F454756

General Info

Members Datasets Scaffolds Average Seq Length
495 244 990 201

Family's Representative Sequence

Representative Sequence 3300042436|Ga0439435_0000207|Ga0439435_0000207_2289_2915
Length 208
Sequence MYSPAYNRLEDRAELLEFMRANSFVVLVTGTGGTLHASHLPAMVHDDNGAIRVDMHMARANPQWKEFFDDEEVLVVFPGPHAYISPRWYEEQERVPTWNYAAVHAYGTPKVIDDKNLKLQSQRRLIVTLDPQWLARFDALRREYVDRMLDGIVNFEIALTRIDTRWKLSQNRSRREQELIVSELERSADSGERALAALTRKHFIDKSE

Samples

Sample ID Description Type Environment
1 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
116 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
117 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
118 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
119 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
120 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
121 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
122 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
123 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
124 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
125 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
126 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
127 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
128 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
129 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
130 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
131 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
132 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
133 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
134 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
135 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
136 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
137 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
138 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
139 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
140 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
141 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
142 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
143 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
144 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
145 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
146 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
147 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
148 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
149 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
152 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
153 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
154 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
155 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
156 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
157 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
158 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
159 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
160 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
161 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
162 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
163 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
164 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
165 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
166 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
167 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
168 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
169 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
170 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
171 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
172 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
173 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
174 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
175 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
176 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
177 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
178 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
179 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
180 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
181 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
182 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
183 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
184 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
185 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
186 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
187 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
188 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
189 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
190 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
191 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
192 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
193 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
194 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
195 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
196 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
197 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
198 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
199 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
214 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
215 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
216 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
217 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
218 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
219 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
220 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
221 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
222 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
223 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
224 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
225 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
226 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
227 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
230 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
231 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
232 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
233 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
234 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
235 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
236 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
237 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
238 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
239 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
240 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
241 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
242 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
243 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
244 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.2
Nodule 0
Rhizoplane 0.2
Rhizosphere 99.39
Stem 0
Stem Tuber 0
Unclassified 3.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439435_0000207 3300042436 Bacteria 8283
2 rootL2_10105527 3300003322 Bacteria 1066
3 Ga0065707_10104596 3300005295 Bacteria 2687
4 Ga0065707_10180152 3300005295 Bacteria 1423
5 Ga0065707_10239471 3300005295 Bacteria 1161
6 Ga0065707_10294643 3300005295 Unclassified 1017
7 Ga0065707_10431917 3300005295 Bacteria 819
8 Ga0070690_100001328 3300005330 Bacteria 12864
9 Ga0070690_100002214 3300005330 Bacteria 10410
10 Ga0070690_100252918 3300005330 Unclassified 1247
11 Ga0070690_100860031 3300005330 Bacteria 707
12 Ga0068869_100008574 3300005334 Bacteria 6599
13 Ga0068869_100073363 3300005334 Bacteria 2537
14 Ga0068869_100079733 3300005334 Bacteria 2440
15 Ga0070666_10295461 3300005335 Bacteria 1153
16 Ga0070680_100087808 3300005336 Bacteria 2572
17 Ga0070680_100437291 3300005336 Bacteria 1117
18 Ga0070680_100844142 3300005336 Bacteria 790
19 Ga0068868_100001141 3300005338 Bacteria 18157
20 Ga0070689_100053625 3300005340 Bacteria 3121
21 Ga0070689_100055194 3300005340 Bacteria 3077
22 Ga0070689_100381098 3300005340 Unclassified 1188
23 Ga0070689_100533008 3300005340 Bacteria 1010
24 Ga0070691_10010497 3300005341 Bacteria 4227
25 Ga0070687_100006271 3300005343 Bacteria 4868
26 Ga0070669_100002686 3300005353 Bacteria 12816
27 Ga0070675_100078436 3300005354 Bacteria 2750
28 Ga0070688_100124066 3300005365 Bacteria 1734
29 Ga0070688_100434965 3300005365 Bacteria 978
30 Ga0070710_10072868 3300005437 Bacteria 1984
31 Ga0070701_10158795 3300005438 Bacteria 1308
32 Ga0070701_10249183 3300005438 Bacteria 1072
33 Ga0070701_10615751 3300005438 Bacteria 721
34 Ga0070705_100001299 3300005440 Bacteria 13380
35 Ga0070705_100039635 3300005440 Bacteria 2674
36 Ga0070705_100090870 3300005440 Bacteria 1901
37 Ga0070705_100125195 3300005440 Bacteria 1666
38 Ga0070705_100591854 3300005440 Bacteria 857
39 Ga0070700_100000811 3300005441 Bacteria 15345
40 Ga0070694_100000228 3300005444 Bacteria 29562
41 Ga0070694_100070922 3300005444 Bacteria 2400
42 Ga0070694_100080937 3300005444 Bacteria 2258
43 Ga0070694_100144360 3300005444 Bacteria 1732
44 Ga0070694_100334684 3300005444 Bacteria 1169
45 Ga0070694_100608698 3300005444 Bacteria 880
46 Ga0070708_100089590 3300005445 Bacteria 2799
47 Ga0070662_100193962 3300005457 Bacteria 1608
48 Ga0070681_10010051 3300005458 Bacteria 9328
49 Ga0070681_10098643 3300005458 Bacteria 2868
50 Ga0068867_100007400 3300005459 Bacteria 7767
51 Ga0068867_100838442 3300005459 Bacteria 823
52 Ga0070706_100773585 3300005467 Bacteria 889
53 Ga0070707_100581987 3300005468 Bacteria 1082
54 Ga0070698_100280526 3300005471 Bacteria 1597
55 Ga0070698_100329462 3300005471 Bacteria 1458
56 Ga0070699_101050227 3300005518 Bacteria 747
57 Ga0070679_100041906 3300005530 Bacteria 4558
58 Ga0070697_100624823 3300005536 Unclassified 948
59 Ga0070697_100649393 3300005536 Bacteria 929
60 Ga0068853_100457588 3300005539 Bacteria 1201
61 Ga0068853_100695122 3300005539 Bacteria 970
62 Ga0070686_100001157 3300005544 Bacteria 15083
63 Ga0070695_100000894 3300005545 Bacteria 16086
64 Ga0070695_100049301 3300005545 Bacteria 2696
65 Ga0070695_100556696 3300005545 Bacteria 895
66 Ga0070696_100001064 3300005546 Bacteria 17754
67 Ga0070696_100003592 3300005546 Bacteria 10330
68 Ga0070696_100728180 3300005546 Bacteria 811
69 Ga0070704_100006688 3300005549 Bacteria 6817
70 Ga0070704_100010611 3300005549 Bacteria 5610
71 Ga0070704_100023368 3300005549 Bacteria 4037
72 Ga0070704_100056281 3300005549 Bacteria 2792
73 Ga0070704_100487125 3300005549 Unclassified 1068
74 Ga0070704_100579692 3300005549 Bacteria 984
75 Ga0068855_100003762 3300005563 Bacteria 18547
76 Ga0070664_101139966 3300005564 Unclassified 735
77 Ga0068854_100007628 3300005578 Bacteria 6922
78 Ga0068854_100572229 3300005578 Bacteria 961
79 Ga0068856_100059469 3300005614 Bacteria 3774
80 Ga0068856_100233765 3300005614 Bacteria 1853
81 Ga0070702_100009678 3300005615 Bacteria 4728
82 Ga0070702_100083726 3300005615 Bacteria 1917
83 Ga0070702_100441404 3300005615 Bacteria 942
84 Ga0068852_100129477 3300005616 Bacteria 2322
85 Ga0068859_100002466 3300005617 Bacteria 18828
86 Ga0068859_100018776 3300005617 Bacteria 6949
87 Ga0068859_100043368 3300005617 Bacteria 4520
88 Ga0068859_100330433 3300005617 Bacteria 1618
89 Ga0068859_100404238 3300005617 Bacteria 1461
90 Ga0068859_101744624 3300005617 Unclassified 688
91 Ga0068864_100109514 3300005618 Bacteria 2459
92 Ga0068866_10000302 3300005718 Bacteria 23469
93 Ga0068866_10020429 3300005718 Bacteria 3035
94 Ga0068861_100001497 3300005719 Bacteria 14824
95 Ga0068863_100233476 3300005841 Bacteria 1774
96 Ga0068858_100068217 3300005842 Bacteria 3295
97 Ga0068858_100091609 3300005842 Bacteria 2829
98 Ga0068860_100006346 3300005843 Bacteria 11866
99 Ga0068860_100685257 3300005843 Bacteria 1034
100 Ga0068862_100007142 3300005844 Bacteria 9273
101 Ga0068862_100014269 3300005844 Bacteria 6589
102 Ga0068862_100031702 3300005844 Bacteria 4464
103 Ga0068871_100095258 3300006358 Bacteria 2486
104 Ga0068871_100549682 3300006358 Bacteria 1046
105 Ga0075428_100001160 3300006844 Bacteria 28222
106 Ga0075428_100021094 3300006844 Bacteria 7216
107 Ga0075430_100000581 3300006846 Bacteria 27790
108 Ga0075430_100070152 3300006846 Bacteria 2939
109 Ga0075430_100145205 3300006846 Bacteria 1976
110 Ga0075431_100008854 3300006847 Bacteria 10085
111 Ga0075431_100011722 3300006847 Bacteria 8843
112 Ga0075431_100039502 3300006847 Bacteria 4861
113 Ga0075431_100041534 3300006847 Bacteria 4741
114 Ga0075433_10004298 3300006852 Bacteria 11067
115 Ga0075433_10021629 3300006852 Bacteria 5396
116 Ga0075433_10073148 3300006852 Bacteria 3015
117 Ga0075434_100004987 3300006871 Bacteria 12043
118 Ga0075434_100467522 3300006871 Bacteria 1282
119 Ga0075429_100000617 3300006880 Bacteria 27413
120 Ga0075429_100001710 3300006880 Bacteria 18147
121 Ga0075429_100110891 3300006880 Bacteria 2398
122 Ga0075429_100122601 3300006880 Bacteria 2272
123 Ga0075429_100862107 3300006880 Bacteria 793
124 Ga0068865_100002724 3300006881 Bacteria 10488
125 Ga0075436_100000152 3300006914 Bacteria 42960
126 Ga0075436_100022503 3300006914 Bacteria 4329
127 Ga0075436_100030597 3300006914 Bacteria 3704
128 Ga0097620_100002466 3300006931 Bacteria 18828
129 Ga0097620_100018776 3300006931 Bacteria 6949
130 Ga0097620_100043369 3300006931 Bacteria 4520
131 Ga0097620_100330443 3300006931 Bacteria 1618
132 Ga0097620_100404230 3300006931 Bacteria 1461
133 Ga0097620_101744642 3300006931 Unclassified 688
134 Ga0075435_100000533 3300007076 Bacteria 23314
135 Ga0075435_100019845 3300007076 Bacteria 5142
136 Ga0075435_100167245 3300007076 Bacteria 1854
137 Ga0075435_100259786 3300007076 Bacteria 1479
138 Ga0099794_10032853 3300007265 Bacteria 2437
139 Ga0111539_10018923 3300009094 Bacteria 8516
140 Ga0111539_10024047 3300009094 Bacteria 7483
141 Ga0111539_10036241 3300009094 Bacteria 5966
142 Ga0111539_10037274 3300009094 Bacteria 5873
143 Ga0111539_10094322 3300009094 Bacteria 3515
144 Ga0111539_10539826 3300009094 Bacteria 1358
145 Ga0111539_10731343 3300009094 Unclassified 1152
146 Ga0105245_10001017 3300009098 Bacteria 25471
147 Ga0105245_10214887 3300009098 Bacteria 1852
148 Ga0114129_10006282 3300009147 Bacteria 16845
149 Ga0114129_10008545 3300009147 Bacteria 14597
150 Ga0114129_10083659 3300009147 Bacteria 4432
151 Ga0114129_10126348 3300009147 Bacteria 3515
152 Ga0105243_10014115 3300009148 Bacteria 6043
153 Ga0105242_10005204 3300009176 Bacteria 10039
154 Ga0105242_10036741 3300009176 Bacteria 3931
155 Ga0105249_10012265 3300009553 Bacteria 7551
156 Ga0105249_10103813 3300009553 Bacteria 2678
157 Ga0105249_11023903 3300009553 Bacteria 895
158 Ga0105239_10327340 3300010375 Bacteria 1728
159 Ga0157372_10824300 3300013307 Bacteria 1077
160 Ga0157372_11305133 3300013307 Bacteria 837
161 Ga0157375_10597365 3300013308 Bacteria 1263
162 Ga0157380_10012258 3300014326 Bacteria 6211
163 Ga0157377_10040702 3300014745 Bacteria 2575
164 Ga0157377_10297239 3300014745 Bacteria 1064
165 Ga0157376_10103347 3300014969 Bacteria 2494
166 Ga0207653_10014430 3300025885 Bacteria 2479
167 Ga0207692_10257130 3300025898 Bacteria 1048
168 Ga0207642_10000809 3300025899 Bacteria 9743
169 Ga0207642_10034404 3300025899 Bacteria 2154
170 Ga0207645_10037403 3300025907 Bacteria 3114
171 Ga0207643_10260325 3300025908 Bacteria 1071
172 Ga0207707_10079582 3300025912 Bacteria 2862
173 Ga0207707_10229965 3300025912 Bacteria 1613
174 Ga0207660_10008185 3300025917 Bacteria 6765
175 Ga0207660_10042730 3300025917 Bacteria 3183
176 Ga0207660_10157012 3300025917 Bacteria 1752
177 Ga0207660_10780251 3300025917 Bacteria 780
178 Ga0207662_10001491 3300025918 Bacteria 11363
179 Ga0207662_10037149 3300025918 Bacteria 2850
180 Ga0207652_10344123 3300025921 Bacteria 1346
181 Ga0207681_10009478 3300025923 Bacteria 5950
182 Ga0207687_10001010 3300025927 Bacteria 19091
183 Ga0207687_10117330 3300025927 Bacteria 1985
184 Ga0207644_10188200 3300025931 Bacteria 1622
185 Ga0207706_10208110 3300025933 Bacteria 1715
186 Ga0207686_10033345 3300025934 Bacteria 3074
187 Ga0207686_10081393 3300025934 Bacteria 2114
188 Ga0207709_10000532 3300025935 Bacteria 32789
189 Ga0207709_10039286 3300025935 Bacteria 2825
190 Ga0207670_10001905 3300025936 Bacteria 10903
191 Ga0207670_10172535 3300025936 Bacteria 1623
192 Ga0207691_10386407 3300025940 Bacteria 1195
193 Ga0207711_10778773 3300025941 Bacteria 891
194 Ga0207689_10001100 3300025942 Bacteria 26064
195 Ga0207689_10067835 3300025942 Bacteria 2931
196 Ga0207667_10013443 3300025949 Bacteria 9368
197 Ga0207651_11514960 3300025960 Bacteria 604
198 Ga0207712_10030646 3300025961 Bacteria 3618
199 Ga0207712_10055011 3300025961 Bacteria 2797
200 Ga0207668_10019027 3300025972 Bacteria 4332
201 Ga0207640_10019813 3300025981 Bacteria 3982
202 Ga0207640_10506980 3300025981 Bacteria 1006
203 Ga0207703_10019064 3300026035 Bacteria 5359
204 Ga0207639_10316844 3300026041 Bacteria 1384
205 Ga0207708_10001449 3300026075 Bacteria 17783
206 Ga0207708_10146839 3300026075 Bacteria 1854
207 Ga0207708_10222380 3300026075 Bacteria 1513
208 Ga0207702_10074366 3300026078 Bacteria 2933
209 Ga0207641_10134990 3300026088 Bacteria 2220
210 Ga0207648_10000297 3300026089 Bacteria 54091
211 Ga0207648_10001964 3300026089 Bacteria 22482
212 Ga0207674_10349082 3300026116 Bacteria 1430
213 Ga0207675_100002266 3300026118 Bacteria 19130
214 Ga0209967_1000944 3300027364 Bacteria 3717
215 Ga0209981_1005634 3300027378 Bacteria 1665
216 Ga0209996_1010078 3300027395 Bacteria 1250
217 Ga0209968_1009836 3300027526 Bacteria 1466
218 Ga0209968_1014135 3300027526 Bacteria 1256
219 Ga0209999_1000966 3300027543 Bacteria 4847
220 Ga0209999_1007133 3300027543 Bacteria 2011
221 Ga0209999_1017405 3300027543 Bacteria 1310
222 Ga0209983_1006749 3300027665 Bacteria 2355
223 Ga0209966_1001708 3300027695 Bacteria 3734
224 Ga0209966_1023963 3300027695 Bacteria 1203
225 Ga0207428_10001985 3300027907 Bacteria 20758
226 Ga0207428_10058488 3300027907 Bacteria 3059
227 Ga0207428_10170708 3300027907 Bacteria 1647
228 Ga0268265_10001755 3300028380 Bacteria 17430
229 Ga0268265_10013789 3300028380 Bacteria 5499
230 Ga0268265_10046435 3300028380 Bacteria 3246
231 Ga0268265_10136995 3300028380 Bacteria 2044
232 Ga0268264_10011861 3300028381 Bacteria 7180
233 Ga0307408_100272344 3300031548 Bacteria 1406
234 Ga0316579_10021055 3300031691 Bacteria 2900
235 Ga0307407_10285444 3300031903 Bacteria 1145
236 Ga0307412_10437893 3300031911 Bacteria 1074
237 Ga0307412_10797960 3300031911 Bacteria 819
238 Ga0307409_100173455 3300031995 Bacteria 1901
239 Ga0307416_100259286 3300032002 Bacteria 1698
240 Ga0307416_100271160 3300032002 Bacteria 1666
241 Ga0307416_100302246 3300032002 Bacteria 1591
242 Ga0307411_10151282 3300032005 Bacteria 1725
243 Ga0307411_10263036 3300032005 Bacteria 1363
244 Ga0307411_10532277 3300032005 Bacteria 999
245 Ga0316583_10019303 3300032133 Bacteria 2447
246 Ga0373950_0003570 3300034818 Bacteria 2232
247 Ga0373938_0014284 3300034957 Bacteria 1522
248 Ga0373938_0029917 3300034957 Bacteria 1159
249 Ga0373926_0020471 3300035083 Bacteria 2285
250 Ga0373928_0023681 3300035084 Bacteria 1311
251 Ga0373929_0007917 3300035085 Bacteria 1951
252 Ga0373934_0083927 3300035086 Bacteria 1281
253 Ga0373940_0046610 3300035088 Unclassified 1206
254 Ga0373944_0014715 3300035089 Bacteria 2187
255 Ga0373949_0005386 3300035090 Bacteria 2857
256 Ga0373951_0007540 3300035091 Bacteria 2470
257 Ga0373932_0001850 3300035112 Bacteria 5671
258 Ga0373936_0016217 3300035113 Bacteria 2864
259 Ga0373939_0024838 3300035114 Bacteria 1673
260 Ga0373939_0033717 3300035114 Bacteria 1498
261 Ga0373945_0011626 3300035116 Bacteria 2912
262 Ga0373953_0045059 3300035117 Bacteria 1766
263 Ga0373956_0186422 3300035119 Unclassified 982
264 Ga0373960_0140361 3300035121 Unclassified 818
265 Ga0373943_0012696 3300035170 Bacteria 3797
266 Ga0373943_0022248 3300035170 Bacteria 2935
267 Ga0373946_0021598 3300035171 Bacteria 2497
268 Ga0373955_0009632 3300035172 Bacteria 4535
269 Ga0373955_0096599 3300035172 Bacteria 1691
270 Ga0373942_0010970 3300035207 Bacteria 2140
271 Ga0373961_0004501 3300035241 Bacteria 3369
272 Ga0373962_0081263 3300035242 Bacteria 984
273 Ga0373924_0011395 3300035410 Bacteria 3302
274 Ga0373931_0000165 3300035691 Bacteria 28797
275 Ga0373931_0000633 3300035691 Bacteria 14607
276 Ga0373931_0024064 3300035691 Bacteria 3081
277 Ga0373931_0046467 3300035691 Bacteria 2295
278 Ga0373931_0648094 3300035691 Unclassified 694
279 Ga0373933_0214651 3300035724 Bacteria 1233
280 Ga0373947_0005621 3300035725 Bacteria 7310
281 Ga0373947_0161943 3300035725 Bacteria 1447
282 Ga0373937_0002317 3300036401 Bacteria 15907
283 Ga0373937_0013112 3300036401 Bacteria 7300
284 Ga0373937_0035144 3300036401 Bacteria 4560
285 Ga0373937_0179520 3300036401 Bacteria 1988
286 Ga0373937_0640657 3300036401 Bacteria 1008
287 Ga0316582_0004812 3300036647 Bacteria 6884
288 Ga0373925_0156545 3300037068 Bacteria 1792
289 Ga0373925_0278562 3300037068 Bacteria 1346
290 Ga0373925_0314043 3300037068 Bacteria 1267
291 Ga0436360_1260745 3300039438 Bacteria 1406
292 Ga0451807_0929959 3300041486 Bacteria 1667
293 Ga0439441_000389 3300042001 Bacteria 4587
294 Ga0439441_001999 3300042001 Bacteria 2803
295 Ga0439441_013572 3300042001 Bacteria 1416
296 Ga0439443_022199 3300042003 Bacteria 1006
297 Ga0450921_009227 3300042123 Bacteria 813
298 Ga0439434_0000209 3300042435 Bacteria 16171
299 Ga0439435_0000249 3300042436 Bacteria 7786
300 Ga0439435_0002421 3300042436 Bacteria 3702
301 Ga0439444_0003857 3300042437 Bacteria 2145
302 Ga0439444_0005000 3300042437 Bacteria 1951
303 Ga0439460_0002574 3300042461 Bacteria 4379
304 Ga0451577_0115501 3300042876 Bacteria 2403
305 Ga0451576_0001930 3300045051 Bacteria 33143
306 Ga0451576_0021461 3300045051 Bacteria 7018
307 Ga0451576_0161700 3300045051 Bacteria 2337
308 Ga0451576_0198511 3300045051 Bacteria 2095
309 Ga0451576_0338227 3300045051 Bacteria 1575
310 Ga0451576_1572428 3300045051 Unclassified 682
311 Ga0495592_0004316 3300046454 Bacteria 10401
312 Ga0495592_0443358 3300046454 Bacteria 815
313 Ga0495603_0004928 3300046455 Bacteria 7990
314 Ga0495651_0050990 3300046462 Bacteria 3192
315 Ga0495653_0032999 3300046463 Bacteria 4106
316 Ga0495580_0006052 3300046472 Bacteria 9902
317 Ga0495582_0060610 3300046473 Bacteria 2088
318 Ga0495639_0007478 3300046475 Bacteria 4690
319 Ga0495662_0004019 3300046476 Bacteria 7411
320 Ga0495594_0033879 3300046499 Bacteria 2778
321 Ga0495608_0001054 3300046511 Bacteria 19402
322 Ga0495618_0024888 3300046514 Bacteria 3712
323 Ga0495628_0006245 3300046516 Bacteria 10414
324 Ga0495630_0009281 3300046517 Bacteria 7072
325 Ga0495630_0731317 3300046517 Unclassified 757
326 Ga0495666_0011404 3300046526 Bacteria 4433
327 Ga0495652_0031309 3300046529 Bacteria 4659
328 Ga0495665_0038212 3300046531 Bacteria 2560
329 Ga0495640_0006865 3300046533 Bacteria 8967
330 Ga0495640_0010281 3300046533 Bacteria 7237
331 Ga0495586_0005860 3300046535 Bacteria 6566
332 Ga0495586_0030123 3300046535 Bacteria 2904
333 Ga0495586_0064418 3300046535 Bacteria 1997
334 Ga0495587_0018005 3300046536 Bacteria 4380
335 Ga0495645_0182216 3300046543 Bacteria 1438
336 Ga0495622_0114698 3300046557 Bacteria 1232
337 Ga0495667_0010346 3300046559 Bacteria 6311
338 Ga0495634_0015359 3300046642 Bacteria 5504
339 Ga0495634_0371525 3300046642 Bacteria 853
340 Ga0495611_0330598 3300046648 Bacteria 701
341 Ga0495635_0320572 3300046663 Bacteria 1037
342 Ga0495657_0127015 3300046675 Bacteria 1601
343 Ga0495647_0003537 3300046681 Bacteria 5005
344 Ga0495658_0085044 3300046683 Bacteria 1863
345 Ga0495624_0018823 3300046690 Bacteria 4616
346 Ga0495624_0065800 3300046690 Bacteria 2264
347 Ga0495624_0209113 3300046690 Unclassified 1184
348 Ga0495581_0031895 3300047315 Bacteria 3053
349 Ga0495581_0082126 3300047315 Bacteria 1866
350 Ga0495604_0021069 3300047317 Bacteria 5201
351 Ga0495636_0002233 3300047318 Bacteria 7437
352 Ga0495676_0085887 3300047321 Bacteria 2369
353 Ga0495680_0006560 3300047322 Bacteria 10799
354 Ga0495684_0074454 3300047471 Bacteria 2580
355 Ga0495593_0145103 3300047673 Bacteria 1201
356 Ga0495593_0220111 3300047673 Bacteria 953
357 Ga0501031_0136187 3300049568 Bacteria 1604
358 Ga0501031_0425841 3300049568 Bacteria 858
359 Ga0501032_0052933 3300049569 Bacteria 2735
360 Ga0501033_0036620 3300049570 Bacteria 3675
361 Ga0501033_0398394 3300049570 Bacteria 960
362 Ga0501034_0187512 3300049571 Bacteria 2031
363 Ga0501034_1014036 3300049571 Bacteria 714
364 Ga0501036_0017023 3300049572 Bacteria 6075
365 Ga0501036_0058044 3300049572 Bacteria 3279
366 Ga0501036_0074339 3300049572 Bacteria 2874
367 Ga0501036_0624086 3300049572 Bacteria 893
368 Ga0501037_0061447 3300049573 Bacteria 2739
369 Ga0501037_0152236 3300049573 Bacteria 1653
370 Ga0501038_0003148 3300049574 Bacteria 15404
371 Ga0501038_0013212 3300049574 Bacteria 7531
372 Ga0501039_0023222 3300049575 Bacteria 4760
373 Ga0501039_0023883 3300049575 Bacteria 4694
374 Ga0501039_0216470 3300049575 Bacteria 1506
375 Ga0501039_0231304 3300049575 Bacteria 1453
376 Ga0501040_0000430 3300049576 Bacteria 24912
377 Ga0501040_0006197 3300049576 Bacteria 7756
378 Ga0501040_0176909 3300049576 Bacteria 1512
379 Ga0501040_0206349 3300049576 Bacteria 1396
380 Ga0501041_0009051 3300049577 Bacteria 5859
381 Ga0501041_0152490 3300049577 Bacteria 1443
382 Ga0501041_0362709 3300049577 Bacteria 916
383 Ga0501042_0020885 3300049578 Bacteria 4559
384 Ga0501042_0037499 3300049578 Bacteria 3440
385 Ga0501042_0388739 3300049578 Bacteria 1010
386 Ga0501046_0012540 3300049580 Bacteria 7208
387 Ga0501046_0025252 3300049580 Bacteria 4864
388 Ga0501046_0083068 3300049580 Bacteria 2473
389 Ga0501046_0128419 3300049580 Bacteria 1924
390 Ga0501047_0110037 3300049581 Bacteria 2638
391 Ga0501048_0000114 3300049582 Bacteria 45735
392 Ga0501048_0019576 3300049582 Bacteria 4964
393 Ga0501048_0091016 3300049582 Bacteria 2152
394 Ga0501068_0033854 3300049584 Bacteria 3045
395 Ga0501069_0130776 3300049585 Bacteria 1437
396 Ga0501071_0033111 3300049587 Bacteria 3672
397 Ga0501071_0053869 3300049587 Bacteria 2902
398 Ga0501071_0061927 3300049587 Bacteria 2710
399 Ga0501071_0588950 3300049587 Bacteria 855
400 Ga0501072_0012705 3300049588 Bacteria 6438
401 Ga0501072_0016773 3300049588 Bacteria 5623
402 Ga0501072_0070886 3300049588 Bacteria 2753
403 Ga0501072_0101784 3300049588 Bacteria 2283
404 Ga0501072_0231084 3300049588 Unclassified 1473
405 Ga0501072_0433443 3300049588 Bacteria 1041
406 Ga0501072_0611498 3300049588 Bacteria 859
407 Ga0501072_0629667 3300049588 Bacteria 845
408 Ga0501073_0192349 3300049589 Bacteria 1412
409 Ga0501073_0197278 3300049589 Bacteria 1392
410 Ga0501074_0027837 3300049590 Bacteria 4097
411 Ga0501074_0070291 3300049590 Bacteria 2517
412 Ga0501074_0300941 3300049590 Bacteria 1139
413 Ga0501075_0078186 3300049591 Bacteria 2504
414 Ga0501075_0083165 3300049591 Bacteria 2424
415 Ga0501075_0374507 3300049591 Bacteria 1085
416 Ga0501075_0484685 3300049591 Bacteria 943
417 Ga0501076_0000440 3300049592 Bacteria 26295
418 Ga0501076_0002635 3300049592 Bacteria 12378
419 Ga0501076_0059579 3300049592 Bacteria 3037
420 Ga0501076_0149256 3300049592 Bacteria 1901
421 Ga0501076_0719535 3300049592 Bacteria 824
422 Ga0501077_0003896 3300049593 Bacteria 8984
423 Ga0501077_0071260 3300049593 Bacteria 2203
424 Ga0501257_098218 3300049686 Bacteria 767
425 Ga0501079_0002366 3300049741 Bacteria 13700
426 Ga0501079_0031080 3300049741 Bacteria 4103
427 Ga0501079_0038380 3300049741 Bacteria 3693
428 Ga0501079_0170587 3300049741 Bacteria 1697
429 Ga0501080_0001892 3300049742 Bacteria 18029
430 Ga0501080_0024338 3300049742 Bacteria 5614
431 Ga0501080_0058135 3300049742 Bacteria 3600
432 Ga0501080_0111892 3300049742 Bacteria 2531
433 Ga0501081_0000059 3300049743 Bacteria 42443
434 Ga0501081_0004845 3300049743 Bacteria 8648
435 Ga0501081_0209195 3300049743 Bacteria 1416
436 Ga0501083_0136538 3300049744 Bacteria 1607
437 Ga0501035_0042580 3300049822 Bacteria 4095
438 Ga0501035_0074702 3300049822 Bacteria 2998
439 Ga0501035_0676115 3300049822 Bacteria 835
440 Ga0501044_0378766 3300049823 Bacteria 1330
441 Ga0501045_0009707 3300049824 Bacteria 6732
442 Ga0501045_0034129 3300049824 Bacteria 3692
443 Ga0501045_0092860 3300049824 Bacteria 2232
444 Ga0501045_0210889 3300049824 Bacteria 1447
445 nmdc:mga05p37_1051379_c1 3300050507 Bacteria 859
446 nmdc:mga05p37_5788_c1 3300050507 Bacteria 14531
447 nmdc:mga05p37_72_c1 3300050507 Bacteria 88725
448 nmdc:mga09592_3229_c1 3300050508 Bacteria 13192
449 nmdc:mga09592_364782_c1 3300050508 Bacteria 1250
450 nmdc:mga09592_739_c1 3300050508 Bacteria 25175
451 nmdc:mga0qj67_205451_c1 3300050509 Bacteria 1600
452 nmdc:mga0qj67_345824_c1 3300050509 Bacteria 1203
453 nmdc:mga0qj67_369_c1 3300050509 Bacteria 30904
454 nmdc:mga0qj67_3854_c1 3300050509 Bacteria 10836
455 nmdc:mga0qj67_99709_c1 3300050509 Bacteria 2341
456 nmdc:mga06r32_15519_c1 3300050510 Bacteria 6918
457 nmdc:mga06r32_278448_c1 3300050510 Bacteria 1660
458 nmdc:mga06r32_285527_c1 3300050510 Bacteria 1637
459 nmdc:mga06r32_458690_c1 3300050510 Bacteria 1254
460 nmdc:mga06r32_47314_c1 3300050510 Bacteria 4108
461 nmdc:mga06r32_5539_c1 3300050510 Bacteria 11382
462 nmdc:mga08y16_105630_c1 3300050511 Bacteria 2932
463 nmdc:mga08y16_25228_c1 3300050511 Bacteria 6268
464 nmdc:mga08y16_2532_c1 3300050511 Bacteria 18792
465 nmdc:mga08y16_509423_c1 3300050511 Bacteria 1222
466 nmdc:mga08y16_605494_c1 3300050511 Unclassified 1104
467 nmdc:mga0n895_169310_c1 3300050512 Bacteria 2216
468 nmdc:mga0n895_252710_c1 3300050512 Bacteria 1789
469 nmdc:mga0n895_25471_c1 3300050512 Bacteria 5590
470 nmdc:mga0n895_307_c1 3300050512 Bacteria 32508
471 nmdc:mga0rr50_2271_c1 3300050513 Bacteria 10781
472 nmdc:mga0rr50_3057_c2 3300050513 Bacteria 3467
473 nmdc:mga0rr50_377206_c1 3300050513 Bacteria 1195
474 nmdc:mga08x19_17534_c1 3300050514 Bacteria 4382
475 nmdc:mga08x19_181289_c1 3300050514 Bacteria 1438
476 nmdc:mga08x19_2576_c1 3300050514 Bacteria 11011
477 nmdc:mga08x19_5329_c1 3300050514 Bacteria 7602
478 nmdc:mga0a205_21494_c1 3300050515 Bacteria 6102
479 nmdc:mga0a205_3356_c1 3300050515 Bacteria 14254
480 nmdc:mga0a205_68251_c1 3300050515 Bacteria 3434
481 nmdc:mga0a205_814295_c1 3300050515 Bacteria 781
482 Ga0495601_0008072 3300053077 Bacteria 6205
483 Ga0495612_0196073 3300053078 Bacteria 890
484 Ga0500566_0114568 3300053094 Bacteria 1461
485 Ga0501084_0017946 3300054114 Bacteria 5892
486 Ga0501084_0454407 3300054114 Bacteria 1083
487 Ga0501084_0826236 3300054114 Bacteria 780
488 Ga0501082_0014688 3300060353 Bacteria 6747
489 Ga0501082_0026902 3300060353 Bacteria 4956
490 Ga0501082_0107212 3300060353 Bacteria 2417
491 Ga0501082_0702591 3300060353 Bacteria 885
492 Ga0530510_0003467 3300061734 Bacteria 10848
493 Ga0530510_0026256 3300061734 Bacteria 4167
494 Ga0530510_0073140 3300061734 Bacteria 2488
495 Ga0530510_0291378 3300061734 Bacteria 1220
496 Ga0439435_0000207
497 rootL2_10105527
498 Ga0065707_10104596
499 Ga0065707_10180152
500 Ga0065707_10239471
501 Ga0065707_10294643
502 Ga0065707_10431917
503 Ga0070690_100001328
504 Ga0070690_100002214
505 Ga0070690_100252918
506 Ga0070690_100860031
507 Ga0068869_100008574
508 Ga0068869_100073363
509 Ga0068869_100079733
510 Ga0070666_10295461
511 Ga0070680_100087808
512 Ga0070680_100437291
513 Ga0070680_100844142
514 Ga0068868_100001141
515 Ga0070689_100053625
516 Ga0070689_100055194
517 Ga0070689_100381098
518 Ga0070689_100533008
519 Ga0070691_10010497
520 Ga0070687_100006271
521 Ga0070669_100002686
522 Ga0070675_100078436
523 Ga0070688_100124066
524 Ga0070688_100434965
525 Ga0070710_10072868
526 Ga0070701_10158795
527 Ga0070701_10249183
528 Ga0070701_10615751
529 Ga0070705_100001299
530 Ga0070705_100039635
531 Ga0070705_100090870
532 Ga0070705_100125195
533 Ga0070705_100591854
534 Ga0070700_100000811
535 Ga0070694_100000228
536 Ga0070694_100070922
537 Ga0070694_100080937
538 Ga0070694_100144360
539 Ga0070694_100334684
540 Ga0070694_100608698
541 Ga0070708_100089590
542 Ga0070662_100193962
543 Ga0070681_10010051
544 Ga0070681_10098643
545 Ga0068867_100007400
546 Ga0068867_100838442
547 Ga0070706_100773585
548 Ga0070707_100581987
549 Ga0070698_100280526
550 Ga0070698_100329462
551 Ga0070699_101050227
552 Ga0070679_100041906
553 Ga0070697_100624823
554 Ga0070697_100649393
555 Ga0068853_100457588
556 Ga0068853_100695122
557 Ga0070686_100001157
558 Ga0070695_100000894
559 Ga0070695_100049301
560 Ga0070695_100556696
561 Ga0070696_100001064
562 Ga0070696_100003592
563 Ga0070696_100728180
564 Ga0070704_100006688
565 Ga0070704_100010611
566 Ga0070704_100023368
567 Ga0070704_100056281
568 Ga0070704_100487125
569 Ga0070704_100579692
570 Ga0068855_100003762
571 Ga0070664_101139966
572 Ga0068854_100007628
573 Ga0068854_100572229
574 Ga0068856_100059469
575 Ga0068856_100233765
576 Ga0070702_100009678
577 Ga0070702_100083726
578 Ga0070702_100441404
579 Ga0068852_100129477
580 Ga0068859_100002466
581 Ga0068859_100018776
582 Ga0068859_100043368
583 Ga0068859_100330433
584 Ga0068859_100404238
585 Ga0068859_101744624
586 Ga0068864_100109514
587 Ga0068866_10000302
588 Ga0068866_10020429
589 Ga0068861_100001497
590 Ga0068863_100233476
591 Ga0068858_100068217
592 Ga0068858_100091609
593 Ga0068860_100006346
594 Ga0068860_100685257
595 Ga0068862_100007142
596 Ga0068862_100014269
597 Ga0068862_100031702
598 Ga0068871_100095258
599 Ga0068871_100549682
600 Ga0075428_100001160
601 Ga0075428_100021094
602 Ga0075430_100000581
603 Ga0075430_100070152
604 Ga0075430_100145205
605 Ga0075431_100008854
606 Ga0075431_100011722
607 Ga0075431_100039502
608 Ga0075431_100041534
609 Ga0075433_10004298
610 Ga0075433_10021629
611 Ga0075433_10073148
612 Ga0075434_100004987
613 Ga0075434_100467522
614 Ga0075429_100000617
615 Ga0075429_100001710
616 Ga0075429_100110891
617 Ga0075429_100122601
618 Ga0075429_100862107
619 Ga0068865_100002724
620 Ga0075436_100000152
621 Ga0075436_100022503
622 Ga0075436_100030597
623 Ga0097620_100002466
624 Ga0097620_100018776
625 Ga0097620_100043369
626 Ga0097620_100330443
627 Ga0097620_100404230
628 Ga0097620_101744642
629 Ga0075435_100000533
630 Ga0075435_100019845
631 Ga0075435_100167245
632 Ga0075435_100259786
633 Ga0099794_10032853
634 Ga0111539_10018923
635 Ga0111539_10024047
636 Ga0111539_10036241
637 Ga0111539_10037274
638 Ga0111539_10094322
639 Ga0111539_10539826
640 Ga0111539_10731343
641 Ga0105245_10001017
642 Ga0105245_10214887
643 Ga0114129_10006282
644 Ga0114129_10008545
645 Ga0114129_10083659
646 Ga0114129_10126348
647 Ga0105243_10014115
648 Ga0105242_10005204
649 Ga0105242_10036741
650 Ga0105249_10012265
651 Ga0105249_10103813
652 Ga0105249_11023903
653 Ga0105239_10327340
654 Ga0157372_10824300
655 Ga0157372_11305133
656 Ga0157375_10597365
657 Ga0157380_10012258
658 Ga0157377_10040702
659 Ga0157377_10297239
660 Ga0157376_10103347
661 Ga0207653_10014430
662 Ga0207692_10257130
663 Ga0207642_10000809
664 Ga0207642_10034404
665 Ga0207645_10037403
666 Ga0207643_10260325
667 Ga0207707_10079582
668 Ga0207707_10229965
669 Ga0207660_10008185
670 Ga0207660_10042730
671 Ga0207660_10157012
672 Ga0207660_10780251
673 Ga0207662_10001491
674 Ga0207662_10037149
675 Ga0207652_10344123
676 Ga0207681_10009478
677 Ga0207687_10001010
678 Ga0207687_10117330
679 Ga0207644_10188200
680 Ga0207706_10208110
681 Ga0207686_10033345
682 Ga0207686_10081393
683 Ga0207709_10000532
684 Ga0207709_10039286
685 Ga0207670_10001905
686 Ga0207670_10172535
687 Ga0207691_10386407
688 Ga0207711_10778773
689 Ga0207689_10001100
690 Ga0207689_10067835
691 Ga0207667_10013443
692 Ga0207651_11514960
693 Ga0207712_10030646
694 Ga0207712_10055011
695 Ga0207668_10019027
696 Ga0207640_10019813
697 Ga0207640_10506980
698 Ga0207703_10019064
699 Ga0207639_10316844
700 Ga0207708_10001449
701 Ga0207708_10146839
702 Ga0207708_10222380
703 Ga0207702_10074366
704 Ga0207641_10134990
705 Ga0207648_10000297
706 Ga0207648_10001964
707 Ga0207674_10349082
708 Ga0207675_100002266
709 Ga0209967_1000944
710 Ga0209981_1005634
711 Ga0209996_1010078
712 Ga0209968_1009836
713 Ga0209968_1014135
714 Ga0209999_1000966
715 Ga0209999_1007133
716 Ga0209999_1017405
717 Ga0209983_1006749
718 Ga0209966_1001708
719 Ga0209966_1023963
720 Ga0207428_10001985
721 Ga0207428_10058488
722 Ga0207428_10170708
723 Ga0268265_10001755
724 Ga0268265_10013789
725 Ga0268265_10046435
726 Ga0268265_10136995
727 Ga0268264_10011861
728 Ga0307408_100272344
729 Ga0316579_10021055
730 Ga0307407_10285444
731 Ga0307412_10437893
732 Ga0307412_10797960
733 Ga0307409_100173455
734 Ga0307416_100259286
735 Ga0307416_100271160
736 Ga0307416_100302246
737 Ga0307411_10151282
738 Ga0307411_10263036
739 Ga0307411_10532277
740 Ga0316583_10019303
741 Ga0373950_0003570
742 Ga0373938_0014284
743 Ga0373938_0029917
744 Ga0373926_0020471
745 Ga0373928_0023681
746 Ga0373929_0007917
747 Ga0373934_0083927
748 Ga0373940_0046610
749 Ga0373944_0014715
750 Ga0373949_0005386
751 Ga0373951_0007540
752 Ga0373932_0001850
753 Ga0373936_0016217
754 Ga0373939_0024838
755 Ga0373939_0033717
756 Ga0373945_0011626
757 Ga0373953_0045059
758 Ga0373956_0186422
759 Ga0373960_0140361
760 Ga0373943_0012696
761 Ga0373943_0022248
762 Ga0373946_0021598
763 Ga0373955_0009632
764 Ga0373955_0096599
765 Ga0373942_0010970
766 Ga0373961_0004501
767 Ga0373962_0081263
768 Ga0373924_0011395
769 Ga0373931_0000165
770 Ga0373931_0000633
771 Ga0373931_0024064
772 Ga0373931_0046467
773 Ga0373931_0648094
774 Ga0373933_0214651
775 Ga0373947_0005621
776 Ga0373947_0161943
777 Ga0373937_0002317
778 Ga0373937_0013112
779 Ga0373937_0035144
780 Ga0373937_0179520
781 Ga0373937_0640657
782 Ga0316582_0004812
783 Ga0373925_0156545
784 Ga0373925_0278562
785 Ga0373925_0314043
786 Ga0436360_1260745
787 Ga0451807_0929959
788 Ga0439441_000389
789 Ga0439441_001999
790 Ga0439441_013572
791 Ga0439443_022199
792 Ga0450921_009227
793 Ga0439434_0000209
794 Ga0439435_0000249
795 Ga0439435_0002421
796 Ga0439444_0003857
797 Ga0439444_0005000
798 Ga0439460_0002574
799 Ga0451577_0115501
800 Ga0451576_0001930
801 Ga0451576_0021461
802 Ga0451576_0161700
803 Ga0451576_0198511
804 Ga0451576_0338227
805 Ga0451576_1572428
806 Ga0495592_0004316
807 Ga0495592_0443358
808 Ga0495603_0004928
809 Ga0495651_0050990
810 Ga0495653_0032999
811 Ga0495580_0006052
812 Ga0495582_0060610
813 Ga0495639_0007478
814 Ga0495662_0004019
815 Ga0495594_0033879
816 Ga0495608_0001054
817 Ga0495618_0024888
818 Ga0495628_0006245
819 Ga0495630_0009281
820 Ga0495630_0731317
821 Ga0495666_0011404
822 Ga0495652_0031309
823 Ga0495665_0038212
824 Ga0495640_0006865
825 Ga0495640_0010281
826 Ga0495586_0005860
827 Ga0495586_0030123
828 Ga0495586_0064418
829 Ga0495587_0018005
830 Ga0495645_0182216
831 Ga0495622_0114698
832 Ga0495667_0010346
833 Ga0495634_0015359
834 Ga0495634_0371525
835 Ga0495611_0330598
836 Ga0495635_0320572
837 Ga0495657_0127015
838 Ga0495647_0003537
839 Ga0495658_0085044
840 Ga0495624_0018823
841 Ga0495624_0065800
842 Ga0495624_0209113
843 Ga0495581_0031895
844 Ga0495581_0082126
845 Ga0495604_0021069
846 Ga0495636_0002233
847 Ga0495676_0085887
848 Ga0495680_0006560
849 Ga0495684_0074454
850 Ga0495593_0145103
851 Ga0495593_0220111
852 Ga0501031_0136187
853 Ga0501031_0425841
854 Ga0501032_0052933
855 Ga0501033_0036620
856 Ga0501033_0398394
857 Ga0501034_0187512
858 Ga0501034_1014036
859 Ga0501036_0017023
860 Ga0501036_0058044
861 Ga0501036_0074339
862 Ga0501036_0624086
863 Ga0501037_0061447
864 Ga0501037_0152236
865 Ga0501038_0003148
866 Ga0501038_0013212
867 Ga0501039_0023222
868 Ga0501039_0023883
869 Ga0501039_0216470
870 Ga0501039_0231304
871 Ga0501040_0000430
872 Ga0501040_0006197
873 Ga0501040_0176909
874 Ga0501040_0206349
875 Ga0501041_0009051
876 Ga0501041_0152490
877 Ga0501041_0362709
878 Ga0501042_0020885
879 Ga0501042_0037499
880 Ga0501042_0388739
881 Ga0501046_0012540
882 Ga0501046_0025252
883 Ga0501046_0083068
884 Ga0501046_0128419
885 Ga0501047_0110037
886 Ga0501048_0000114
887 Ga0501048_0019576
888 Ga0501048_0091016
889 Ga0501068_0033854
890 Ga0501069_0130776
891 Ga0501071_0033111
892 Ga0501071_0053869
893 Ga0501071_0061927
894 Ga0501071_0588950
895 Ga0501072_0012705
896 Ga0501072_0016773
897 Ga0501072_0070886
898 Ga0501072_0101784
899 Ga0501072_0231084
900 Ga0501072_0433443
901 Ga0501072_0611498
902 Ga0501072_0629667
903 Ga0501073_0192349
904 Ga0501073_0197278
905 Ga0501074_0027837
906 Ga0501074_0070291
907 Ga0501074_0300941
908 Ga0501075_0078186
909 Ga0501075_0083165
910 Ga0501075_0374507
911 Ga0501075_0484685
912 Ga0501076_0000440
913 Ga0501076_0002635
914 Ga0501076_0059579
915 Ga0501076_0149256
916 Ga0501076_0719535
917 Ga0501077_0003896
918 Ga0501077_0071260
919 Ga0501257_098218
920 Ga0501079_0002366
921 Ga0501079_0031080
922 Ga0501079_0038380
923 Ga0501079_0170587
924 Ga0501080_0001892
925 Ga0501080_0024338
926 Ga0501080_0058135
927 Ga0501080_0111892
928 Ga0501081_0000059
929 Ga0501081_0004845
930 Ga0501081_0209195
931 Ga0501083_0136538
932 Ga0501035_0042580
933 Ga0501035_0074702
934 Ga0501035_0676115
935 Ga0501044_0378766
936 Ga0501045_0009707
937 Ga0501045_0034129
938 Ga0501045_0092860
939 Ga0501045_0210889
940 nmdc:mga05p37_1051379_c1
941 nmdc:mga05p37_5788_c1
942 nmdc:mga05p37_72_c1
943 nmdc:mga09592_3229_c1
944 nmdc:mga09592_364782_c1
945 nmdc:mga09592_739_c1
946 nmdc:mga0qj67_205451_c1
947 nmdc:mga0qj67_345824_c1
948 nmdc:mga0qj67_369_c1
949 nmdc:mga0qj67_3854_c1
950 nmdc:mga0qj67_99709_c1
951 nmdc:mga06r32_15519_c1
952 nmdc:mga06r32_278448_c1
953 nmdc:mga06r32_285527_c1
954 nmdc:mga06r32_458690_c1
955 nmdc:mga06r32_47314_c1
956 nmdc:mga06r32_5539_c1
957 nmdc:mga08y16_105630_c1
958 nmdc:mga08y16_25228_c1
959 nmdc:mga08y16_2532_c1
960 nmdc:mga08y16_509423_c1
961 nmdc:mga08y16_605494_c1
962 nmdc:mga0n895_169310_c1
963 nmdc:mga0n895_252710_c1
964 nmdc:mga0n895_25471_c1
965 nmdc:mga0n895_307_c1
966 nmdc:mga0rr50_2271_c1
967 nmdc:mga0rr50_3057_c2
968 nmdc:mga0rr50_377206_c1
969 nmdc:mga08x19_17534_c1
970 nmdc:mga08x19_181289_c1
971 nmdc:mga08x19_2576_c1
972 nmdc:mga08x19_5329_c1
973 nmdc:mga0a205_21494_c1
974 nmdc:mga0a205_3356_c1
975 nmdc:mga0a205_68251_c1
976 nmdc:mga0a205_814295_c1
977 Ga0495601_0008072
978 Ga0495612_0196073
979 Ga0500566_0114568
980 Ga0501084_0017946
981 Ga0501084_0454407
982 Ga0501084_0826236
983 Ga0501082_0014688
984 Ga0501082_0026902
985 Ga0501082_0107212
986 Ga0501082_0702591
987 Ga0530510_0003467
988 Ga0530510_0026256
989 Ga0530510_0073140
990 Ga0530510_0291378

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04299

FMN_bind_2

Putative FMN-binding domain

1

161

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cp3-assembly1.cif.gz_A-2 crystal structure of conserved protein of unknown function dip1874 from corynebacterium diphtheriae 0.7748 3 51
3swj-assembly1.cif.gz_A crystal structure of campylobacter jejuni chuz 0.7269 5 66
7qih-assembly1.cif.gz_B complex of the yersinia enterocolitica type iii secretion proteins yscx and yscy 0.6933 136 173
2ol5-assembly1.cif.gz_B crystal structure of a protease synthase and sporulation negative regulatory protein pai 2 from bacillus stearothermophilus 0.6675 2 172
2ig6-assembly1.cif.gz_B crystal structure of a nimc/nima family protein (ca_c2569) from clostridium acetobutylicum at 1.80 a resolution 0.6522 5 64
ID Description Score Start End Superfamily
3cp3A00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7744 3 51 2.30.110.10
3fkhA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7461 3 48 2.30.110.10
af_O53240_10_156_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.6895 1 64 2.30.110.10
af_A0A1D8PQI8_1_209_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.6618 1 174 2.30.110.10
af_A0A1D8PQI8_1_209_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.6418 1 174 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A2D6SA63-F1-model_v4 deleted 0.8206 1 81
AF-A0A1E4ZRH9-F1-model_v4 General stress protein FMN-binding split barrel domain-containing protein 0.8043 5 64
AF-A0A553JJG7-F1-model_v4 FMN-binding negative transcriptional regulator 0.7434 1 86
AF-A0A1F4BGR9-F1-model_v4 Transcriptional regulator 0.7398 1 175
AF-A0A7Y4VIH7-F1-model_v4 FMN-binding negative transcriptional regulator 0.7383 1 175

Map