F454690

General Info

Members Datasets Scaffolds Average Seq Length
495 264 990 145

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100073911|Ga0070708_1000739113
Length 159
Sequence VAARAKTSHWAETTIASLQAKGHRSGDARRAVVELLGRQQCCLTAQEIFDQLRSEGRRVGIASVYRTLEQLSRDGYVQRIDIGAGTTRFEPIHADGEHHHHLVCDDCGKVEAFADDQLERALRKVEGRTGYSVAGHDVVLRGACRDCAPRAGGRVRLTR

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
62 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
147 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
148 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
149 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
150 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
151 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
152 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
153 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
154 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
155 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
156 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
157 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
158 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
159 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
160 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
161 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
162 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
163 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
164 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
165 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
166 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
167 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
168 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
169 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
170 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
171 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
172 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
173 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
174 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
175 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
176 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
177 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
178 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
179 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
180 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
181 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
182 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
183 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
184 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
185 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
186 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
187 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
188 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
189 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
190 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
191 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
192 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
193 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
194 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
195 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
196 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
197 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
198 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
199 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
200 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
201 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
202 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
203 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
204 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
205 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
206 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
207 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
208 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
209 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
210 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
211 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
212 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
213 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
214 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
215 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
216 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
217 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
218 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
219 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
220 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
221 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
222 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
223 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
224 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
225 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
226 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
227 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
228 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
229 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
230 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
231 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
232 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
233 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
234 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
235 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
236 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
237 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
238 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
239 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
240 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
241 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
242 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
246 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
247 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
248 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
249 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
250 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
251 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
252 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
253 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
254 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
255 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
256 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
257 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
258 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
259 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
260 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
261 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
262 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
263 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
264 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.99
Metatranscriptomes 1.01
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.47
Rhizosphere 92.53
Stem 0
Stem Tuber 0
Unclassified 12.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100073911 3300005445 Bacteria 3073
2 JGI24744J21845_10026713 3300002077 Bacteria 1119
3 Ga0070658_10099216 3300005327 Bacteria 2406
4 Ga0070683_100346383 3300005329 Bacteria 1415
5 Ga0070683_100584905 3300005329 Bacteria 1068
6 Ga0070670_100035343 3300005331 Bacteria 4302
7 Ga0070670_100084270 3300005331 Bacteria 2731
8 Ga0070670_100235365 3300005331 Bacteria 1594
9 Ga0068869_100233878 3300005334 Bacteria 1461
10 Ga0070682_100013112 3300005337 Bacteria 4761
11 Ga0068868_100051621 3300005338 Unclassified 3236
12 Ga0068868_100164615 3300005338 Bacteria 1833
13 Ga0070689_100024563 3300005340 Bacteria 4521
14 Ga0070691_10650133 3300005341 Bacteria 628
15 Ga0070687_100271712 3300005343 Bacteria 1063
16 Ga0070661_100154790 3300005344 Bacteria 1734
17 Ga0070661_100216104 3300005344 Bacteria 1469
18 Ga0070668_100107865 3300005347 Bacteria 2214
19 Ga0070668_100786176 3300005347 Bacteria 845
20 Ga0070669_100373412 3300005353 Bacteria 1162
21 Ga0070669_101082257 3300005353 Bacteria 690
22 Ga0070675_100336759 3300005354 Unclassified 1336
23 Ga0070671_100756256 3300005355 Bacteria 845
24 Ga0070671_101203201 3300005355 Unclassified 667
25 Ga0070674_100004228 3300005356 Bacteria 8159
26 Ga0070674_100008473 3300005356 Bacteria 6122
27 Ga0070674_100355711 3300005356 Bacteria 1184
28 Ga0070688_100034864 3300005365 Bacteria 3052
29 Ga0070659_100059470 3300005366 Unclassified 3018
30 Ga0070659_100234514 3300005366 Bacteria 1517
31 Ga0070659_100426734 3300005366 Bacteria 1122
32 Ga0070667_100132053 3300005367 Bacteria 2180
33 Ga0070703_10004295 3300005406 Bacteria 4015
34 Ga0070703_10033867 3300005406 Bacteria 1557
35 Ga0070709_11289657 3300005434 Unclassified 589
36 Ga0070714_100113812 3300005435 Bacteria 2399
37 Ga0070714_100179926 3300005435 Bacteria 1923
38 Ga0070714_100290322 3300005435 Bacteria 1522
39 Ga0070713_100604012 3300005436 Bacteria 1042
40 Ga0070713_101527944 3300005436 Unclassified 648
41 Ga0070710_10050768 3300005437 Bacteria 2326
42 Ga0070701_10150079 3300005438 Bacteria 1341
43 Ga0070701_10309301 3300005438 Bacteria 974
44 Ga0070711_100034882 3300005439 Bacteria 3359
45 Ga0070711_100091863 3300005439 Bacteria 2189
46 Ga0070705_100466562 3300005440 Bacteria 951
47 Ga0070700_100191152 3300005441 Bacteria 1431
48 Ga0070700_100623224 3300005441 Bacteria 848
49 Ga0070700_101095793 3300005441 Unclassified 660
50 Ga0070694_100013787 3300005444 Bacteria 5052
51 Ga0070694_100073172 3300005444 Bacteria 2366
52 Ga0070694_100088945 3300005444 Bacteria 2163
53 Ga0070708_100003918 3300005445 Bacteria 11687
54 Ga0070708_100084998 3300005445 Bacteria 2871
55 Ga0070708_100109124 3300005445 Bacteria 2542
56 Ga0070708_100166845 3300005445 Bacteria 2054
57 Ga0070708_100502504 3300005445 Bacteria 1144
58 Ga0070678_100075526 3300005456 Bacteria 2535
59 Ga0070678_100326580 3300005456 Bacteria 1312
60 Ga0068867_100299707 3300005459 Bacteria 1325
61 Ga0068867_100328675 3300005459 Bacteria 1269
62 Ga0068867_100920884 3300005459 Bacteria 788
63 Ga0070685_10011990 3300005466 Unclassified 4545
64 Ga0070685_10651724 3300005466 Bacteria 763
65 Ga0070706_100088192 3300005467 Bacteria 2877
66 Ga0070706_100088667 3300005467 Bacteria 2868
67 Ga0070706_100142174 3300005467 Bacteria 2240
68 Ga0070706_100316382 3300005467 Bacteria 1456
69 Ga0070707_100002587 3300005468 Bacteria 17194
70 Ga0070707_100031718 3300005468 Bacteria 5035
71 Ga0070707_100611171 3300005468 Bacteria 1053
72 Ga0070698_100005032 3300005471 Bacteria 14478
73 Ga0070699_100019093 3300005518 Bacteria 5897
74 Ga0070699_100068802 3300005518 Bacteria 3076
75 Ga0070699_100289548 3300005518 Bacteria 1468
76 Ga0070679_100338747 3300005530 Bacteria 1452
77 Ga0070679_100896197 3300005530 Bacteria 830
78 Ga0070684_100000625 3300005535 Bacteria 24406
79 Ga0070684_100024713 3300005535 Bacteria 5042
80 Ga0070684_100037736 3300005535 Bacteria 4147
81 Ga0070697_100124846 3300005536 Bacteria 2156
82 Ga0070697_100159890 3300005536 Unclassified 1903
83 Ga0070697_100579771 3300005536 Bacteria 985
84 Ga0070672_100028983 3300005543 Bacteria 4146
85 Ga0070686_100160756 3300005544 Bacteria 1582
86 Ga0070686_100182920 3300005544 Bacteria 1491
87 Ga0070695_100157626 3300005545 Bacteria 1590
88 Ga0070696_100013463 3300005546 Bacteria 5488
89 Ga0070696_100211813 3300005546 Bacteria 1451
90 Ga0070696_100568090 3300005546 Bacteria 911
91 Ga0070693_100052452 3300005547 Bacteria 2338
92 Ga0070693_100464162 3300005547 Unclassified 891
93 Ga0070693_101072978 3300005547 Bacteria 613
94 Ga0070665_100726015 3300005548 Bacteria 1006
95 Ga0070704_100073473 3300005549 Bacteria 2491
96 Ga0068855_100011074 3300005563 Bacteria 10884
97 Ga0068855_100927196 3300005563 Unclassified 919
98 Ga0070664_100277415 3300005564 Bacteria 1511
99 Ga0068857_100000374 3300005577 Bacteria 31280
100 Ga0068857_100636223 3300005577 Bacteria 1010
101 Ga0068854_100064809 3300005578 Bacteria 2655
102 Ga0068854_100763299 3300005578 Bacteria 840
103 Ga0068856_100052272 3300005614 Bacteria 4029
104 Ga0070702_100058865 3300005615 Unclassified 2228
105 Ga0070702_100162694 3300005615 Bacteria 1444
106 Ga0070702_100254642 3300005615 Bacteria 1192
107 Ga0068852_100652436 3300005616 Bacteria 1060
108 Ga0068864_100565243 3300005618 Bacteria 1101
109 Ga0068866_10036430 3300005718 Bacteria 2410
110 Ga0068866_10162561 3300005718 Bacteria 1303
111 Ga0068866_10456395 3300005718 Unclassified 837
112 Ga0068870_10002364 3300005840 Bacteria 7845
113 Ga0068870_10034050 3300005840 Bacteria 2604
114 Ga0068863_100714838 3300005841 Bacteria 996
115 Ga0068862_100273840 3300005844 Bacteria 1545
116 Ga0068862_100908618 3300005844 Unclassified 866
117 Ga0070717_10477379 3300006028 Bacteria 1126
118 Ga0070717_11738375 3300006028 Bacteria 564
119 Ga0075432_10091087 3300006058 Bacteria 1116
120 Ga0070715_10001778 3300006163 Bacteria 6415
121 Ga0070716_100052429 3300006173 Bacteria 2322
122 Ga0070712_100329469 3300006175 Bacteria 1244
123 Ga0070712_100726356 3300006175 Bacteria 848
124 Ga0097621_100295234 3300006237 Bacteria 1430
125 Ga0097621_100702754 3300006237 Bacteria 931
126 Ga0068871_100311067 3300006358 Bacteria 1385
127 Ga0068871_101120515 3300006358 Bacteria 736
128 Ga0075428_100010172 3300006844 Bacteria 10445
129 Ga0075428_100074398 3300006844 Bacteria 3710
130 Ga0075428_100628399 3300006844 Bacteria 1146
131 Ga0075428_101073404 3300006844 Unclassified 851
132 Ga0075431_100040096 3300006847 Bacteria 4825
133 Ga0075433_10019975 3300006852 Bacteria 5595
134 Ga0075433_10025459 3300006852 Bacteria 5002
135 Ga0075433_10502403 3300006852 Unclassified 1067
136 Ga0075434_100016157 3300006871 Bacteria 7173
137 Ga0075434_100026056 3300006871 Bacteria 5725
138 Ga0075434_100112989 3300006871 Bacteria 2728
139 Ga0075434_100133901 3300006871 Bacteria 2498
140 Ga0075429_100239027 3300006880 Unclassified 1591
141 Ga0068865_100087083 3300006881 Unclassified 2257
142 Ga0068865_101205776 3300006881 Bacteria 670
143 Ga0075436_100029042 3300006914 Bacteria 3803
144 Ga0075435_100013308 3300007076 Bacteria 6115
145 Ga0075435_100018274 3300007076 Bacteria 5327
146 Ga0075435_100352539 3300007076 Bacteria 1261
147 Ga0105240_10027225 3300009093 Bacteria 7487
148 Ga0105240_10713636 3300009093 Bacteria 1093
149 Ga0105240_11720470 3300009093 Unclassified 654
150 Ga0111539_10012304 3300009094 Bacteria 10723
151 Ga0111539_10046165 3300009094 Bacteria 5212
152 Ga0111539_10105058 3300009094 Bacteria 3313
153 Ga0111539_12462398 3300009094 Bacteria 604
154 Ga0105245_10242415 3300009098 Bacteria 1748
155 Ga0105245_10662585 3300009098 Bacteria 1074
156 Ga0105245_10787965 3300009098 Bacteria 988
157 Ga0105245_11332077 3300009098 Bacteria 767
158 Ga0105245_11547364 3300009098 Bacteria 714
159 Ga0114129_10005412 3300009147 Bacteria 18029
160 Ga0114129_10033663 3300009147 Bacteria 7239
161 Ga0114129_10134950 3300009147 Bacteria 3386
162 Ga0114129_10219368 3300009147 Bacteria 2566
163 Ga0114129_10285616 3300009147 Bacteria 2203
164 Ga0114129_10674776 3300009147 Bacteria 1331
165 Ga0105243_10028759 3300009148 Bacteria 4269
166 Ga0105243_10040653 3300009148 Bacteria 3633
167 Ga0105243_10047104 3300009148 Bacteria 3393
168 Ga0105243_10175742 3300009148 Bacteria 1858
169 Ga0105243_10431432 3300009148 Bacteria 1232
170 Ga0105241_10296279 3300009174 Bacteria 1387
171 Ga0105242_10029858 3300009176 Bacteria 4351
172 Ga0105242_10036222 3300009176 Bacteria 3957
173 Ga0105242_10873084 3300009176 Bacteria 897
174 Ga0105249_10093860 3300009553 Bacteria 2812
175 Ga0105249_10708882 3300009553 Bacteria 1067
176 Ga0105239_10447716 3300010375 Bacteria 1465
177 Ga0105239_10520080 3300010375 Bacteria 1354
178 Ga0105239_11142782 3300010375 Bacteria 897
179 Ga0105246_10050341 3300011119 Bacteria 2857
180 Ga0105246_10805941 3300011119 Bacteria 834
181 Ga0157370_10018064 3300013104 Bacteria 7098
182 Ga0157370_10020611 3300013104 Bacteria 6581
183 Ga0157369_10001698 3300013105 Bacteria 26844
184 Ga0157369_11901185 3300013105 Bacteria 604
185 Ga0157374_10310417 3300013296 Unclassified 1561
186 Ga0157374_10818054 3300013296 Bacteria 948
187 Ga0157378_10217608 3300013297 Bacteria 1814
188 Ga0157378_11159690 3300013297 Bacteria 811
189 Ga0157372_10204461 3300013307 Unclassified 2288
190 Ga0157375_10250085 3300013308 Unclassified 1933
191 Ga0157380_10693963 3300014326 Bacteria 1022
192 Ga0157380_10950487 3300014326 Bacteria 889
193 Ga0182008_10276344 3300014497 Bacteria 873
194 Ga0157377_10001184 3300014745 Bacteria 11091
195 Ga0157377_10629462 3300014745 Bacteria 769
196 Ga0157376_10071906 3300014969 Bacteria 2941
197 Ga0157376_10085938 3300014969 Bacteria 2711
198 Ga0163161_10051318 3300017792 Bacteria 2987
199 Ga0197907_11474427 3300020069 Bacteria 582
200 Ga0206356_11310739 3300020070 Bacteria 1553
201 Ga0206354_10686538 3300020081 Bacteria 1179
202 Ga0206354_10711395 3300020081 Bacteria 728
203 Ga0206353_11225252 3300020082 Bacteria 615
204 Ga0207653_10000436 3300025885 Bacteria 17252
205 Ga0207653_10004853 3300025885 Bacteria 4202
206 Ga0207642_10112394 3300025899 Bacteria 1389
207 Ga0207688_10001835 3300025901 Bacteria 11333
208 Ga0207688_10787924 3300025901 Bacteria 602
209 Ga0207688_10927345 3300025901 Unclassified 551
210 Ga0207685_10162915 3300025905 Bacteria 1020
211 Ga0207645_10248211 3300025907 Bacteria 1177
212 Ga0207643_10006658 3300025908 Bacteria 6195
213 Ga0207643_10007840 3300025908 Bacteria 5735
214 Ga0207705_10075050 3300025909 Bacteria 2455
215 Ga0207705_11063142 3300025909 Bacteria 624
216 Ga0207684_10693885 3300025910 Bacteria 865
217 Ga0207684_10877089 3300025910 Bacteria 755
218 Ga0207684_11255204 3300025910 Unclassified 612
219 Ga0207707_10128450 3300025912 Bacteria 2216
220 Ga0207695_10207246 3300025913 Bacteria 1873
221 Ga0207695_10472021 3300025913 Bacteria 1137
222 Ga0207693_10000736 3300025915 Bacteria 29488
223 Ga0207693_10002218 3300025915 Bacteria 16923
224 Ga0207693_10030589 3300025915 Bacteria 4253
225 Ga0207663_10025981 3300025916 Bacteria 3393
226 Ga0207663_11464727 3300025916 Bacteria 550
227 Ga0207660_10322855 3300025917 Bacteria 1233
228 Ga0207662_10343665 3300025918 Bacteria 1000
229 Ga0207657_10000440 3300025919 Bacteria 43988
230 Ga0207649_10517776 3300025920 Bacteria 909
231 Ga0207652_10126887 3300025921 Bacteria 2273
232 Ga0207646_10003166 3300025922 Bacteria 18831
233 Ga0207646_10018802 3300025922 Bacteria 6437
234 Ga0207681_10713561 3300025923 Unclassified 834
235 Ga0207650_10190837 3300025925 Unclassified 1637
236 Ga0207650_10490739 3300025925 Bacteria 1026
237 Ga0207659_10686690 3300025926 Unclassified 876
238 Ga0207687_10184390 3300025927 Bacteria 1619
239 Ga0207687_10208840 3300025927 Bacteria 1531
240 Ga0207687_10295445 3300025927 Bacteria 1303
241 Ga0207687_10531714 3300025927 Bacteria 984
242 Ga0207664_10048849 3300025929 Bacteria 3329
243 Ga0207664_10103268 3300025929 Bacteria 2358
244 Ga0207664_10158342 3300025929 Bacteria 1930
245 Ga0207664_10769356 3300025929 Bacteria 866
246 Ga0207664_11850199 3300025929 Unclassified 526
247 Ga0207690_10071685 3300025932 Unclassified 2390
248 Ga0207690_10116441 3300025932 Unclassified 1933
249 Ga0207690_10135146 3300025932 Bacteria 1810
250 Ga0207709_10057806 3300025935 Bacteria 2407
251 Ga0207709_10217249 3300025935 Bacteria 1376
252 Ga0207709_10280370 3300025935 Bacteria 1231
253 Ga0207709_10712868 3300025935 Bacteria 804
254 Ga0207670_10141441 3300025936 Unclassified 1775
255 Ga0207669_10008397 3300025937 Bacteria 4846
256 Ga0207669_10018572 3300025937 Unclassified 3598
257 Ga0207669_10263327 3300025937 Bacteria 1291
258 Ga0207704_10059557 3300025938 Unclassified 2358
259 Ga0207691_10129242 3300025940 Unclassified 2232
260 Ga0207689_10164896 3300025942 Bacteria 1826
261 Ga0207661_10000897 3300025944 Bacteria 19524
262 Ga0207661_10588024 3300025944 Bacteria 1021
263 Ga0207667_10026330 3300025949 Bacteria 6357
264 Ga0207667_10316413 3300025949 Bacteria 1594
265 Ga0207712_10251167 3300025961 Bacteria 1430
266 Ga0207712_10436928 3300025961 Bacteria 1107
267 Ga0207668_10071832 3300025972 Bacteria 2474
268 Ga0207668_10179089 3300025972 Unclassified 1670
269 Ga0207658_10105293 3300025986 Bacteria 2218
270 Ga0207677_10126700 3300026023 Bacteria 1931
271 Ga0207677_10192521 3300026023 Unclassified 1614
272 Ga0207708_10005477 3300026075 Bacteria 9367
273 Ga0207708_10260906 3300026075 Bacteria 1399
274 Ga0207708_10417260 3300026075 Bacteria 1112
275 Ga0207708_10430163 3300026075 Bacteria 1096
276 Ga0207708_10872963 3300026075 Bacteria 777
277 Ga0207702_10225392 3300026078 Bacteria 1749
278 Ga0207648_10303493 3300026089 Bacteria 1432
279 Ga0207648_10747408 3300026089 Bacteria 908
280 Ga0207676_10132009 3300026095 Unclassified 2125
281 Ga0207674_10023797 3300026116 Bacteria 6554
282 Ga0207674_10470650 3300026116 Bacteria 1214
283 Ga0207675_100026323 3300026118 Bacteria 5414
284 Ga0207675_100057052 3300026118 Bacteria 3643
285 Ga0207683_10060597 3300026121 Unclassified 3327
286 Ga0207428_10020097 3300027907 Bacteria 5681
287 Ga0207428_10218107 3300027907 Bacteria 1431
288 Ga0207428_10333736 3300027907 Bacteria 1118
289 Ga0268266_10366149 3300028379 Bacteria 1357
290 Ga0268265_10015180 3300028380 Bacteria 5265
291 Ga0268265_10819050 3300028380 Unclassified 909
292 Ga0265337_1049745 3300028556 Bacteria 1183
293 Ga0265326_10132645 3300028558 Unclassified 710
294 Ga0265319_1016594 3300028563 Unclassified 2821
295 Ga0265334_10001775 3300028573 Bacteria 10296
296 Ga0265318_10000309 3300028577 Bacteria 39338
297 Ga0265318_10268488 3300028577 Bacteria 622
298 Ga0265322_10003812 3300028654 Bacteria 4526
299 Ga0265322_10016023 3300028654 Unclassified 2164
300 Ga0265336_10031175 3300028666 Unclassified 1657
301 Ga0265338_10005865 3300028800 Bacteria 15841
302 Ga0265338_10016669 3300028800 Bacteria 7966
303 Ga0265338_10051379 3300028800 Bacteria 3711
304 Ga0265338_10160734 3300028800 Bacteria 1735
305 Ga0265338_10389470 3300028800 Bacteria 995
306 Ga0265338_10862514 3300028800 Bacteria 618
307 Ga0265324_10026885 3300029957 Unclassified 2035
308 Ga0265330_10000410 3300031235 Bacteria 29517
309 Ga0265332_10004251 3300031238 Bacteria 6771
310 Ga0265332_10053977 3300031238 Bacteria 1724
311 Ga0265332_10093853 3300031238 Bacteria 1268
312 Ga0265328_10004360 3300031239 Bacteria 6147
313 Ga0265328_10091720 3300031239 Bacteria 1123
314 Ga0265328_10319470 3300031239 Bacteria 602
315 Ga0265320_10101126 3300031240 Unclassified 1327
316 Ga0265325_10001304 3300031241 Bacteria 17661
317 Ga0265325_10014810 3300031241 Bacteria 4400
318 Ga0265325_10017772 3300031241 Bacteria 3951
319 Ga0265329_10001722 3300031242 Bacteria 10461
320 Ga0265340_10002895 3300031247 Bacteria 9771
321 Ga0265340_10151224 3300031247 Bacteria 1058
322 Ga0265331_10065794 3300031250 Unclassified 1703
323 Ga0265331_10101758 3300031250 Bacteria 1322
324 Ga0265327_10008487 3300031251 Bacteria 7639
325 Ga0265327_10033840 3300031251 Bacteria 2842
326 Ga0265316_10000910 3300031344 Bacteria 32268
327 Ga0265316_10047662 3300031344 Bacteria 3388
328 Ga0265316_10331438 3300031344 Unclassified 1104
329 Ga0265313_10018531 3300031595 Bacteria 3904
330 Ga0265313_10019156 3300031595 Bacteria 3820
331 Ga0265313_10021966 3300031595 Bacteria 3476
332 Ga0265313_10025384 3300031595 Bacteria 3141
333 Ga0265314_10008685 3300031711 Bacteria 8689
334 Ga0265314_10010549 3300031711 Bacteria 7693
335 Ga0265342_10014693 3300031712 Bacteria 5188
336 Ga0265342_10050182 3300031712 Bacteria 2493
337 Ga0373948_0009421 3300034817 Bacteria 1683
338 Ga0373950_0026470 3300034818 Bacteria 1053
339 Ga0373958_0032995 3300034819 Bacteria 1025
340 Ga0373959_0001393 3300034820 Bacteria 3869
341 Ga0373938_0003144 3300034957 Bacteria 2683
342 Ga0373928_0001754 3300035084 Bacteria 4223
343 Ga0373929_0023983 3300035085 Bacteria 1257
344 Ga0373940_0022305 3300035088 Bacteria 1626
345 Ga0373949_0007875 3300035090 Bacteria 2335
346 Ga0373951_0003175 3300035091 Bacteria 4034
347 Ga0373952_0021746 3300035092 Bacteria 1356
348 Ga0373932_0002510 3300035112 Bacteria 4618
349 Ga0373939_0009431 3300035114 Bacteria 2420
350 Ga0373941_0033975 3300035115 Bacteria 1535
351 Ga0373960_0023291 3300035121 Bacteria 1666
352 Ga0373943_0038442 3300035170 Bacteria 2301
353 Ga0373943_0173171 3300035170 Bacteria 1182
354 Ga0373946_0524842 3300035171 Bacteria 609
355 Ga0373961_0106340 3300035241 Bacteria 914
356 Ga0373962_0023189 3300035242 Bacteria 1651
357 Ga0373931_0376888 3300035691 Bacteria 893
358 Ga0373935_0550406 3300035692 Bacteria 841
359 Ga0373927_0348642 3300035695 Bacteria 976
360 Ga0373933_0230489 3300035724 Bacteria 1190
361 Ga0373947_0309109 3300035725 Bacteria 1055
362 Ga0395899_0005518 3300037312 Bacteria 9801
363 Ga0395899_0077097 3300037312 Bacteria 2431
364 Ga0395899_0124670 3300037312 Bacteria 1842
365 Ga0395900_0009647 3300037418 Bacteria 9901
366 Ga0395900_0012761 3300037418 Bacteria 8587
367 Ga0395900_0075595 3300037418 Bacteria 3463
368 Ga0395898_0002570 3300037466 Bacteria 21244
369 Ga0395898_0003259 3300037466 Bacteria 18237
370 Ga0395898_0146410 3300037466 Bacteria 2260
371 Ga0395898_0390273 3300037466 Bacteria 1327
372 Ga0395898_1202473 3300037466 Unclassified 689
373 Ga0395905_0027631 3300037471 Bacteria 5350
374 Ga0395905_0028099 3300037471 Bacteria 5303
375 Ga0395905_0041527 3300037471 Bacteria 4316
376 Ga0395901_0002731 3300038443 Bacteria 17800
377 Ga0395901_0004843 3300038443 Bacteria 13583
378 Ga0395901_0006874 3300038443 Bacteria 11492
379 Ga0395901_0097684 3300038443 Bacteria 3079
380 Ga0395901_0149523 3300038443 Bacteria 2454
381 Ga0395901_0876871 3300038443 Unclassified 881
382 Ga0395901_1225129 3300038443 Unclassified 715
383 Ga0242420_004984 3300038996 Bacteria 2035
384 Ga0439448_0005322 3300042005 Bacteria 3669
385 Ga0439458_0008391 3300042157 Bacteria 2299
386 Ga0466966_0079142 3300044684 Bacteria 2049
387 Ga0466963_0032884 3300044694 Bacteria 3362
388 Ga0466964_0002678 3300044706 Bacteria 6380
389 Ga0466964_0019142 3300044706 Bacteria 2630
390 Ga0466957_0305771 3300044842 Unclassified 1069
391 Ga0466958_0192879 3300045836 Bacteria 1295
392 Ga0466958_0437320 3300045836 Unclassified 846
393 Ga0466967_0061077 3300045976 Bacteria 3342
394 Ga0466967_0341591 3300045976 Bacteria 1448
395 Ga0466967_1044423 3300045976 Bacteria 814
396 Ga0495651_0177432 3300046462 Bacteria 1511
397 Ga0495653_0016809 3300046463 Bacteria 5954
398 Ga0495583_0452374 3300046506 Bacteria 503
399 Ga0495630_0144980 3300046517 Bacteria 1806
400 Ga0495630_0507249 3300046517 Unclassified 925
401 Ga0495630_0774684 3300046517 Bacteria 733
402 Ga0495640_0450168 3300046533 Bacteria 787
403 Ga0495587_0773194 3300046536 Unclassified 525
404 Ga0495609_0194012 3300046538 Bacteria 851
405 Ga0495622_0205820 3300046557 Bacteria 876
406 Ga0495667_0110152 3300046559 Bacteria 1779
407 Ga0495656_0533089 3300046615 Bacteria 625
408 Ga0495611_0454030 3300046648 Unclassified 584
409 Ga0495635_0039761 3300046663 Bacteria 3253
410 Ga0495588_0389352 3300046674 Bacteria 732
411 Ga0495657_0510942 3300046675 Unclassified 700
412 Ga0495658_0077741 3300046683 Bacteria 1941
413 Ga0495613_0320113 3300046689 Bacteria 1071
414 Ga0495613_0458092 3300046689 Bacteria 863
415 Ga0495589_0309862 3300046794 Bacteria 731
416 Ga0495600_0256326 3300046809 Bacteria 1112
417 Ga0495581_0299724 3300047315 Bacteria 939
418 Ga0495674_0582956 3300047319 Bacteria 887
419 Ga0495684_0594847 3300047471 Bacteria 747
420 Ga0496100_0137016 3300048903 Bacteria 1730
421 Ga0496100_0749199 3300048903 Bacteria 764
422 Ga0496101_0054593 3300048904 Bacteria 2884
423 Ga0496101_1133856 3300048904 Bacteria 614
424 Ga0496102_0068310 3300048905 Bacteria 3261
425 Ga0496102_0078179 3300048905 Bacteria 3046
426 Ga0496102_0987032 3300048905 Bacteria 763
427 Ga0496103_0014834 3300048906 Bacteria 4632
428 Ga0496103_0327155 3300048906 Bacteria 986
429 Ga0496104_0008654 3300048907 Bacteria 9054
430 Ga0496105_0046690 3300048908 Bacteria 3574
431 Ga0496105_0461287 3300048908 Bacteria 1002
432 Ga0496107_0082536 3300048910 Bacteria 2344
433 Ga0496107_0109775 3300048910 Bacteria 2026
434 Ga0496108_0035241 3300048911 Bacteria 4159
435 Ga0496108_0062264 3300048911 Bacteria 3142
436 Ga0496109_0009091 3300048912 Bacteria 8460
437 Ga0496109_0361434 3300048912 Bacteria 1371
438 Ga0496109_0437586 3300048912 Bacteria 1235
439 Ga0496109_0601884 3300048912 Unclassified 1035
440 Ga0496110_0051290 3300048913 Unclassified 3625
441 Ga0496110_0292556 3300048913 Bacteria 1483
442 Ga0496110_0719456 3300048913 Bacteria 900
443 Ga0496110_1331602 3300048913 Bacteria 627
444 Ga0496111_0413223 3300048914 Bacteria 997
445 Ga0496111_0445093 3300048914 Bacteria 956
446 Ga0496111_0747352 3300048914 Bacteria 710
447 Ga0496112_0160028 3300048915 Bacteria 2218
448 Ga0496112_0216035 3300048915 Bacteria 1874
449 Ga0496112_0426518 3300048915 Bacteria 1264
450 Ga0496112_1198018 3300048915 Bacteria 676
451 Ga0496113_0252454 3300048916 Bacteria 1408
452 Ga0496114_0060006 3300048917 Bacteria 3178
453 Ga0496114_0454680 3300048917 Unclassified 1134
454 Ga0496115_0004162 3300048918 Bacteria 10447
455 Ga0496115_0275730 3300048918 Bacteria 1381
456 Ga0496115_1382166 3300048918 Bacteria 521
457 Ga0501042_0491361 3300049578 Unclassified 891
458 Ga0501043_0536106 3300049579 Bacteria 871
459 Ga0501046_0357609 3300049580 Bacteria 1059
460 Ga0501067_0136985 3300049583 Bacteria 1363
461 Ga0501072_0552710 3300049588 Bacteria 909
462 Ga0501075_0130987 3300049591 Bacteria 1911
463 Ga0501077_0275007 3300049593 Bacteria 1072
464 Ga0501077_0705961 3300049593 Bacteria 648
465 Ga0501079_0227966 3300049741 Bacteria 1455
466 Ga0501079_1053252 3300049741 Bacteria 641
467 Ga0501045_0425151 3300049824 Bacteria 988
468 nmdc:mga05p37_28273_c1 3300050507 Bacteria 6837
469 nmdc:mga05p37_288042_c1 3300050507 Bacteria 1956
470 nmdc:mga05p37_77403_c1 3300050507 Bacteria 4095
471 nmdc:mga05p37_841600_c1 3300050507 Bacteria 998
472 nmdc:mga09592_299425_c1 3300050508 Unclassified 1394
473 nmdc:mga06r32_206503_c1 3300050510 Bacteria 1952
474 nmdc:mga08y16_104513_c1 3300050511 Bacteria 2948
475 nmdc:mga08y16_511587_c1 3300050511 Bacteria 1219
476 nmdc:mga08y16_517894_c1 3300050511 Unclassified 1210
477 nmdc:mga08y16_63067_c1 3300050511 Bacteria 3870
478 nmdc:mga0n895_154204_c1 3300050512 Bacteria 2328
479 nmdc:mga0n895_290592_c1 3300050512 Unclassified 1657
480 nmdc:mga0n895_38174_c1 3300050512 Bacteria 4652
481 nmdc:mga0rr50_108771_c1 3300050513 Bacteria 2191
482 nmdc:mga08x19_15228_c1 3300050514 Bacteria 4677
483 nmdc:mga08x19_28926_c1 3300050514 Bacteria 3475
484 nmdc:mga0a205_181302_c1 3300050515 Bacteria 2000
485 nmdc:mga0a205_38791_c1 3300050515 Bacteria 4584
486 nmdc:mga0a205_46110_c2 3300050515 Bacteria 3129
487 Ga0495601_0024996 3300053077 Bacteria 3680
488 Ga0495612_0047454 3300053078 Bacteria 1760
489 Ga0495655_0001442 3300053083 Bacteria 3638
490 Ga0495619_0019420 3300053085 Bacteria 4320
491 Ga0495619_0057547 3300053085 Bacteria 2580
492 Ga0501082_0133305 3300060353 Bacteria 2155
493 Ga0501082_0594703 3300060353 Bacteria 968
494 Ga0530510_0242446 3300061734 Bacteria 1342
495 Ga0530510_1258040 3300061734 Bacteria 567
496 Ga0070708_100073911
497 JGI24744J21845_10026713
498 Ga0070658_10099216
499 Ga0070683_100346383
500 Ga0070683_100584905
501 Ga0070670_100035343
502 Ga0070670_100084270
503 Ga0070670_100235365
504 Ga0068869_100233878
505 Ga0070682_100013112
506 Ga0068868_100051621
507 Ga0068868_100164615
508 Ga0070689_100024563
509 Ga0070691_10650133
510 Ga0070687_100271712
511 Ga0070661_100154790
512 Ga0070661_100216104
513 Ga0070668_100107865
514 Ga0070668_100786176
515 Ga0070669_100373412
516 Ga0070669_101082257
517 Ga0070675_100336759
518 Ga0070671_100756256
519 Ga0070671_101203201
520 Ga0070674_100004228
521 Ga0070674_100008473
522 Ga0070674_100355711
523 Ga0070688_100034864
524 Ga0070659_100059470
525 Ga0070659_100234514
526 Ga0070659_100426734
527 Ga0070667_100132053
528 Ga0070703_10004295
529 Ga0070703_10033867
530 Ga0070709_11289657
531 Ga0070714_100113812
532 Ga0070714_100179926
533 Ga0070714_100290322
534 Ga0070713_100604012
535 Ga0070713_101527944
536 Ga0070710_10050768
537 Ga0070701_10150079
538 Ga0070701_10309301
539 Ga0070711_100034882
540 Ga0070711_100091863
541 Ga0070705_100466562
542 Ga0070700_100191152
543 Ga0070700_100623224
544 Ga0070700_101095793
545 Ga0070694_100013787
546 Ga0070694_100073172
547 Ga0070694_100088945
548 Ga0070708_100003918
549 Ga0070708_100084998
550 Ga0070708_100109124
551 Ga0070708_100166845
552 Ga0070708_100502504
553 Ga0070678_100075526
554 Ga0070678_100326580
555 Ga0068867_100299707
556 Ga0068867_100328675
557 Ga0068867_100920884
558 Ga0070685_10011990
559 Ga0070685_10651724
560 Ga0070706_100088192
561 Ga0070706_100088667
562 Ga0070706_100142174
563 Ga0070706_100316382
564 Ga0070707_100002587
565 Ga0070707_100031718
566 Ga0070707_100611171
567 Ga0070698_100005032
568 Ga0070699_100019093
569 Ga0070699_100068802
570 Ga0070699_100289548
571 Ga0070679_100338747
572 Ga0070679_100896197
573 Ga0070684_100000625
574 Ga0070684_100024713
575 Ga0070684_100037736
576 Ga0070697_100124846
577 Ga0070697_100159890
578 Ga0070697_100579771
579 Ga0070672_100028983
580 Ga0070686_100160756
581 Ga0070686_100182920
582 Ga0070695_100157626
583 Ga0070696_100013463
584 Ga0070696_100211813
585 Ga0070696_100568090
586 Ga0070693_100052452
587 Ga0070693_100464162
588 Ga0070693_101072978
589 Ga0070665_100726015
590 Ga0070704_100073473
591 Ga0068855_100011074
592 Ga0068855_100927196
593 Ga0070664_100277415
594 Ga0068857_100000374
595 Ga0068857_100636223
596 Ga0068854_100064809
597 Ga0068854_100763299
598 Ga0068856_100052272
599 Ga0070702_100058865
600 Ga0070702_100162694
601 Ga0070702_100254642
602 Ga0068852_100652436
603 Ga0068864_100565243
604 Ga0068866_10036430
605 Ga0068866_10162561
606 Ga0068866_10456395
607 Ga0068870_10002364
608 Ga0068870_10034050
609 Ga0068863_100714838
610 Ga0068862_100273840
611 Ga0068862_100908618
612 Ga0070717_10477379
613 Ga0070717_11738375
614 Ga0075432_10091087
615 Ga0070715_10001778
616 Ga0070716_100052429
617 Ga0070712_100329469
618 Ga0070712_100726356
619 Ga0097621_100295234
620 Ga0097621_100702754
621 Ga0068871_100311067
622 Ga0068871_101120515
623 Ga0075428_100010172
624 Ga0075428_100074398
625 Ga0075428_100628399
626 Ga0075428_101073404
627 Ga0075431_100040096
628 Ga0075433_10019975
629 Ga0075433_10025459
630 Ga0075433_10502403
631 Ga0075434_100016157
632 Ga0075434_100026056
633 Ga0075434_100112989
634 Ga0075434_100133901
635 Ga0075429_100239027
636 Ga0068865_100087083
637 Ga0068865_101205776
638 Ga0075436_100029042
639 Ga0075435_100013308
640 Ga0075435_100018274
641 Ga0075435_100352539
642 Ga0105240_10027225
643 Ga0105240_10713636
644 Ga0105240_11720470
645 Ga0111539_10012304
646 Ga0111539_10046165
647 Ga0111539_10105058
648 Ga0111539_12462398
649 Ga0105245_10242415
650 Ga0105245_10662585
651 Ga0105245_10787965
652 Ga0105245_11332077
653 Ga0105245_11547364
654 Ga0114129_10005412
655 Ga0114129_10033663
656 Ga0114129_10134950
657 Ga0114129_10219368
658 Ga0114129_10285616
659 Ga0114129_10674776
660 Ga0105243_10028759
661 Ga0105243_10040653
662 Ga0105243_10047104
663 Ga0105243_10175742
664 Ga0105243_10431432
665 Ga0105241_10296279
666 Ga0105242_10029858
667 Ga0105242_10036222
668 Ga0105242_10873084
669 Ga0105249_10093860
670 Ga0105249_10708882
671 Ga0105239_10447716
672 Ga0105239_10520080
673 Ga0105239_11142782
674 Ga0105246_10050341
675 Ga0105246_10805941
676 Ga0157370_10018064
677 Ga0157370_10020611
678 Ga0157369_10001698
679 Ga0157369_11901185
680 Ga0157374_10310417
681 Ga0157374_10818054
682 Ga0157378_10217608
683 Ga0157378_11159690
684 Ga0157372_10204461
685 Ga0157375_10250085
686 Ga0157380_10693963
687 Ga0157380_10950487
688 Ga0182008_10276344
689 Ga0157377_10001184
690 Ga0157377_10629462
691 Ga0157376_10071906
692 Ga0157376_10085938
693 Ga0163161_10051318
694 Ga0197907_11474427
695 Ga0206356_11310739
696 Ga0206354_10686538
697 Ga0206354_10711395
698 Ga0206353_11225252
699 Ga0207653_10000436
700 Ga0207653_10004853
701 Ga0207642_10112394
702 Ga0207688_10001835
703 Ga0207688_10787924
704 Ga0207688_10927345
705 Ga0207685_10162915
706 Ga0207645_10248211
707 Ga0207643_10006658
708 Ga0207643_10007840
709 Ga0207705_10075050
710 Ga0207705_11063142
711 Ga0207684_10693885
712 Ga0207684_10877089
713 Ga0207684_11255204
714 Ga0207707_10128450
715 Ga0207695_10207246
716 Ga0207695_10472021
717 Ga0207693_10000736
718 Ga0207693_10002218
719 Ga0207693_10030589
720 Ga0207663_10025981
721 Ga0207663_11464727
722 Ga0207660_10322855
723 Ga0207662_10343665
724 Ga0207657_10000440
725 Ga0207649_10517776
726 Ga0207652_10126887
727 Ga0207646_10003166
728 Ga0207646_10018802
729 Ga0207681_10713561
730 Ga0207650_10190837
731 Ga0207650_10490739
732 Ga0207659_10686690
733 Ga0207687_10184390
734 Ga0207687_10208840
735 Ga0207687_10295445
736 Ga0207687_10531714
737 Ga0207664_10048849
738 Ga0207664_10103268
739 Ga0207664_10158342
740 Ga0207664_10769356
741 Ga0207664_11850199
742 Ga0207690_10071685
743 Ga0207690_10116441
744 Ga0207690_10135146
745 Ga0207709_10057806
746 Ga0207709_10217249
747 Ga0207709_10280370
748 Ga0207709_10712868
749 Ga0207670_10141441
750 Ga0207669_10008397
751 Ga0207669_10018572
752 Ga0207669_10263327
753 Ga0207704_10059557
754 Ga0207691_10129242
755 Ga0207689_10164896
756 Ga0207661_10000897
757 Ga0207661_10588024
758 Ga0207667_10026330
759 Ga0207667_10316413
760 Ga0207712_10251167
761 Ga0207712_10436928
762 Ga0207668_10071832
763 Ga0207668_10179089
764 Ga0207658_10105293
765 Ga0207677_10126700
766 Ga0207677_10192521
767 Ga0207708_10005477
768 Ga0207708_10260906
769 Ga0207708_10417260
770 Ga0207708_10430163
771 Ga0207708_10872963
772 Ga0207702_10225392
773 Ga0207648_10303493
774 Ga0207648_10747408
775 Ga0207676_10132009
776 Ga0207674_10023797
777 Ga0207674_10470650
778 Ga0207675_100026323
779 Ga0207675_100057052
780 Ga0207683_10060597
781 Ga0207428_10020097
782 Ga0207428_10218107
783 Ga0207428_10333736
784 Ga0268266_10366149
785 Ga0268265_10015180
786 Ga0268265_10819050
787 Ga0265337_1049745
788 Ga0265326_10132645
789 Ga0265319_1016594
790 Ga0265334_10001775
791 Ga0265318_10000309
792 Ga0265318_10268488
793 Ga0265322_10003812
794 Ga0265322_10016023
795 Ga0265336_10031175
796 Ga0265338_10005865
797 Ga0265338_10016669
798 Ga0265338_10051379
799 Ga0265338_10160734
800 Ga0265338_10389470
801 Ga0265338_10862514
802 Ga0265324_10026885
803 Ga0265330_10000410
804 Ga0265332_10004251
805 Ga0265332_10053977
806 Ga0265332_10093853
807 Ga0265328_10004360
808 Ga0265328_10091720
809 Ga0265328_10319470
810 Ga0265320_10101126
811 Ga0265325_10001304
812 Ga0265325_10014810
813 Ga0265325_10017772
814 Ga0265329_10001722
815 Ga0265340_10002895
816 Ga0265340_10151224
817 Ga0265331_10065794
818 Ga0265331_10101758
819 Ga0265327_10008487
820 Ga0265327_10033840
821 Ga0265316_10000910
822 Ga0265316_10047662
823 Ga0265316_10331438
824 Ga0265313_10018531
825 Ga0265313_10019156
826 Ga0265313_10021966
827 Ga0265313_10025384
828 Ga0265314_10008685
829 Ga0265314_10010549
830 Ga0265342_10014693
831 Ga0265342_10050182
832 Ga0373948_0009421
833 Ga0373950_0026470
834 Ga0373958_0032995
835 Ga0373959_0001393
836 Ga0373938_0003144
837 Ga0373928_0001754
838 Ga0373929_0023983
839 Ga0373940_0022305
840 Ga0373949_0007875
841 Ga0373951_0003175
842 Ga0373952_0021746
843 Ga0373932_0002510
844 Ga0373939_0009431
845 Ga0373941_0033975
846 Ga0373960_0023291
847 Ga0373943_0038442
848 Ga0373943_0173171
849 Ga0373946_0524842
850 Ga0373961_0106340
851 Ga0373962_0023189
852 Ga0373931_0376888
853 Ga0373935_0550406
854 Ga0373927_0348642
855 Ga0373933_0230489
856 Ga0373947_0309109
857 Ga0395899_0005518
858 Ga0395899_0077097
859 Ga0395899_0124670
860 Ga0395900_0009647
861 Ga0395900_0012761
862 Ga0395900_0075595
863 Ga0395898_0002570
864 Ga0395898_0003259
865 Ga0395898_0146410
866 Ga0395898_0390273
867 Ga0395898_1202473
868 Ga0395905_0027631
869 Ga0395905_0028099
870 Ga0395905_0041527
871 Ga0395901_0002731
872 Ga0395901_0004843
873 Ga0395901_0006874
874 Ga0395901_0097684
875 Ga0395901_0149523
876 Ga0395901_0876871
877 Ga0395901_1225129
878 Ga0242420_004984
879 Ga0439448_0005322
880 Ga0439458_0008391
881 Ga0466966_0079142
882 Ga0466963_0032884
883 Ga0466964_0002678
884 Ga0466964_0019142
885 Ga0466957_0305771
886 Ga0466958_0192879
887 Ga0466958_0437320
888 Ga0466967_0061077
889 Ga0466967_0341591
890 Ga0466967_1044423
891 Ga0495651_0177432
892 Ga0495653_0016809
893 Ga0495583_0452374
894 Ga0495630_0144980
895 Ga0495630_0507249
896 Ga0495630_0774684
897 Ga0495640_0450168
898 Ga0495587_0773194
899 Ga0495609_0194012
900 Ga0495622_0205820
901 Ga0495667_0110152
902 Ga0495656_0533089
903 Ga0495611_0454030
904 Ga0495635_0039761
905 Ga0495588_0389352
906 Ga0495657_0510942
907 Ga0495658_0077741
908 Ga0495613_0320113
909 Ga0495613_0458092
910 Ga0495589_0309862
911 Ga0495600_0256326
912 Ga0495581_0299724
913 Ga0495674_0582956
914 Ga0495684_0594847
915 Ga0496100_0137016
916 Ga0496100_0749199
917 Ga0496101_0054593
918 Ga0496101_1133856
919 Ga0496102_0068310
920 Ga0496102_0078179
921 Ga0496102_0987032
922 Ga0496103_0014834
923 Ga0496103_0327155
924 Ga0496104_0008654
925 Ga0496105_0046690
926 Ga0496105_0461287
927 Ga0496107_0082536
928 Ga0496107_0109775
929 Ga0496108_0035241
930 Ga0496108_0062264
931 Ga0496109_0009091
932 Ga0496109_0361434
933 Ga0496109_0437586
934 Ga0496109_0601884
935 Ga0496110_0051290
936 Ga0496110_0292556
937 Ga0496110_0719456
938 Ga0496110_1331602
939 Ga0496111_0413223
940 Ga0496111_0445093
941 Ga0496111_0747352
942 Ga0496112_0160028
943 Ga0496112_0216035
944 Ga0496112_0426518
945 Ga0496112_1198018
946 Ga0496113_0252454
947 Ga0496114_0060006
948 Ga0496114_0454680
949 Ga0496115_0004162
950 Ga0496115_0275730
951 Ga0496115_1382166
952 Ga0501042_0491361
953 Ga0501043_0536106
954 Ga0501046_0357609
955 Ga0501067_0136985
956 Ga0501072_0552710
957 Ga0501075_0130987
958 Ga0501077_0275007
959 Ga0501077_0705961
960 Ga0501079_0227966
961 Ga0501079_1053252
962 Ga0501045_0425151
963 nmdc:mga05p37_28273_c1
964 nmdc:mga05p37_288042_c1
965 nmdc:mga05p37_77403_c1
966 nmdc:mga05p37_841600_c1
967 nmdc:mga09592_299425_c1
968 nmdc:mga06r32_206503_c1
969 nmdc:mga08y16_104513_c1
970 nmdc:mga08y16_511587_c1
971 nmdc:mga08y16_517894_c1
972 nmdc:mga08y16_63067_c1
973 nmdc:mga0n895_154204_c1
974 nmdc:mga0n895_290592_c1
975 nmdc:mga0n895_38174_c1
976 nmdc:mga0rr50_108771_c1
977 nmdc:mga08x19_15228_c1
978 nmdc:mga08x19_28926_c1
979 nmdc:mga0a205_181302_c1
980 nmdc:mga0a205_38791_c1
981 nmdc:mga0a205_46110_c2
982 Ga0495601_0024996
983 Ga0495612_0047454
984 Ga0495655_0001442
985 Ga0495619_0019420
986 Ga0495619_0057547
987 Ga0501082_0133305
988 Ga0501082_0594703
989 Ga0530510_0242446
990 Ga0530510_1258040

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01475

FUR

Ferric uptake regulator family

20

141

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lb5-assembly1.cif.gz_B crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.906 27 86
2mh2-assembly1.cif.gz_A structural insights into the dna recognition and protein interaction domains reveal fundamental homologous dna pairing properties of hop2 0.8914 20 85
2mh2-assembly1.cif.gz_A structural insights into the dna recognition and protein interaction domains reveal fundamental homologous dna pairing properties of hop2 0.8791 20 85
5l0p-assembly1.cif.gz_A-2 symmetry-based assembly of a two-dimensional protein lattice 0.8587 5 85
2fu4-assembly1.cif.gz_A crystal structure of the dna binding domain of e.coli fur (ferric uptake regulator) 0.8511 5 85
ID Description Score Start End Superfamily
3mwmB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9267 22 87 1.10.10.10
4lb5B00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.906 27 86 1.10.10.10
2mh2A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8914 20 85 1.10.10.10
af_Q4DPL3_4_78_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8839 21 87 1.10.10.10
2mh2A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8791 20 85 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A559IYA8-F1-model_v4 Fe2+/Zn2+ uptake regulation protein 0.9059 14 85 GO:0003700
AF-A0A7K1SD76-F1-model_v4 Uncharacterized protein 0.8915 3 85 GO:0003700
GO:0005737
AF-A0A1G9MSQ5-F1-model_v4 Ferric uptake regulator family protein 0.8799 1 86 GO:0003700
GO:0005737
AF-A0A4U6CR48-F1-model_v4 Ferric uptake regulator family protein 0.8792 1 87 GO:0003700
GO:0005737
AF-A0A1G9MSQ5-F1-model_v4 Ferric uptake regulator family protein 0.8616 1 86 GO:0003700
GO:0005737

Map