0070658_10313706 Ga0070658_103137061 226
446 3300005339 Ga0070660_100020107 Ga0070660_1000201072 226
447 3300005455 Ga0070663_100017473 Ga0070663_1000174731 226
448 3300005563 Ga0068855_100031481 Ga0068855_1000314817 226
449 3300009093 Ga0105240_10014007 Ga0105240_100140078 226
450 3300013104 Ga0157370_10081628 Ga0157370_100816284 226
451 3300015265 Ga0182005_1000019 Ga0182005_1000019190 226
452 3300025242 Ga0209258_100202 Ga0209258_10020251 226
453 3300025254 Ga0209148_1007089 Ga0209148_10070893 226
454 3300025256 Ga0209759_1000540 Ga0209759_100054035 226
455 3300025272 Ga0209455_1000181 Ga0209455_100018151 226
456 3300025913 Ga0207695_10108721 Ga0207695_101087213 226
457 3300025919 Ga0207657_10027041 Ga0207657_100270415 226
458 3300025949 Ga0207667_10147229 Ga0207667_101472293 226
459 3300026067 Ga0207678_10029084 Ga0207678_100290846 226
460 3300031251 Ga0265327_10009570 Ga0265327_100095707 226
461 3300046452 Ga0495617_025054 Ga0495617_025054_329_1012 226
462 3300046458 Ga0495591_000132 Ga0495591_000132_32284_32967 226
463 3300046492 Ga0495585_0013437 Ga0495585_0013437_2413_3096 226
464 3300046500 Ga0495596_0003753 Ga0495596_0003753_5527_6210 226
465 3300046501 Ga0495607_0000632 Ga0495607_0000632_33222_33905 226
466 3300046506 Ga0495583_0002281 Ga0495583_0002281_7430_8113 226
467 3300046507 Ga0495606_0060845 Ga0495606_0060845_741_1424 226
468 3300046512 Ga0495610_0000413 Ga0495610_0000413_33225_33908 226
469 3300046513 Ga0495616_0022981 Ga0495616_0022981_1219_1902 226
470 3300046518 Ga0495631_0012314 Ga0495631_0012314_26_709 226
471 3300046519 Ga0495632_0017200 Ga0495632_0017200_2929_3612 226
472 3300046520 Ga0495637_0000028 Ga0495637_0000028_111237_111920 226
473 3300046522 Ga0495643_0027060 Ga0495643_0027060_2356_3039 226
474 3300046523 Ga0495644_0004431 Ga0495644_0004431_2420_3103 226
475 3300046528 Ga0495642_0004126 Ga0495642_0004126_730_1413 226
476 3300046538 Ga0495609_0005864 Ga0495609_0005864_1786_2469 226
477 3300046558 Ga0495633_0004054 Ga0495633_0004054_5099_5782 226
478 3300046665 Ga0495661_0024170 Ga0495661_0024170_838_1521 226
479 3300046684 Ga0495669_0080604 Ga0495669_0080604_793_1476 226
480 3300046691 Ga0495670_0182929 Ga0495670_0182929_381_1064 226
481 3300046794 Ga0495589_0031470 Ga0495589_0031470_1729_2412 226
482 3300047320 Ga0495672_0000305 Ga0495672_0000305_32284_32967 226
483 3300047323 Ga0495683_0000263 Ga0495683_0000263_33229_33912 226
484 3300047445 Ga0495677_0000193 Ga0495677_0000193_7436_8119 226
485 3300047446 Ga0495679_011811 Ga0495679_011811_259_942 226
486 3300047447 Ga0495685_060145 Ga0495685_060145_518_1201 226
487 3300047470 Ga0495681_0015824 Ga0495681_0015824_2326_3009 226
488 3300047472 Ga0495686_0000080 Ga0495686_0000080_158052_158735 226
489 3300048091 Ga0495626_0019565 Ga0495626_0019565_838_1521 226
490 3300048908 Ga0496105_0000279 Ga0496105_0000279_31099_31779 226
491 3300048911 Ga0496108_0029177 Ga0496108_0029177_450_1130 226
492 3300048916 Ga0496113_0000565 Ga0496113_0000565_358_1038 226
493 3300048918 Ga0496115_0074903 Ga0496115_0074903_1615_2295 226
494 3300049822 Ga0501035_0018350 Ga0501035_0018350_3549_4238 226
495 3300049823 Ga0501044_0000045 Ga0501044_0000045_140982_141671 226

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

47

195

0.98

PF08534

Redoxin

Redoxin

46

214

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hjp-assembly2.cif.gz_D the crystal structure of bcp4 from sulfolobus solfataricus 0.9191 48 221
3hjp-assembly2.cif.gz_D the crystal structure of bcp4 from sulfolobus solfataricus 0.9027 48 221
2cx4-assembly4.cif.gz_H crystal structure of a bacterioferritin comigratory protein peroxiredoxin from the aeropyrum pernix k1 (form-2 crystal) 0.8906 49 223
4xih-assembly1.cif.gz_B-2 crystal structure of the r116a mutant ahpe from mycobacterium tuberculosis 0.8906 46 220
5id2-assembly1.cif.gz_B asymmetry in the active site of mycobacterium tuberculosis ahpe upon exposure to mycothiol 0.8878 47 220
ID Description Score Start End Superfamily
af_Q55E48_3_135_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9093 48 200 3.40.30.10
af_A0A0R0K508_6_109_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9037 51 146 3.40.30.10
2cx4E00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8944 49 223 3.40.30.10
5id2B00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8882 47 220 3.40.30.10
5epfA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8844 48 218 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A4Q3KQR6-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9985 1 183 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A3D9KEQ7-F1-model_v4 deleted 0.9984 1 220
AF-T0G1M1-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) (Thioredoxin-dependent peroxiredoxin Bcp) 0.9955 1 223 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A7X8Y7Z7-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) (Thioredoxin-dependent peroxiredoxin Bcp) 0.9849 1 224 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A2S0JT29-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9839 1 218 GO:0005737
GO:0008379
GO:0034599
GO:0045454

Feature Viewer

pLDDT pTM Quality
94.48 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map