F454747

General Info

Members Datasets Scaffolds Average Seq Length
495 260 990 246

Family's Representative Sequence

Representative Sequence 3300035724|Ga0373933_0008885|Ga0373933_0008885_1137_1946
Length 269
Sequence MIRPRRPILGAKSIVGMGTPIMCDKLEHPWNCTDLGRRHFLKMTGAATALSLAGGSLFTDPAHADALTRAQRDKMTPEQIVEVMRKGNERFRMGVRKNRNYLNEQRASATGQYPAAVLLTCIDSRAPAEVIMDLGIGDIFNCRVAGNVENQDILGSMEFACKLAGAKVVLVMGHTACGAIKGAIDNAELGNLTGLLAKIKPAVQATTYSGERSAKNYPFVDAVARKNVEMTVTDIRKDSPVLAELEAKGTIKITGAMYNLETGAVEFFG

Samples

Sample ID Description Type Environment
1 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
109 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
159 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
165 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
166 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
167 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
168 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
169 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
170 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
171 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
172 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
173 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
174 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
175 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
176 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
177 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
178 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
179 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
180 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
181 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
182 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
183 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
184 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
185 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
186 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
187 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
188 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
189 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
190 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
191 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
192 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
193 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
194 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
195 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
196 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
197 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
198 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
199 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
200 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
201 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
202 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
203 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
204 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
205 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
206 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
207 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
208 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
209 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
210 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
211 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
212 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
213 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
214 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
215 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
216 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
217 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
218 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
219 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
220 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
221 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
222 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
223 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
224 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
225 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
226 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
227 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
228 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
229 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
230 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
231 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
232 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
233 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
234 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
235 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
236 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
237 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
238 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
239 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
240 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
241 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
242 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
243 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
244 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
245 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
246 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
247 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
248 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
249 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
250 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
251 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
252 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
253 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
254 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
255 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
256 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
257 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
258 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
259 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
260 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.18
Metatranscriptomes 0
Isolates 1.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.61
Nodule 2.02
Rhizoplane 5.45
Rhizosphere 90.71
Stem 0
Stem Tuber 0
Unclassified 4.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373933_0008885 3300035724 Bacteria 5479
2 JGI24743J22301_10036464 3300001991 Bacteria 979
3 Ga0065712_10003060 3300005290 Bacteria 4805
4 Ga0065715_10135489 3300005293 Bacteria 1937
5 Ga0065715_10196543 3300005293 Bacteria 1384
6 Ga0065707_10244581 3300005295 Bacteria 1140
7 Ga0070676_10008839 3300005328 Bacteria 5439
8 Ga0070676_10031495 3300005328 Bacteria 3031
9 Ga0070676_10240921 3300005328 Bacteria 1203
10 Ga0070683_100026492 3300005329 Bacteria 5221
11 Ga0070670_100015685 3300005331 Bacteria 6503
12 Ga0070670_100209276 3300005331 Unclassified 1696
13 Ga0068869_100000907 3300005334 Bacteria 17056
14 Ga0068869_100003169 3300005334 Bacteria 10039
15 Ga0068869_100082700 3300005334 Bacteria 2400
16 Ga0070666_10044568 3300005335 Bacteria 2972
17 Ga0070680_100004956 3300005336 Bacteria 10026
18 Ga0070682_100267001 3300005337 Bacteria 1241
19 Ga0068868_100005476 3300005338 Bacteria 8929
20 Ga0068868_100211957 3300005338 Bacteria 1619
21 Ga0068868_100294207 3300005338 Bacteria 1377
22 Ga0068868_100571861 3300005338 Unclassified 998
23 Ga0070660_100003636 3300005339 Bacteria 10650
24 Ga0070660_100170088 3300005339 Unclassified 1760
25 Ga0070660_100398139 3300005339 Bacteria 1138
26 Ga0070660_100475349 3300005339 Bacteria 1038
27 Ga0070661_100004753 3300005344 Bacteria 9347
28 Ga0070661_100022068 3300005344 Bacteria 4555
29 Ga0070668_100035021 3300005347 Bacteria 3827
30 Ga0070669_100010742 3300005353 Bacteria 6498
31 Ga0070669_100423264 3300005353 Bacteria 1093
32 Ga0070675_100000285 3300005354 Bacteria 33772
33 Ga0070675_100005179 3300005354 Bacteria 9944
34 Ga0070675_100086587 3300005354 Bacteria 2619
35 Ga0070671_100001487 3300005355 Bacteria 17515
36 Ga0070671_100011413 3300005355 Bacteria 7144
37 Ga0070671_100231472 3300005355 Bacteria 1568
38 Ga0070674_100018737 3300005356 Bacteria 4384
39 Ga0070674_100219491 3300005356 Unclassified 1478
40 Ga0070674_100288688 3300005356 Bacteria 1303
41 Ga0070673_100015880 3300005364 Bacteria 5303
42 Ga0070673_100017020 3300005364 Bacteria 5158
43 Ga0070673_100138466 3300005364 Bacteria 2051
44 Ga0070673_100376208 3300005364 Bacteria 1265
45 Ga0070673_100536651 3300005364 Unclassified 1061
46 Ga0070659_100001189 3300005366 Bacteria 18951
47 Ga0070659_100006855 3300005366 Bacteria 8251
48 Ga0070659_100068263 3300005366 Bacteria 2820
49 Ga0070659_100140078 3300005366 Bacteria 1969
50 Ga0070659_100193530 3300005366 Bacteria 1672
51 Ga0070667_100018972 3300005367 Bacteria 5702
52 Ga0070709_10258574 3300005434 Bacteria 1257
53 Ga0070709_10318488 3300005434 Unclassified 1141
54 Ga0070711_100329885 3300005439 Bacteria 1221
55 Ga0070705_100239209 3300005440 Bacteria 1268
56 Ga0070708_100635951 3300005445 Bacteria 1006
57 Ga0070663_100010189 3300005455 Bacteria 5852
58 Ga0070663_100127515 3300005455 Bacteria 1929
59 Ga0070678_100000922 3300005456 Bacteria 15107
60 Ga0070678_100007149 3300005456 Bacteria 6600
61 Ga0070678_100112190 3300005456 Bacteria 2135
62 Ga0070678_100293949 3300005456 Bacteria 1378
63 Ga0070662_100002396 3300005457 Bacteria 11519
64 Ga0070662_100003417 3300005457 Bacteria 9898
65 Ga0070681_10006766 3300005458 Bacteria 11161
66 Ga0070681_10010352 3300005458 Bacteria 9207
67 Ga0070681_10079628 3300005458 Bacteria 3233
68 Ga0070681_10258477 3300005458 Bacteria 1653
69 Ga0068867_100020706 3300005459 Bacteria 4688
70 Ga0068867_100154512 3300005459 Bacteria 1805
71 Ga0068867_100406872 3300005459 Bacteria 1149
72 Ga0070706_100490861 3300005467 Bacteria 1143
73 Ga0070698_100356310 3300005471 Bacteria 1395
74 Ga0070699_100120021 3300005518 Unclassified 2311
75 Ga0070699_100266956 3300005518 Bacteria 1531
76 Ga0070699_100562089 3300005518 Bacteria 1039
77 Ga0070679_100000932 3300005530 Bacteria 25387
78 Ga0070679_100010271 3300005530 Bacteria 8876
79 Ga0070697_100059702 3300005536 Unclassified 3106
80 Ga0068853_100006201 3300005539 Bacteria 9467
81 Ga0070672_100003476 3300005543 Bacteria 10207
82 Ga0070672_100003994 3300005543 Bacteria 9619
83 Ga0070672_100009957 3300005543 Bacteria 6576
84 Ga0070686_100265754 3300005544 Bacteria 1259
85 Ga0070696_100144527 3300005546 Bacteria 1741
86 Ga0070693_100028671 3300005547 Bacteria 3029
87 Ga0070665_100003009 3300005548 Bacteria 18178
88 Ga0070665_100713280 3300005548 Bacteria 1016
89 Ga0070704_100188442 3300005549 Unclassified 1656
90 Ga0068855_100000418 3300005563 Bacteria 52788
91 Ga0068855_100094029 3300005563 Bacteria 3457
92 Ga0070664_100006481 3300005564 Bacteria 9436
93 Ga0070664_100056451 3300005564 Bacteria 3336
94 Ga0070664_100407711 3300005564 Bacteria 1244
95 Ga0068857_100012769 3300005577 Bacteria 7322
96 Ga0068857_100189105 3300005577 Bacteria 1875
97 Ga0068857_100290724 3300005577 Bacteria 1505
98 Ga0068854_100009745 3300005578 Bacteria 6210
99 Ga0068854_100057767 3300005578 Bacteria 2799
100 Ga0068856_100005040 3300005614 Bacteria 13076
101 Ga0068856_100008676 3300005614 Bacteria 9890
102 Ga0068856_100130093 3300005614 Bacteria 2522
103 Ga0068852_100004215 3300005616 Bacteria 10144
104 Ga0068852_100005938 3300005616 Bacteria 8782
105 Ga0068852_100013071 3300005616 Bacteria 6339
106 Ga0068852_100149758 3300005616 Bacteria 2169
107 Ga0068859_100006408 3300005617 Bacteria 11942
108 Ga0068859_100043144 3300005617 Bacteria 4532
109 Ga0068864_100016558 3300005618 Bacteria 6136
110 Ga0068864_100046876 3300005618 Bacteria 3710
111 Ga0068864_100075490 3300005618 Bacteria 2943
112 Ga0068866_10169832 3300005718 Bacteria 1279
113 Ga0068861_100004042 3300005719 Bacteria 9825
114 Ga0068861_100439250 3300005719 Bacteria 1167
115 Ga0068851_10022559 3300005834 Bacteria 3069
116 Ga0068870_10275094 3300005840 Bacteria 1053
117 Ga0068863_100046592 3300005841 Bacteria 4115
118 Ga0068858_100014032 3300005842 Bacteria 7558
119 Ga0068858_100808222 3300005842 Bacteria 915
120 Ga0068860_100145192 3300005843 Bacteria 2283
121 Ga0068862_100105624 3300005844 Bacteria 2468
122 Ga0081455_10138640 3300005937 Bacteria 1892
123 Ga0081538_10034483 3300005981 Bacteria 3345
124 Ga0081538_10108273 3300005981 Bacteria 1373
125 Ga0070717_10025205 3300006028 Bacteria 4727
126 Ga0070717_10093985 3300006028 Bacteria 2536
127 Ga0070716_100205853 3300006173 Unclassified 1311
128 Ga0070712_100595709 3300006175 Unclassified 935
129 Ga0097621_100011018 3300006237 Bacteria 6644
130 Ga0097621_100601409 3300006237 Bacteria 1005
131 Ga0068871_100004337 3300006358 Bacteria 9853
132 Ga0068871_100011281 3300006358 Bacteria 6552
133 Ga0068871_100792886 3300006358 Bacteria 873
134 Ga0075428_100007949 3300006844 Bacteria 11763
135 Ga0075428_100021678 3300006844 Bacteria 7114
136 Ga0075428_100130958 3300006844 Bacteria 2728
137 Ga0075428_100163785 3300006844 Bacteria 2412
138 Ga0075428_100164560 3300006844 Bacteria 2406
139 Ga0075428_100260701 3300006844 Bacteria 1866
140 Ga0075428_100358604 3300006844 Bacteria 1564
141 Ga0075428_100669700 3300006844 Bacteria 1106
142 Ga0075431_100120306 3300006847 Bacteria 2709
143 Ga0075433_10090895 3300006852 Bacteria 2698
144 Ga0075433_10350422 3300006852 Bacteria 1305
145 Ga0075433_10376489 3300006852 Bacteria 1253
146 Ga0075434_100025686 3300006871 Bacteria 5764
147 Ga0075434_100043972 3300006871 Bacteria 4431
148 Ga0075434_100054253 3300006871 Bacteria 3982
149 Ga0075429_100230141 3300006880 Bacteria 1624
150 Ga0068865_100153736 3300006881 Bacteria 1748
151 Ga0075436_100026252 3300006914 Bacteria 4010
152 Ga0075436_100083640 3300006914 Bacteria 2215
153 Ga0097620_100006409 3300006931 Bacteria 11942
154 Ga0097620_100043144 3300006931 Bacteria 4532
155 Ga0099822_1008434 3300006943 Bacteria 13184
156 Ga0075435_100301883 3300007076 Bacteria 1369
157 Ga0099795_10018884 3300007788 Bacteria 2223
158 Ga0099795_10042135 3300007788 Bacteria 1628
159 Ga0105240_10049120 3300009093 Bacteria 5328
160 Ga0105240_10441978 3300009093 Bacteria 1457
161 Ga0111539_10188210 3300009094 Bacteria 2409
162 Ga0111539_10431724 3300009094 Bacteria 1534
163 Ga0111539_10835947 3300009094 Bacteria 1071
164 Ga0105245_10215168 3300009098 Bacteria 1851
165 Ga0105247_10157748 3300009101 Bacteria 1500
166 Ga0114129_10058441 3300009147 Bacteria 5393
167 Ga0114129_10100233 3300009147 Bacteria 4008
168 Ga0114129_10115623 3300009147 Unclassified 3697
169 Ga0114129_10139113 3300009147 Bacteria 3330
170 Ga0114129_10183110 3300009147 Bacteria 2849
171 Ga0114129_10198847 3300009147 Bacteria 2716
172 Ga0114129_10349437 3300009147 Bacteria 1959
173 Ga0114129_10587921 3300009147 Bacteria 1444
174 Ga0114129_10600042 3300009147 Bacteria 1427
175 Ga0114129_10631905 3300009147 Bacteria 1384
176 Ga0105243_10087937 3300009148 Bacteria 2552
177 Ga0105241_10026527 3300009174 Bacteria 4312
178 Ga0105242_10176936 3300009176 Bacteria 1879
179 Ga0105242_10240277 3300009176 Bacteria 1628
180 Ga0105248_10060662 3300009177 Bacteria 4246
181 Ga0105248_10092438 3300009177 Bacteria 3407
182 Ga0105248_10222078 3300009177 Bacteria 2127
183 Ga0105248_10774672 3300009177 Bacteria 1083
184 Ga0105237_10175097 3300009545 Bacteria 2146
185 Ga0105237_10275230 3300009545 Bacteria 1686
186 Ga0105237_10353413 3300009545 Bacteria 1474
187 Ga0105237_10601994 3300009545 Bacteria 1106
188 Ga0105238_10377716 3300009551 Bacteria 1408
189 Ga0099796_10043946 3300010159 Bacteria 1524
190 Ga0105239_10040515 3300010375 Bacteria 5104
191 Ga0105239_10271133 3300010375 Bacteria 1909
192 Ga0105246_10154861 3300011119 Bacteria 1739
193 Ga0105246_10159972 3300011119 Bacteria 1714
194 Ga0157373_10000950 3300013100 Bacteria 22473
195 Ga0157370_10000604 3300013104 Bacteria 44766
196 Ga0157370_10116933 3300013104 Bacteria 2491
197 Ga0157369_10004890 3300013105 Bacteria 15715
198 Ga0157369_10067450 3300013105 Bacteria 3846
199 Ga0157369_10303051 3300013105 Bacteria 1662
200 Ga0157374_10011116 3300013296 Bacteria 7782
201 Ga0157378_10013003 3300013297 Bacteria 7282
202 Ga0157378_10261225 3300013297 Bacteria 1661
203 Ga0163162_10180313 3300013306 Bacteria 2238
204 Ga0163162_10360826 3300013306 Bacteria 1586
205 Ga0163162_10498855 3300013306 Bacteria 1348
206 Ga0157372_10004943 3300013307 Bacteria 14157
207 Ga0157372_10009907 3300013307 Bacteria 10135
208 Ga0157372_10015703 3300013307 Bacteria 8120
209 Ga0157372_10143530 3300013307 Bacteria 2753
210 Ga0157375_10003626 3300013308 Bacteria 13391
211 Ga0157375_10070368 3300013308 Bacteria 3509
212 Ga0157375_10070756 3300013308 Bacteria 3500
213 Ga0157375_10205510 3300013308 Bacteria 2126
214 Ga0163163_10716282 3300014325 Bacteria 1064
215 Ga0157380_10827388 3300014326 Unclassified 945
216 Ga0157377_10362884 3300014745 Bacteria 976
217 Ga0157379_10004475 3300014968 Bacteria 11987
218 Ga0157379_10005914 3300014968 Bacteria 10532
219 Ga0157379_10155371 3300014968 Bacteria 2064
220 Ga0157376_10008826 3300014969 Bacteria 7294
221 Ga0157376_10009478 3300014969 Bacteria 7072
222 Ga0163161_10097605 3300017792 Bacteria 2182
223 Ga0209677_100628 3300025253 Bacteria 18938
224 Ga0209677_100687 3300025253 Bacteria 17321
225 Ga0209233_1006054 3300025261 Bacteria 3938
226 Ga0207697_10118397 3300025315 Bacteria 1138
227 Ga0207697_10152863 3300025315 Bacteria 1005
228 Ga0207713_1000029 3300025735 Bacteria 285054
229 Ga0207642_10102803 3300025899 Bacteria 1438
230 Ga0207688_10045797 3300025901 Bacteria 2441
231 Ga0207645_10015079 3300025907 Bacteria 5148
232 Ga0207645_10017051 3300025907 Bacteria 4798
233 Ga0207645_10071019 3300025907 Bacteria 2228
234 Ga0207645_10126780 3300025907 Bacteria 1659
235 Ga0207643_10118914 3300025908 Bacteria 1563
236 Ga0207654_10041622 3300025911 Bacteria 2595
237 Ga0207707_10011309 3300025912 Bacteria 7769
238 Ga0207707_10091460 3300025912 Bacteria 2659
239 Ga0207695_10058931 3300025913 Bacteria 3984
240 Ga0207693_10456059 3300025915 Unclassified 999
241 Ga0207663_10288849 3300025916 Bacteria 1221
242 Ga0207660_10240741 3300025917 Bacteria 1425
243 Ga0207657_10001329 3300025919 Bacteria 26244
244 Ga0207657_10431549 3300025919 Bacteria 1035
245 Ga0207649_10007976 3300025920 Bacteria 5760
246 Ga0207649_10148877 3300025920 Bacteria 1610
247 Ga0207649_10361605 3300025920 Bacteria 1077
248 Ga0207652_10010942 3300025921 Bacteria 7315
249 Ga0207652_10065470 3300025921 Bacteria 3147
250 Ga0207646_10364474 3300025922 Bacteria 1305
251 Ga0207650_10003270 3300025925 Bacteria 11169
252 Ga0207650_10426772 3300025925 Bacteria 1101
253 Ga0207659_10020581 3300025926 Bacteria 4363
254 Ga0207659_10056134 3300025926 Bacteria 2819
255 Ga0207659_10083768 3300025926 Bacteria 2365
256 Ga0207687_10285312 3300025927 Bacteria 1325
257 Ga0207700_10000061 3300025928 Bacteria 67891
258 Ga0207700_10623352 3300025928 Bacteria 961
259 Ga0207664_10009719 3300025929 Bacteria 6762
260 Ga0207644_10001429 3300025931 Bacteria 15389
261 Ga0207644_10025045 3300025931 Bacteria 4100
262 Ga0207644_10256381 3300025931 Bacteria 1397
263 Ga0207690_10001155 3300025932 Bacteria 16710
264 Ga0207690_10046622 3300025932 Bacteria 2872
265 Ga0207690_10150513 3300025932 Bacteria 1725
266 Ga0207706_10000024 3300025933 Bacteria 151942
267 Ga0207706_10000756 3300025933 Bacteria 33603
268 Ga0207706_10124217 3300025933 Bacteria 2270
269 Ga0207686_10233171 3300025934 Bacteria 1336
270 Ga0207669_10099389 3300025937 Unclassified 1919
271 Ga0207669_10202803 3300025937 Bacteria 1441
272 Ga0207704_10085136 3300025938 Bacteria 2057
273 Ga0207704_10235043 3300025938 Bacteria 1366
274 Ga0207665_10336856 3300025939 Bacteria 1136
275 Ga0207665_10428826 3300025939 Bacteria 1011
276 Ga0207691_10000521 3300025940 Bacteria 38291
277 Ga0207691_10058310 3300025940 Bacteria 3512
278 Ga0207711_10005135 3300025941 Bacteria 11098
279 Ga0207711_10175953 3300025941 Bacteria 1944
280 Ga0207711_10556753 3300025941 Bacteria 1069
281 Ga0207689_10000908 3300025942 Bacteria 28411
282 Ga0207689_10003040 3300025942 Bacteria 15459
283 Ga0207689_10113869 3300025942 Bacteria 2223
284 Ga0207661_10137961 3300025944 Bacteria 2096
285 Ga0207679_10006389 3300025945 Bacteria 7444
286 Ga0207679_10015666 3300025945 Bacteria 5016
287 Ga0207679_10031150 3300025945 Bacteria 3731
288 Ga0207679_10121263 3300025945 Bacteria 2082
289 Ga0207667_10028598 3300025949 Bacteria 6053
290 Ga0207667_10031276 3300025949 Bacteria 5747
291 Ga0207667_10075198 3300025949 Bacteria 3508
292 Ga0207651_10009006 3300025960 Bacteria 5427
293 Ga0207651_10368334 3300025960 Bacteria 1215
294 Ga0207651_10439760 3300025960 Unclassified 1117
295 Ga0207640_10048559 3300025981 Bacteria 2744
296 Ga0207640_10053043 3300025981 Bacteria 2645
297 Ga0207640_10289842 3300025981 Bacteria 1290
298 Ga0207658_10102179 3300025986 Bacteria 2248
299 Ga0207677_10001981 3300026023 Bacteria 10839
300 Ga0207677_10010922 3300026023 Bacteria 5158
301 Ga0207677_10165990 3300026023 Bacteria 1721
302 Ga0207703_10004251 3300026035 Bacteria 11789
303 Ga0207703_10048453 3300026035 Bacteria 3430
304 Ga0207703_10149050 3300026035 Bacteria 2038
305 Ga0207639_10003688 3300026041 Bacteria 10295
306 Ga0207639_10010988 3300026041 Bacteria 6276
307 Ga0207708_10847670 3300026075 Bacteria 789
308 Ga0207702_10014796 3300026078 Bacteria 6471
309 Ga0207702_10038570 3300026078 Bacteria 4001
310 Ga0207702_10095857 3300026078 Bacteria 2608
311 Ga0207702_10241212 3300026078 Bacteria 1693
312 Ga0207702_10258682 3300026078 Bacteria 1638
313 Ga0207648_10036841 3300026089 Bacteria 4309
314 Ga0207648_10052748 3300026089 Bacteria 3556
315 Ga0207648_10129538 3300026089 Bacteria 2221
316 Ga0207676_10024524 3300026095 Bacteria 4464
317 Ga0207676_10117546 3300026095 Bacteria 2236
318 Ga0207674_10012289 3300026116 Bacteria 9573
319 Ga0207674_10016732 3300026116 Bacteria 8014
320 Ga0207674_10056460 3300026116 Bacteria 3987
321 Ga0207674_10206652 3300026116 Bacteria 1913
322 Ga0207675_100007424 3300026118 Bacteria 10358
323 Ga0207683_10000576 3300026121 Bacteria 33957
324 Ga0207683_10001464 3300026121 Bacteria 21278
325 Ga0207683_10103391 3300026121 Bacteria 2545
326 Ga0207698_10005793 3300026142 Bacteria 7669
327 Ga0207698_10008161 3300026142 Bacteria 6602
328 Ga0209371_1000230 3300027312 Bacteria 71436
329 Ga0209371_1003328 3300027312 Bacteria 7903
330 Ga0209589_1002492 3300027357 Bacteria 31962
331 Ga0209984_1013753 3300027424 Bacteria 1064
332 Ga0209588_1028826 3300027671 Bacteria 1768
333 Ga0209974_10055836 3300027876 Bacteria 1332
334 Ga0268265_10395871 3300028380 Bacteria 1275
335 Ga0268264_10341164 3300028381 Bacteria 1423
336 Ga0268256_1001580 3300030500 Bacteria 13328
337 Ga0268256_1007288 3300030500 Bacteria 3966
338 Ga0307408_100008227 3300031548 Bacteria 6882
339 Ga0307516_10017967 3300031730 Bacteria 7359
340 Ga0307405_10029307 3300031731 Bacteria 3216
341 Ga0307413_10005497 3300031824 Bacteria 5662
342 Ga0307406_10019514 3300031901 Bacteria 3979
343 Ga0307407_10003318 3300031903 Bacteria 6573
344 Ga0307412_10015298 3300031911 Bacteria 4545
345 Ga0307416_100908010 3300032002 Bacteria 981
346 Ga0307411_10028995 3300032005 Bacteria 3373
347 Ga0307415_100344485 3300032126 Bacteria 1252
348 Ga0373930_0033463 3300034816 Bacteria 1067
349 Ga0373949_0041155 3300035090 Bacteria 1136
350 Ga0373953_0265643 3300035117 Bacteria 747
351 Ga0373954_0097406 3300035118 Bacteria 1417
352 Ga0373954_0256910 3300035118 Bacteria 860
353 Ga0373924_0219594 3300035410 Bacteria 840
354 Ga0373931_0004786 3300035691 Bacteria 6211
355 Ga0373931_0015335 3300035691 Bacteria 3757
356 Ga0373931_0039264 3300035691 Bacteria 2480
357 Ga0373927_0557197 3300035695 Bacteria 757
358 Ga0373933_0255738 3300035724 Bacteria 1128
359 Ga0373947_0039410 3300035725 Bacteria 2811
360 Ga0373937_0022811 3300036401 Bacteria 5631
361 Ga0373937_0035519 3300036401 Bacteria 4537
362 Ga0373937_0042790 3300036401 Bacteria 4133
363 Ga0373937_0054451 3300036401 Bacteria 3671
364 Ga0373937_0164717 3300036401 Bacteria 2079
365 Ga0373937_0172939 3300036401 Bacteria 2027
366 Ga0373937_0328334 3300036401 Bacteria 1448
367 Ga0373937_0370451 3300036401 Bacteria 1358
368 Ga0373937_0482845 3300036401 Bacteria 1177
369 Ga0373937_0597439 3300036401 Bacteria 1048
370 Ga0373925_0151921 3300037068 Bacteria 1819
371 Ga0373925_0216714 3300037068 Bacteria 1527
372 Ga0451807_0443253 3300041486 Bacteria 1377
373 Ga0451807_1340960 3300041486 Bacteria 1001
374 Ga0450914_014210 3300042118 Bacteria 819
375 Ga0451577_0234560 3300042876 Bacteria 1659
376 Ga0466972_0003301 3300044658 Bacteria 7994
377 Ga0466960_0004014 3300044901 Bacteria 5721
378 Ga0451576_0030225 3300045051 Bacteria 5793
379 Ga0451576_0118327 3300045051 Bacteria 2758
380 Ga0451576_0389897 3300045051 Bacteria 1460
381 Ga0495651_0069156 3300046462 Bacteria 2690
382 Ga0495580_0034558 3300046472 Bacteria 3639
383 Ga0495639_0138209 3300046475 Bacteria 1170
384 Ga0495606_0009187 3300046507 Bacteria 8404
385 Ga0495618_0033692 3300046514 Bacteria 3212
386 Ga0495620_0036181 3300046515 Bacteria 2211
387 Ga0495630_0086804 3300046517 Bacteria 2363
388 Ga0495648_0007667 3300046524 Bacteria 8606
389 Ga0495666_0007993 3300046526 Bacteria 5296
390 Ga0495652_0054973 3300046529 Bacteria 3387
391 Ga0495665_0075041 3300046531 Unclassified 1780
392 Ga0495640_0038993 3300046533 Bacteria 3337
393 Ga0495597_0054698 3300046542 Bacteria 1752
394 Ga0495645_0053341 3300046543 Bacteria 2940
395 Ga0495645_0112124 3300046543 Bacteria 1929
396 Ga0495667_0147622 3300046559 Bacteria 1514
397 Ga0495634_0064596 3300046642 Bacteria 2426
398 Ga0495657_0112308 3300046675 Bacteria 1725
399 Ga0495623_0359527 3300046679 Bacteria 791
400 Ga0495624_0143403 3300046690 Unclassified 1462
401 Ga0495649_0007281 3300046694 Bacteria 6771
402 Ga0495649_0007892 3300046694 Bacteria 6441
403 Ga0495600_0015482 3300046809 Bacteria 4821
404 Ga0495600_0102228 3300046809 Bacteria 1868
405 Ga0495600_0280521 3300046809 Unclassified 1055
406 Ga0495581_0246854 3300047315 Bacteria 1044
407 Ga0495604_0005560 3300047317 Bacteria 9991
408 Ga0495604_0021917 3300047317 Bacteria 5099
409 Ga0495674_0076082 3300047319 Bacteria 2888
410 Ga0495683_0005158 3300047323 Bacteria 7276
411 Ga0495687_000005 3300047443 Bacteria 610401
412 Ga0495602_0065044 3300048088 Bacteria 3149
413 Ga0495602_0179298 3300048088 Bacteria 1636
414 Ga0495602_0275389 3300048088 Bacteria 1242
415 Ga0495626_0035083 3300048091 Bacteria 2396
416 Ga0495626_0126299 3300048091 Bacteria 1095
417 Ga0496101_0124414 3300048904 Bacteria 1953
418 Ga0496102_0001232 3300048905 Bacteria 23171
419 Ga0496102_0563245 3300048905 Bacteria 1062
420 Ga0496103_0022263 3300048906 Bacteria 3815
421 Ga0496106_0000378 3300048909 Bacteria 31643
422 Ga0496106_0011359 3300048909 Bacteria 6590
423 Ga0496106_0291536 3300048909 Bacteria 1308
424 Ga0496107_0009338 3300048910 Bacteria 6798
425 Ga0496107_0013580 3300048910 Bacteria 5694
426 Ga0496107_0215765 3300048910 Bacteria 1427
427 Ga0496108_0008804 3300048911 Bacteria 8181
428 Ga0496108_0076301 3300048911 Bacteria 2833
429 Ga0496108_0736385 3300048911 Bacteria 853
430 Ga0496109_0062842 3300048912 Bacteria 3396
431 Ga0496109_0398935 3300048912 Unclassified 1299
432 Ga0496110_0187441 3300048913 Bacteria 1878
433 Ga0496111_0055284 3300048914 Bacteria 2871
434 Ga0496111_0129841 3300048914 Bacteria 1864
435 Ga0496112_0054135 3300048915 Bacteria 3942
436 Ga0496112_0356921 3300048915 Bacteria 1404
437 Ga0496112_0383538 3300048915 Bacteria 1346
438 Ga0496113_0714779 3300048916 Bacteria 799
439 Ga0496114_0034469 3300048917 Bacteria 4177
440 Ga0496115_0078885 3300048918 Bacteria 2679
441 Ga0496115_0623383 3300048918 Bacteria 855
442 Ga0496116_0066220 3300048919 Bacteria 2313
443 Ga0496118_0022979 3300048921 Bacteria 5430
444 Ga0496121_0011032 3300048924 Bacteria 10084
445 Ga0496126_0002351 3300048929 Bacteria 25857
446 Ga0501070_0297426 3300049586 Bacteria 1315
447 Ga0501072_0340685 3300049588 Bacteria 1191
448 Ga0501074_0288346 3300049590 Bacteria 1167
449 nmdc:mga05p37_124193_c1 3300050507 Bacteria 3171
450 nmdc:mga05p37_146993_c1 3300050507 Bacteria 2885
451 nmdc:mga05p37_175170_c1 3300050507 Bacteria 2614
452 nmdc:mga05p37_197185_c1 3300050507 Bacteria 2441
453 nmdc:mga05p37_210000_c1 3300050507 Bacteria 2354
454 nmdc:mga05p37_428351_c1 3300050507 Bacteria 1538
455 nmdc:mga05p37_502635_c1 3300050507 Bacteria 1391
456 nmdc:mga05p37_503935_c1 3300050507 Bacteria 1389
457 nmdc:mga09592_279244_c1 3300050508 Bacteria 1449
458 nmdc:mga09592_385331_c1 3300050508 Bacteria 1212
459 nmdc:mga09592_473424_c1 3300050508 Bacteria 1080
460 nmdc:mga09592_6474_c1 3300050508 Bacteria 9538
461 nmdc:mga0qj67_459337_c1 3300050509 Bacteria 1025
462 nmdc:mga06r32_65324_c1 3300050510 Bacteria 3509
463 nmdc:mga06r32_689581_c1 3300050510 Bacteria 988
464 nmdc:mga08y16_188788_c1 3300050511 Bacteria 2138
465 nmdc:mga08y16_89292_c1 3300050511 Bacteria 3212
466 nmdc:mga0n895_121628_c1 3300050512 Bacteria 2632
467 nmdc:mga0n895_208266_c1 3300050512 Bacteria 1986
468 nmdc:mga0n895_265088_c1 3300050512 Bacteria 1743
469 nmdc:mga0n895_76472_c1 3300050512 Bacteria 3329
470 nmdc:mga0rr50_223458_c1 3300050513 Bacteria 1556
471 nmdc:mga0rr50_664560_c1 3300050513 Bacteria 889
472 nmdc:mga08x19_304441_c1 3300050514 Bacteria 1107
473 nmdc:mga08x19_392631_c1 3300050514 Bacteria 972
474 nmdc:mga08x19_488333_c1 3300050514 Bacteria 869
475 nmdc:mga08x19_55618_c1 3300050514 Bacteria 2551
476 nmdc:mga0a205_118873_c1 3300050515 Bacteria 2542
477 nmdc:mga0a205_302169_c1 3300050515 Bacteria 1473
478 nmdc:mga0a205_327853_c1 3300050515 Bacteria 1401
479 nmdc:mga0a205_41032_c1 3300050515 Bacteria 4456
480 Ga0495601_0010210 3300053077 Bacteria 5582
481 Ga0495612_0058098 3300053078 Bacteria 1598
482 Ga0495595_0011808 3300053084 Bacteria 3660
483 Ga0495619_0020199 3300053085 Bacteria 4239
484 Ga0495619_0319650 3300053085 Bacteria 1074
485 Ga0495619_0544543 3300053085 Bacteria 796
486 Ga0530510_0603540 3300061734 Unclassified 835
487 2513692490 2513237101 Bacteria 7952346
488 2723848399 2721755755 Bacteria 8322773
489 2874608633 2874604998 Bacteria 7834745
490 2921649290 2921643360 Bacteria 11448031
491 2922361643 2922361189 Bacteria 7436256
492 2922364892 2922361189 Bacteria 7436256
493 2974315610 2974310843 Bacteria 4947816
494 8006965827 8006964411 Bacteria 8966052
495 8055271832 8055266321 Bacteria 7999742
496 Ga0373933_0008885
497 JGI24743J22301_10036464
498 Ga0065712_10003060
499 Ga0065715_10135489
500 Ga0065715_10196543
501 Ga0065707_10244581
502 Ga0070676_10008839
503 Ga0070676_10031495
504 Ga0070676_10240921
505 Ga0070683_100026492
506 Ga0070670_100015685
507 Ga0070670_100209276
508 Ga0068869_100000907
509 Ga0068869_100003169
510 Ga0068869_100082700
511 Ga0070666_10044568
512 Ga0070680_100004956
513 Ga0070682_100267001
514 Ga0068868_100005476
515 Ga0068868_100211957
516 Ga0068868_100294207
517 Ga0068868_100571861
518 Ga0070660_100003636
519 Ga0070660_100170088
520 Ga0070660_100398139
521 Ga0070660_100475349
522 Ga0070661_100004753
523 Ga0070661_100022068
524 Ga0070668_100035021
525 Ga0070669_100010742
526 Ga0070669_100423264
527 Ga0070675_100000285
528 Ga0070675_100005179
529 Ga0070675_100086587
530 Ga0070671_100001487
531 Ga0070671_100011413
532 Ga0070671_100231472
533 Ga0070674_100018737
534 Ga0070674_100219491
535 Ga0070674_100288688
536 Ga0070673_100015880
537 Ga0070673_100017020
538 Ga0070673_100138466
539 Ga0070673_100376208
540 Ga0070673_100536651
541 Ga0070659_100001189
542 Ga0070659_100006855
543 Ga0070659_100068263
544 Ga0070659_100140078
545 Ga0070659_100193530
546 Ga0070667_100018972
547 Ga0070709_10258574
548 Ga0070709_10318488
549 Ga0070711_100329885
550 Ga0070705_100239209
551 Ga0070708_100635951
552 Ga0070663_100010189
553 Ga0070663_100127515
554 Ga0070678_100000922
555 Ga0070678_100007149
556 Ga0070678_100112190
557 Ga0070678_100293949
558 Ga0070662_100002396
559 Ga0070662_100003417
560 Ga0070681_10006766
561 Ga0070681_10010352
562 Ga0070681_10079628
563 Ga0070681_10258477
564 Ga0068867_100020706
565 Ga0068867_100154512
566 Ga0068867_100406872
567 Ga0070706_100490861
568 Ga0070698_100356310
569 Ga0070699_100120021
570 Ga0070699_100266956
571 Ga0070699_100562089
572 Ga0070679_100000932
573 Ga0070679_100010271
574 Ga0070697_100059702
575 Ga0068853_100006201
576 Ga0070672_100003476
577 Ga0070672_100003994
578 Ga0070672_100009957
579 Ga0070686_100265754
580 Ga0070696_100144527
581 Ga0070693_100028671
582 Ga0070665_100003009
583 Ga0070665_100713280
584 Ga0070704_100188442
585 Ga0068855_100000418
586 Ga0068855_100094029
587 Ga0070664_100006481
588 Ga0070664_100056451
589 Ga0070664_100407711
590 Ga0068857_100012769
591 Ga0068857_100189105
592 Ga0068857_100290724
593 Ga0068854_100009745
594 Ga0068854_100057767
595 Ga0068856_100005040
596 Ga0068856_100008676
597 Ga0068856_100130093
598 Ga0068852_100004215
599 Ga0068852_100005938
600 Ga0068852_100013071
601 Ga0068852_100149758
602 Ga0068859_100006408
603 Ga0068859_100043144
604 Ga0068864_100016558
605 Ga0068864_100046876
606 Ga0068864_100075490
607 Ga0068866_10169832
608 Ga0068861_100004042
609 Ga0068861_100439250
610 Ga0068851_10022559
611 Ga0068870_10275094
612 Ga0068863_100046592
613 Ga0068858_100014032
614 Ga0068858_100808222
615 Ga0068860_100145192
616 Ga0068862_100105624
617 Ga0081455_10138640
618 Ga0081538_10034483
619 Ga0081538_10108273
620 Ga0070717_10025205
621 Ga0070717_10093985
622 Ga0070716_100205853
623 Ga0070712_100595709
624 Ga0097621_100011018
625 Ga0097621_100601409
626 Ga0068871_100004337
627 Ga0068871_100011281
628 Ga0068871_100792886
629 Ga0075428_100007949
630 Ga0075428_100021678
631 Ga0075428_100130958
632 Ga0075428_100163785
633 Ga0075428_100164560
634 Ga0075428_100260701
635 Ga0075428_100358604
636 Ga0075428_100669700
637 Ga0075431_100120306
638 Ga0075433_10090895
639 Ga0075433_10350422
640 Ga0075433_10376489
641 Ga0075434_100025686
642 Ga0075434_100043972
643 Ga0075434_100054253
644 Ga0075429_100230141
645 Ga0068865_100153736
646 Ga0075436_100026252
647 Ga0075436_100083640
648 Ga0097620_100006409
649 Ga0097620_100043144
650 Ga0099822_1008434
651 Ga0075435_100301883
652 Ga0099795_10018884
653 Ga0099795_10042135
654 Ga0105240_10049120
655 Ga0105240_10441978
656 Ga0111539_10188210
657 Ga0111539_10431724
658 Ga0111539_10835947
659 Ga0105245_10215168
660 Ga0105247_10157748
661 Ga0114129_10058441
662 Ga0114129_10100233
663 Ga0114129_10115623
664 Ga0114129_10139113
665 Ga0114129_10183110
666 Ga0114129_10198847
667 Ga0114129_10349437
668 Ga0114129_10587921
669 Ga0114129_10600042
670 Ga0114129_10631905
671 Ga0105243_10087937
672 Ga0105241_10026527
673 Ga0105242_10176936
674 Ga0105242_10240277
675 Ga0105248_10060662
676 Ga0105248_10092438
677 Ga0105248_10222078
678 Ga0105248_10774672
679 Ga0105237_10175097
680 Ga0105237_10275230
681 Ga0105237_10353413
682 Ga0105237_10601994
683 Ga0105238_10377716
684 Ga0099796_10043946
685 Ga0105239_10040515
686 Ga0105239_10271133
687 Ga0105246_10154861
688 Ga0105246_10159972
689 Ga0157373_10000950
690 Ga0157370_10000604
691 Ga0157370_10116933
692 Ga0157369_10004890
693 Ga0157369_10067450
694 Ga0157369_10303051
695 Ga0157374_10011116
696 Ga0157378_10013003
697 Ga0157378_10261225
698 Ga0163162_10180313
699 Ga0163162_10360826
700 Ga0163162_10498855
701 Ga0157372_10004943
702 Ga0157372_10009907
703 Ga0157372_10015703
704 Ga0157372_10143530
705 Ga0157375_10003626
706 Ga0157375_10070368
707 Ga0157375_10070756
708 Ga0157375_10205510
709 Ga0163163_10716282
710 Ga0157380_10827388
711 Ga0157377_10362884
712 Ga0157379_10004475
713 Ga0157379_10005914
714 Ga0157379_10155371
715 Ga0157376_10008826
716 Ga0157376_10009478
717 Ga0163161_10097605
718 Ga0209677_100628
719 Ga0209677_100687
720 Ga0209233_1006054
721 Ga0207697_10118397
722 Ga0207697_10152863
723 Ga0207713_1000029
724 Ga0207642_10102803
725 Ga0207688_10045797
726 Ga0207645_10015079
727 Ga0207645_10017051
728 Ga0207645_10071019
729 Ga0207645_10126780
730 Ga0207643_10118914
731 Ga0207654_10041622
732 Ga0207707_10011309
733 Ga0207707_10091460
734 Ga0207695_10058931
735 Ga0207693_10456059
736 Ga0207663_10288849
737 Ga0207660_10240741
738 Ga0207657_10001329
739 Ga0207657_10431549
740 Ga0207649_10007976
741 Ga0207649_10148877
742 Ga0207649_10361605
743 Ga0207652_10010942
744 Ga0207652_10065470
745 Ga0207646_10364474
746 Ga0207650_10003270
747 Ga0207650_10426772
748 Ga0207659_10020581
749 Ga0207659_10056134
750 Ga0207659_10083768
751 Ga0207687_10285312
752 Ga0207700_10000061
753 Ga0207700_10623352
754 Ga0207664_10009719
755 Ga0207644_10001429
756 Ga0207644_10025045
757 Ga0207644_10256381
758 Ga0207690_10001155
759 Ga0207690_10046622
760 Ga0207690_10150513
761 Ga0207706_10000024
762 Ga0207706_10000756
763 Ga0207706_10124217
764 Ga0207686_10233171
765 Ga0207669_10099389
766 Ga0207669_10202803
767 Ga0207704_10085136
768 Ga0207704_10235043
769 Ga0207665_10336856
770 Ga0207665_10428826
771 Ga0207691_10000521
772 Ga0207691_10058310
773 Ga0207711_10005135
774 Ga0207711_10175953
775 Ga0207711_10556753
776 Ga0207689_10000908
777 Ga0207689_10003040
778 Ga0207689_10113869
779 Ga0207661_10137961
780 Ga0207679_10006389
781 Ga0207679_10015666
782 Ga0207679_10031150
783 Ga0207679_10121263
784 Ga0207667_10028598
785 Ga0207667_10031276
786 Ga0207667_10075198
787 Ga0207651_10009006
788 Ga0207651_10368334
789 Ga0207651_10439760
790 Ga0207640_10048559
791 Ga0207640_10053043
792 Ga0207640_10289842
793 Ga0207658_10102179
794 Ga0207677_10001981
795 Ga0207677_10010922
796 Ga0207677_10165990
797 Ga0207703_10004251
798 Ga0207703_10048453
799 Ga0207703_10149050
800 Ga0207639_10003688
801 Ga0207639_10010988
802 Ga0207708_10847670
803 Ga0207702_10014796
804 Ga0207702_10038570
805 Ga0207702_10095857
806 Ga0207702_10241212
807 Ga0207702_10258682
808 Ga0207648_10036841
809 Ga0207648_10052748
810 Ga0207648_10129538
811 Ga0207676_10024524
812 Ga0207676_10117546
813 Ga0207674_10012289
814 Ga0207674_10016732
815 Ga0207674_10056460
816 Ga0207674_10206652
817 Ga0207675_100007424
818 Ga0207683_10000576
819 Ga0207683_10001464
820 Ga0207683_10103391
821 Ga0207698_10005793
822 Ga0207698_10008161
823 Ga0209371_1000230
824 Ga0209371_1003328
825 Ga0209589_1002492
826 Ga0209984_1013753
827 Ga0209588_1028826
828 Ga0209974_10055836
829 Ga0268265_10395871
830 Ga0268264_10341164
831 Ga0268256_1001580
832 Ga0268256_1007288
833 Ga0307408_100008227
834 Ga0307516_10017967
835 Ga0307405_10029307
836 Ga0307413_10005497
837 Ga0307406_10019514
838 Ga0307407_10003318
839 Ga0307412_10015298
840 Ga0307416_100908010
841 Ga0307411_10028995
842 Ga0307415_100344485
843 Ga0373930_0033463
844 Ga0373949_0041155
845 Ga0373953_0265643
846 Ga0373954_0097406
847 Ga0373954_0256910
848 Ga0373924_0219594
849 Ga0373931_0004786
850 Ga0373931_0015335
851 Ga0373931_0039264
852 Ga0373927_0557197
853 Ga0373933_0255738
854 Ga0373947_0039410
855 Ga0373937_0022811
856 Ga0373937_0035519
857 Ga0373937_0042790
858 Ga0373937_0054451
859 Ga0373937_0164717
860 Ga0373937_0172939
861 Ga0373937_0328334
862 Ga0373937_0370451
863 Ga0373937_0482845
864 Ga0373937_0597439
865 Ga0373925_0151921
866 Ga0373925_0216714
867 Ga0451807_0443253
868 Ga0451807_1340960
869 Ga0450914_014210
870 Ga0451577_0234560
871 Ga0466972_0003301
872 Ga0466960_0004014
873 Ga0451576_0030225
874 Ga0451576_0118327
875 Ga0451576_0389897
876 Ga0495651_0069156
877 Ga0495580_0034558
878 Ga0495639_0138209
879 Ga0495606_0009187
880 Ga0495618_0033692
881 Ga0495620_0036181
882 Ga0495630_0086804
883 Ga0495648_0007667
884 Ga0495666_0007993
885 Ga0495652_0054973
886 Ga0495665_0075041
887 Ga0495640_0038993
888 Ga0495597_0054698
889 Ga0495645_0053341
890 Ga0495645_0112124
891 Ga0495667_0147622
892 Ga0495634_0064596
893 Ga0495657_0112308
894 Ga0495623_0359527
895 Ga0495624_0143403
896 Ga0495649_0007281
897 Ga0495649_0007892
898 Ga0495600_0015482
899 Ga0495600_0102228
900 Ga0495600_0280521
901 Ga0495581_0246854
902 Ga0495604_0005560
903 Ga0495604_0021917
904 Ga0495674_0076082
905 Ga0495683_0005158
906 Ga0495687_000005
907 Ga0495602_0065044
908 Ga0495602_0179298
909 Ga0495602_0275389
910 Ga0495626_0035083
911 Ga0495626_0126299
912 Ga0496101_0124414
913 Ga0496102_0001232
914 Ga0496102_0563245
915 Ga0496103_0022263
916 Ga0496106_0000378
917 Ga0496106_0011359
918 Ga0496106_0291536
919 Ga0496107_0009338
920 Ga0496107_0013580
921 Ga0496107_0215765
922 Ga0496108_0008804
923 Ga0496108_0076301
924 Ga0496108_0736385
925 Ga0496109_0062842
926 Ga0496109_0398935
927 Ga0496110_0187441
928 Ga0496111_0055284
929 Ga0496111_0129841
930 Ga0496112_0054135
931 Ga0496112_0356921
932 Ga0496112_0383538
933 Ga0496113_0714779
934 Ga0496114_0034469
935 Ga0496115_0078885
936 Ga0496115_0623383
937 Ga0496116_0066220
938 Ga0496118_0022979
939 Ga0496121_0011032
940 Ga0496126_0002351
941 Ga0501070_0297426
942 Ga0501072_0340685
943 Ga0501074_0288346
944 nmdc:mga05p37_124193_c1
945 nmdc:mga05p37_146993_c1
946 nmdc:mga05p37_175170_c1
947 nmdc:mga05p37_197185_c1
948 nmdc:mga05p37_210000_c1
949 nmdc:mga05p37_428351_c1
950 nmdc:mga05p37_502635_c1
951 nmdc:mga05p37_503935_c1
952 nmdc:mga09592_279244_c1
953 nmdc:mga09592_385331_c1
954 nmdc:mga09592_473424_c1
955 nmdc:mga09592_6474_c1
956 nmdc:mga0qj67_459337_c1
957 nmdc:mga06r32_65324_c1
958 nmdc:mga06r32_689581_c1
959 nmdc:mga08y16_188788_c1
960 nmdc:mga08y16_89292_c1
961 nmdc:mga0n895_121628_c1
962 nmdc:mga0n895_208266_c1
963 nmdc:mga0n895_265088_c1
964 nmdc:mga0n895_76472_c1
965 nmdc:mga0rr50_223458_c1
966 nmdc:mga0rr50_664560_c1
967 nmdc:mga08x19_304441_c1
968 nmdc:mga08x19_392631_c1
969 nmdc:mga08x19_488333_c1
970 nmdc:mga08x19_55618_c1
971 nmdc:mga0a205_118873_c1
972 nmdc:mga0a205_302169_c1
973 nmdc:mga0a205_327853_c1
974 nmdc:mga0a205_41032_c1
975 Ga0495601_0010210
976 Ga0495612_0058098
977 Ga0495595_0011808
978 Ga0495619_0020199
979 Ga0495619_0319650
980 Ga0495619_0544543
981 Ga0530510_0603540
982 2513692490
983 2723848399
984 2874608633
985 2921649290
986 2922361643
987 2922364892
988 2974315610
989 8006965827
990 8055271832

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00484

Pro_CA

Carbonic anhydrase

116

265

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2a5v-assembly1.cif.gz_A crystal structure of m. tuberculosis beta carbonic anhydrase, rv3588c, tetrameric form 0.8985 53 247
5jj8-assembly1.cif.gz_A crystal structure of the beta carbonic anhydrase psca3 isolated from pseudomonas aeruginosa - alternate crystal packing form 0.8695 87 247
1ym3-assembly1.cif.gz_A-2 crystal structure of carbonic anhydrase rv3588c from mycobacterium tuberculosis 0.8623 53 247
3ucj-assembly1.cif.gz_A coccomyxa beta-carbonic anhydrase in complex with acetazolamide 0.8515 87 246
3e24-assembly1.cif.gz_A h. influenzae beta-carbonic anhydrase, variant w39f 0.8403 92 244
ID Description Score Start End Superfamily
1ym3A00 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.8623 53 247 3.40.1050.10
af_P0ABE9_1_202_3.40.1050.10 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.8567 83 247 3.40.1050.10
1ddzB02 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.8536 90 245 3.40.1050.10
af_Q69MC9_78_288_3.40.1050.10 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.8456 80 246 3.40.1050.10
3ucnB00 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.8412 87 245 3.40.1050.10
ID Description Score Start End GO Terms
AF-A0A2N7WAD4-F1-model_v4 Carbonic anhydrase 0.9987 145 247 GO:0004089
GO:0008270
AF-A0A655C940-F1-model_v4 Carbonic anhydrase chloroplast (EC 4.2.1.1) 0.9981 132 247 GO:0004089
GO:0008270
AF-A0A6Y0VSY3-F1-model_v4 Carbonic anhydrase 0.9945 153 247 GO:0004089
GO:0008270
AF-A0A509D325-F1-model_v4 deleted 0.9934 128 247
AF-A0A7X1WED6-F1-model_v4 Carbonic anhydrase 0.9916 115 247 GO:0004089
GO:0008270

Map