F454683

General Info

Members Datasets Scaffolds Average Seq Length
495 289 990 283

Family's Representative Sequence

Representative Sequence 3300005343|Ga0070687_100054413|Ga0070687_1000544131
Length 328
Sequence MDLTSLAVAAIAVSSGIIGWDFMSRRSATEPPSEAHRNLAELAYYVLLVGCFGLLVILKIMSFAGILFSATVLTGVVWAWNDFIGAKKRPAGKSEPVFVEIARGFFPIILVVFLLRSFLVEPFKIPSGSMIPSLLVGDFILVNKYTYGVRLPVINKKIIAVNDPKRGDVMVFRFPEDPSTDYIKRVIGLPGDKVEYRDKRLYINDTLQTLTPAGPYYVSSDSGLGTTVADSFVEKMGDTEHRVILQSERAPVSLPSVHQFPLKENCSYNEAGFTCTVPAGHFFMMGDNRDGSSDSRYWGFVPESNIVGKAFLIWWNFGDFKRVGSKII

Samples

Sample ID Description Type Environment
1 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
54 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
70 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
71 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
161 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
164 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
165 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
166 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
167 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
168 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
169 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
170 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
171 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
172 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
173 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
174 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
175 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
176 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
177 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
178 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
179 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
180 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
181 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
182 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
183 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
184 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
185 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
186 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
187 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
188 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
189 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
190 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
191 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
192 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
193 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
194 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
195 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
196 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
197 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
198 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
199 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
200 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
201 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
202 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
203 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
204 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
205 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
206 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
207 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
208 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
209 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
210 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
211 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
212 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
213 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
214 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
215 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
216 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
217 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
218 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
219 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
220 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
221 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
222 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
223 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
224 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
225 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
226 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
227 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
228 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
229 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
230 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
231 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
232 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
233 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
234 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
235 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
236 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
237 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
238 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
239 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
240 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
241 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
242 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
243 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
244 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
258 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
259 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
260 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
261 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
262 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
263 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
264 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
265 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
266 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
267 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
268 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
269 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
270 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
273 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
274 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
275 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
276 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
277 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
278 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
279 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
280 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
281 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
282 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
283 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
284 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
285 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
286 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
287 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
288 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
289 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.41
Nodule 0
Rhizoplane 0.61
Rhizosphere 97.98
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070687_100054413 3300005343 Bacteria 2085
2 JGI25406J46586_10011256 3300003203 Bacteria 3930
3 Ga0065712_10109429 3300005290 Bacteria 1855
4 Ga0070658_10199533 3300005327 Bacteria 1687
5 Ga0070683_100147244 3300005329 Bacteria 2232
6 Ga0068869_100000362 3300005334 Bacteria 24432
7 Ga0070680_100011013 3300005336 Bacteria 6991
8 Ga0070680_100371745 3300005336 Bacteria 1216
9 Ga0070680_100412775 3300005336 Bacteria 1151
10 Ga0068868_100000248 3300005338 Bacteria 36775
11 Ga0070689_100003039 3300005340 Bacteria 11050
12 Ga0070689_100013902 3300005340 Bacteria 5837
13 Ga0070689_100153066 3300005340 Bacteria 1861
14 Ga0070691_10067723 3300005341 Bacteria 1727
15 Ga0070687_100000207 3300005343 Bacteria 20504
16 Ga0070692_10003330 3300005345 Bacteria 6499
17 Ga0070692_10038567 3300005345 Bacteria 2435
18 Ga0070692_10097674 3300005345 Bacteria 1606
19 Ga0070692_10243035 3300005345 Bacteria 1074
20 Ga0070669_100076379 3300005353 Bacteria 2486
21 Ga0070671_100123789 3300005355 Bacteria 2177
22 Ga0070674_100076881 3300005356 Bacteria 2375
23 Ga0070674_100439122 3300005356 Bacteria 1075
24 Ga0070703_10030853 3300005406 Bacteria 1618
25 Ga0070709_10076888 3300005434 Bacteria 2169
26 Ga0070714_100068678 3300005435 Bacteria 3058
27 Ga0070714_100310306 3300005435 Bacteria 1472
28 Ga0070713_100020106 3300005436 Bacteria 5111
29 Ga0070701_10000076 3300005438 Bacteria 27089
30 Ga0070705_100002993 3300005440 Bacteria 8355
31 Ga0070705_100021580 3300005440 Bacteria 3427
32 Ga0070700_100000605 3300005441 Bacteria 17941
33 Ga0070694_100000270 3300005444 Bacteria 27446
34 Ga0070694_100014663 3300005444 Bacteria 4909
35 Ga0070694_100015279 3300005444 Bacteria 4817
36 Ga0070694_100018802 3300005444 Bacteria 4391
37 Ga0070678_100196805 3300005456 Bacteria 1661
38 Ga0070662_100441511 3300005457 Bacteria 1079
39 Ga0070681_10151443 3300005458 Bacteria 2245
40 Ga0070681_10209849 3300005458 Bacteria 1864
41 Ga0068867_100000406 3300005459 Bacteria 29006
42 Ga0068867_100002930 3300005459 Bacteria 12026
43 Ga0068867_100238168 3300005459 Bacteria 1474
44 Ga0070699_100011783 3300005518 Bacteria 7546
45 Ga0070699_100038313 3300005518 Bacteria 4150
46 Ga0070699_100234535 3300005518 Bacteria 1637
47 Ga0070679_100019907 3300005530 Bacteria 6535
48 Ga0070679_100026208 3300005530 Bacteria 5723
49 Ga0070684_100057706 3300005535 Bacteria 3390
50 Ga0070697_100018736 3300005536 Bacteria 5462
51 Ga0070697_100057002 3300005536 Bacteria 3179
52 Ga0068853_100040798 3300005539 Bacteria 3962
53 Ga0070686_100009529 3300005544 Bacteria 5460
54 Ga0070695_100000673 3300005545 Bacteria 18262
55 Ga0070695_100001966 3300005545 Bacteria 11678
56 Ga0070695_100064011 3300005545 Bacteria 2391
57 Ga0070695_100131781 3300005545 Bacteria 1724
58 Ga0070696_100137590 3300005546 Bacteria 1782
59 Ga0070696_100246257 3300005546 Bacteria 1350
60 Ga0070696_100290713 3300005546 Bacteria 1248
61 Ga0070696_100532859 3300005546 Bacteria 938
62 Ga0070693_100001687 3300005547 Bacteria 10014
63 Ga0070693_100003308 3300005547 Bacteria 7491
64 Ga0070693_100371838 3300005547 Bacteria 984
65 Ga0070665_100007682 3300005548 Bacteria 10953
66 Ga0070704_100000068 3300005549 Bacteria 34169
67 Ga0070704_100063308 3300005549 Bacteria 2654
68 Ga0070704_100268051 3300005549 Bacteria 1410
69 Ga0068855_100002155 3300005563 Bacteria 24332
70 Ga0068855_100009221 3300005563 Bacteria 11921
71 Ga0068855_100015772 3300005563 Bacteria 9090
72 Ga0068855_100069114 3300005563 Bacteria 4110
73 Ga0068855_100070308 3300005563 Bacteria 4072
74 Ga0068854_100001464 3300005578 Bacteria 14297
75 Ga0070702_100000140 3300005615 Bacteria 22411
76 Ga0070702_100053639 3300005615 Bacteria 2317
77 Ga0070702_100124883 3300005615 Bacteria 1616
78 Ga0070702_100168433 3300005615 Bacteria 1423
79 Ga0070702_100172686 3300005615 Bacteria 1407
80 Ga0068852_100012260 3300005616 Bacteria 6498
81 Ga0068852_100038055 3300005616 Bacteria 4039
82 Ga0068852_100078816 3300005616 Bacteria 2916
83 Ga0068859_100000543 3300005617 Bacteria 37386
84 Ga0068859_100194469 3300005617 Bacteria 2113
85 Ga0068859_100372974 3300005617 Bacteria 1523
86 Ga0068859_100413583 3300005617 Bacteria 1445
87 Ga0068864_100063944 3300005618 Bacteria 3190
88 Ga0068864_100149771 3300005618 Bacteria 2112
89 Ga0068866_10000166 3300005718 Bacteria 30436
90 Ga0068861_100000836 3300005719 Bacteria 18613
91 Ga0068851_10000495 3300005834 Bacteria 17225
92 Ga0068870_10035543 3300005840 Bacteria 2557
93 Ga0068870_10060965 3300005840 Bacteria 2026
94 Ga0068863_100438491 3300005841 Bacteria 1281
95 Ga0068858_100001484 3300005842 Bacteria 24147
96 Ga0068858_100020711 3300005842 Bacteria 6143
97 Ga0068858_100039119 3300005842 Bacteria 4399
98 Ga0068860_100001630 3300005843 Bacteria 24046
99 Ga0068862_100008793 3300005844 Bacteria 8364
100 Ga0068862_100014794 3300005844 Bacteria 6481
101 Ga0081539_10000556 3300005985 Bacteria 77121
102 Ga0081539_10031092 3300005985 Bacteria 3298
103 Ga0075364_10006346 3300006051 Bacteria 6947
104 Ga0070715_10044217 3300006163 Bacteria 1882
105 Ga0070716_100040281 3300006173 Bacteria 2598
106 Ga0070716_100042445 3300006173 Bacteria 2539
107 Ga0075366_10003769 3300006195 Bacteria 8056
108 Ga0075366_10081452 3300006195 Bacteria 1933
109 Ga0097621_100000836 3300006237 Bacteria 21659
110 Ga0097621_100015938 3300006237 Bacteria 5668
111 Ga0097621_100020933 3300006237 Bacteria 5048
112 Ga0068871_100069421 3300006358 Bacteria 2894
113 Ga0068871_100184990 3300006358 Bacteria 1792
114 Ga0068871_100210710 3300006358 Bacteria 1681
115 Ga0075428_100002620 3300006844 Bacteria 19578
116 Ga0075428_100030402 3300006844 Bacteria 5973
117 Ga0075428_100184392 3300006844 Bacteria 2258
118 Ga0075430_100177231 3300006846 Bacteria 1773
119 Ga0075430_100190743 3300006846 Bacteria 1703
120 Ga0075431_100022160 3300006847 Bacteria 6496
121 Ga0075431_100086900 3300006847 Bacteria 3227
122 Ga0075431_100129965 3300006847 Bacteria 2598
123 Ga0075431_100270429 3300006847 Bacteria 1722
124 Ga0075433_10014589 3300006852 Bacteria 6423
125 Ga0075433_10199756 3300006852 Bacteria 1778
126 Ga0075434_100005026 3300006871 Bacteria 12005
127 Ga0075434_100140026 3300006871 Bacteria 2439
128 Ga0075429_100000155 3300006880 Bacteria 42828
129 Ga0075429_100177346 3300006880 Bacteria 1867
130 Ga0075429_100286785 3300006880 Bacteria 1441
131 Ga0075429_100686005 3300006880 Bacteria 897
132 Ga0068865_100000254 3300006881 Bacteria 29586
133 Ga0068865_100063534 3300006881 Bacteria 2595
134 Ga0075436_100001941 3300006914 Bacteria 14225
135 Ga0075436_100014360 3300006914 Bacteria 5422
136 Ga0075436_100022069 3300006914 Bacteria 4372
137 Ga0075436_100032169 3300006914 Bacteria 3615
138 Ga0075436_100140572 3300006914 Bacteria 1697
139 Ga0097620_100000543 3300006931 Bacteria 37386
140 Ga0097620_100194475 3300006931 Bacteria 2113
141 Ga0097620_100372975 3300006931 Bacteria 1523
142 Ga0097620_100413605 3300006931 Bacteria 1445
143 Ga0075435_100017813 3300007076 Bacteria 5384
144 Ga0075435_100039774 3300007076 Bacteria 3753
145 Ga0099794_10091225 3300007265 Bacteria 1512
146 Ga0099795_10065985 3300007788 Bacteria 1354
147 Ga0105250_10047163 3300009092 Bacteria 1728
148 Ga0105240_10021131 3300009093 Bacteria 8664
149 Ga0105240_10110621 3300009093 Bacteria 3325
150 Ga0111539_10003080 3300009094 Bacteria 22102
151 Ga0105245_10001077 3300009098 Bacteria 24735
152 Ga0114129_10000730 3300009147 Bacteria 41752
153 Ga0114129_10051503 3300009147 Bacteria 5780
154 Ga0105243_10000508 3300009148 Bacteria 39703
155 Ga0105243_10005293 3300009148 Bacteria 10086
156 Ga0105241_10107786 3300009174 Bacteria 2226
157 Ga0105241_10116738 3300009174 Bacteria 2143
158 Ga0105242_10000746 3300009176 Bacteria 25338
159 Ga0105242_10001748 3300009176 Bacteria 17181
160 Ga0105242_10043933 3300009176 Bacteria 3617
161 Ga0105242_10138485 3300009176 Bacteria 2109
162 Ga0105248_10025887 3300009177 Bacteria 6525
163 Ga0105248_10085372 3300009177 Bacteria 3552
164 Ga0105238_10022708 3300009551 Bacteria 6394
165 Ga0105238_10332304 3300009551 Bacteria 1507
166 Ga0105249_10004637 3300009553 Bacteria 11878
167 Ga0105249_10005738 3300009553 Bacteria 10735
168 Ga0105239_10525976 3300010375 Bacteria 1346
169 Ga0157371_10170932 3300013102 Bacteria 1553
170 Ga0157370_10001120 3300013104 Bacteria 33464
171 Ga0157369_10003403 3300013105 Bacteria 18870
172 Ga0157369_10501055 3300013105 Bacteria 1256
173 Ga0157378_10000714 3300013297 Bacteria 31062
174 Ga0157378_10196667 3300013297 Bacteria 1905
175 Ga0157378_10226480 3300013297 Bacteria 1779
176 Ga0163162_10014655 3300013306 Bacteria 7661
177 Ga0163162_10057164 3300013306 Bacteria 3929
178 Ga0163162_10073588 3300013306 Bacteria 3473
179 Ga0163162_10149794 3300013306 Bacteria 2450
180 Ga0163162_10225032 3300013306 Bacteria 2006
181 Ga0157372_10027720 3300013307 Bacteria 6173
182 Ga0157372_10061683 3300013307 Bacteria 4199
183 Ga0157372_10111439 3300013307 Bacteria 3135
184 Ga0157375_10119539 3300013308 Bacteria 2743
185 Ga0157380_10034720 3300014326 Bacteria 3891
186 Ga0157380_10082466 3300014326 Bacteria 2632
187 Ga0157380_10321184 3300014326 Bacteria 1435
188 Ga0157380_10505840 3300014326 Bacteria 1175
189 Ga0157377_10015794 3300014745 Bacteria 3870
190 Ga0157377_10128832 3300014745 Bacteria 1543
191 Ga0157379_10077510 3300014968 Bacteria 2976
192 Ga0157379_10228462 3300014968 Bacteria 1687
193 Ga0157376_10010239 3300014969 Bacteria 6848
194 Ga0207696_1023473 3300025711 Bacteria 1945
195 Ga0207642_10002976 3300025899 Bacteria 5302
196 Ga0207688_10021600 3300025901 Bacteria 3519
197 Ga0207680_10230684 3300025903 Bacteria 1272
198 Ga0207647_10048082 3300025904 Bacteria 2650
199 Ga0207699_10049383 3300025906 Bacteria 2477
200 Ga0207645_10028645 3300025907 Bacteria 3595
201 Ga0207643_10046507 3300025908 Bacteria 2453
202 Ga0207643_10101639 3300025908 Bacteria 1686
203 Ga0207654_10034904 3300025911 Bacteria 2798
204 Ga0207654_10093118 3300025911 Bacteria 1842
205 Ga0207707_10060492 3300025912 Bacteria 3295
206 Ga0207695_10035546 3300025913 Bacteria 5401
207 Ga0207695_10073383 3300025913 Bacteria 3487
208 Ga0207695_10143262 3300025913 Bacteria 2336
209 Ga0207693_10235584 3300025915 Bacteria 1437
210 Ga0207660_10000830 3300025917 Bacteria 20366
211 Ga0207662_10000364 3300025918 Bacteria 20389
212 Ga0207662_10098743 3300025918 Bacteria 1807
213 Ga0207649_10094903 3300025920 Bacteria 1961
214 Ga0207652_10036937 3300025921 Bacteria 4132
215 Ga0207646_10165874 3300025922 Bacteria 1994
216 Ga0207681_10017204 3300025923 Bacteria 4536
217 Ga0207681_10142960 3300025923 Bacteria 1784
218 Ga0207694_10299514 3300025924 Bacteria 1324
219 Ga0207650_10195526 3300025925 Bacteria 1618
220 Ga0207659_10013064 3300025926 Bacteria 5307
221 Ga0207687_10002931 3300025927 Bacteria 11589
222 Ga0207700_10104668 3300025928 Bacteria 2265
223 Ga0207700_10385302 3300025928 Bacteria 1226
224 Ga0207664_10053227 3300025929 Bacteria 3203
225 Ga0207664_10104416 3300025929 Bacteria 2346
226 Ga0207664_10334594 3300025929 Bacteria 1338
227 Ga0207644_10294543 3300025931 Bacteria 1306
228 Ga0207690_10028963 3300025932 Bacteria 3516
229 Ga0207706_10236378 3300025933 Bacteria 1598
230 Ga0207686_10000852 3300025934 Bacteria 18528
231 Ga0207686_10071326 3300025934 Bacteria 2235
232 Ga0207709_10001202 3300025935 Bacteria 18678
233 Ga0207670_10008031 3300025936 Bacteria 5933
234 Ga0207670_10378025 3300025936 Bacteria 1128
235 Ga0207669_10109008 3300025937 Bacteria 1850
236 Ga0207704_10000714 3300025938 Bacteria 14618
237 Ga0207665_10019635 3300025939 Bacteria 4444
238 Ga0207665_10031147 3300025939 Bacteria 3528
239 Ga0207691_10013842 3300025940 Bacteria 7703
240 Ga0207691_10030356 3300025940 Bacteria 5052
241 Ga0207711_10015871 3300025941 Bacteria 6248
242 Ga0207711_10065614 3300025941 Bacteria 3138
243 Ga0207711_10123450 3300025941 Bacteria 2314
244 Ga0207689_10001501 3300025942 Bacteria 22293
245 Ga0207689_10069479 3300025942 Bacteria 2894
246 Ga0207661_10085710 3300025944 Bacteria 2612
247 Ga0207667_10016568 3300025949 Bacteria 8323
248 Ga0207667_10030499 3300025949 Bacteria 5833
249 Ga0207667_10046275 3300025949 Bacteria 4607
250 Ga0207667_10133631 3300025949 Bacteria 2555
251 Ga0207651_10115260 3300025960 Bacteria 2026
252 Ga0207651_10226943 3300025960 Bacteria 1513
253 Ga0207712_10014499 3300025961 Bacteria 5073
254 Ga0207640_10008038 3300025981 Bacteria 5831
255 Ga0207640_10257814 3300025981 Bacteria 1357
256 Ga0207677_10001272 3300026023 Bacteria 13553
257 Ga0207703_10008048 3300026035 Bacteria 8332
258 Ga0207703_10025071 3300026035 Bacteria 4691
259 Ga0207639_10074930 3300026041 Bacteria 2659
260 Ga0207708_10000327 3300026075 Bacteria 37451
261 Ga0207708_10003562 3300026075 Bacteria 11479
262 Ga0207708_10240469 3300026075 Bacteria 1456
263 Ga0207702_10058142 3300026078 Bacteria 3290
264 Ga0207641_10557479 3300026088 Bacteria 1118
265 Ga0207641_10791768 3300026088 Bacteria 937
266 Ga0207648_10000706 3300026089 Bacteria 37476
267 Ga0207648_10032751 3300026089 Bacteria 4586
268 Ga0207648_10356311 3300026089 Bacteria 1320
269 Ga0207676_10443298 3300026095 Bacteria 1222
270 Ga0207675_100000616 3300026118 Bacteria 34778
271 Ga0207675_100011216 3300026118 Bacteria 8392
272 Ga0207683_10199586 3300026121 Bacteria 1818
273 Ga0207698_10001184 3300026142 Bacteria 15204
274 Ga0207698_10057027 3300026142 Bacteria 3019
275 Ga0209969_1009165 3300027360 Bacteria 1408
276 Ga0209981_1002061 3300027378 Bacteria 2563
277 Ga0209996_1011263 3300027395 Bacteria 1193
278 Ga0210000_1003078 3300027462 Bacteria 2392
279 Ga0210000_1005999 3300027462 Bacteria 1769
280 Ga0209995_1013536 3300027471 Bacteria 1337
281 Ga0209968_1025859 3300027526 Bacteria 968
282 Ga0209999_1007498 3300027543 Bacteria 1965
283 Ga0209970_1008995 3300027614 Bacteria 1635
284 Ga0209983_1019305 3300027665 Bacteria 1417
285 Ga0209588_1002802 3300027671 Bacteria 4773
286 Ga0209588_1038307 3300027671 Bacteria 1544
287 Ga0209588_1040053 3300027671 Bacteria 1512
288 Ga0209971_1005795 3300027682 Bacteria 2927
289 Ga0209966_1000921 3300027695 Bacteria 5570
290 Ga0209998_10009810 3300027717 Bacteria 1985
291 Ga0209974_10018488 3300027876 Bacteria 2313
292 Ga0209974_10029126 3300027876 Bacteria 1829
293 Ga0207428_10014894 3300027907 Bacteria 6736
294 Ga0207428_10103522 3300027907 Bacteria 2198
295 Ga0268265_10006683 3300028380 Bacteria 7808
296 Ga0268264_10001855 3300028381 Bacteria 19216
297 Ga0268264_10123956 3300028381 Bacteria 2281
298 Ga0307408_100184757 3300031548 Bacteria 1675
299 Ga0307408_100311229 3300031548 Bacteria 1323
300 Ga0307405_10204381 3300031731 Bacteria 1437
301 Ga0307412_10083102 3300031911 Bacteria 2219
302 Ga0307416_100111250 3300032002 Bacteria 2414
303 Ga0307416_100178080 3300032002 Bacteria 1989
304 Ga0307416_100471697 3300032002 Bacteria 1313
305 Ga0307411_10317076 3300032005 Bacteria 1257
306 Ga0307411_10456007 3300032005 Bacteria 1071
307 Ga0373938_0019053 3300034957 Bacteria 1369
308 Ga0373926_0000292 3300035083 Bacteria 12281
309 Ga0373929_0031126 3300035085 Bacteria 1141
310 Ga0373934_0008580 3300035086 Bacteria 3811
311 Ga0373940_0002024 3300035088 Bacteria 3841
312 Ga0373944_0003363 3300035089 Bacteria 4122
313 Ga0373923_0005014 3300035111 Bacteria 4456
314 Ga0373936_0000564 3300035113 Bacteria 12709
315 Ga0373936_0008416 3300035113 Bacteria 3883
316 Ga0373939_0003332 3300035114 Bacteria 3771
317 Ga0373941_0042931 3300035115 Bacteria 1406
318 Ga0373953_0001352 3300035117 Bacteria 7052
319 Ga0373954_0000018 3300035118 Bacteria 62651
320 Ga0373954_0000178 3300035118 Bacteria 22926
321 Ga0373954_0001750 3300035118 Bacteria 8915
322 Ga0373954_0011251 3300035118 Bacteria 3961
323 Ga0373956_0000012 3300035119 Bacteria 57485
324 Ga0373956_0013655 3300035119 Bacteria 3380
325 Ga0373957_0002207 3300035120 Bacteria 5506
326 Ga0373946_0012967 3300035171 Bacteria 3127
327 Ga0373946_0015781 3300035171 Bacteria 2869
328 Ga0373955_0001278 3300035172 Bacteria 10709
329 Ga0373955_0235762 3300035172 Bacteria 1095
330 Ga0373924_0003836 3300035410 Bacteria 5201
331 Ga0373931_0000901 3300035691 Bacteria 12578
332 Ga0373931_0073158 3300035691 Bacteria 1875
333 Ga0373935_0076951 3300035692 Bacteria 2161
334 Ga0373935_0118509 3300035692 Bacteria 1765
335 Ga0373935_0172410 3300035692 Bacteria 1481
336 Ga0373927_0247212 3300035695 Bacteria 1172
337 Ga0373933_0000864 3300035724 Bacteria 18577
338 Ga0373933_0004498 3300035724 Bacteria 7647
339 Ga0373933_0011996 3300035724 Bacteria 4784
340 Ga0373947_0126977 3300035725 Bacteria 1625
341 Ga0373947_0206964 3300035725 Bacteria 1285
342 Ga0373937_0000290 3300036401 Bacteria 47834
343 Ga0373937_0001545 3300036401 Bacteria 19332
344 Ga0373925_0023384 3300037068 Bacteria 4509
345 Ga0373925_0026436 3300037068 Bacteria 4246
346 Ga0395899_0092349 3300037312 Bacteria 2192
347 Ga0395900_0020660 3300037418 Bacteria 6729
348 Ga0395905_0013444 3300037471 Bacteria 7844
349 Ga0439453_0003793 3300041408 Bacteria 2202
350 Ga0451807_0274805 3300041486 Bacteria 3352
351 Ga0439441_005808 3300042001 Bacteria 1932
352 Ga0439446_0003707 3300042156 Bacteria 3817
353 Ga0439434_0001977 3300042435 Bacteria 5935
354 Ga0439435_0001667 3300042436 Bacteria 4177
355 Ga0439435_0001863 3300042436 Bacteria 4035
356 Ga0439435_0006379 3300042436 Bacteria 2648
357 Ga0439435_0011913 3300042436 Bacteria 2095
358 Ga0439444_0004012 3300042437 Bacteria 2112
359 Ga0439460_0002028 3300042461 Bacteria 4852
360 Ga0439460_0004453 3300042461 Bacteria 3416
361 Ga0451577_0282379 3300042876 Bacteria 1504
362 Ga0451577_0313474 3300042876 Bacteria 1422
363 Ga0453683_0301747 3300044673 Bacteria 1025
364 Ga0466957_0014852 3300044842 Bacteria 4540
365 Ga0451576_0011180 3300045051 Bacteria 10231
366 Ga0495641_0002580 3300046461 Bacteria 14220
367 Ga0495651_0000027 3300046462 Bacteria 107496
368 Ga0495651_0018592 3300046462 Bacteria 5383
369 Ga0495651_0086828 3300046462 Bacteria 2353
370 Ga0495651_0214419 3300046462 Bacteria 1337
371 Ga0495653_0103107 3300046463 Bacteria 2063
372 Ga0495580_0021572 3300046472 Bacteria 4749
373 Ga0495580_0058597 3300046472 Bacteria 2708
374 Ga0495582_0270502 3300046473 Bacteria 975
375 Ga0495639_0094550 3300046475 Bacteria 1405
376 Ga0495664_0019323 3300046477 Bacteria 3916
377 Ga0495608_0000486 3300046511 Bacteria 27463
378 Ga0495618_0016449 3300046514 Bacteria 4525
379 Ga0495666_0007006 3300046526 Bacteria 5662
380 Ga0495666_0010130 3300046526 Bacteria 4703
381 Ga0495652_0100702 3300046529 Bacteria 2343
382 Ga0495665_0068400 3300046531 Bacteria 1873
383 Ga0495587_0179732 3300046536 Bacteria 1200
384 Ga0495598_0036743 3300046537 Bacteria 1409
385 Ga0495621_0071740 3300046539 Bacteria 1277
386 Ga0495645_0002550 3300046543 Bacteria 12363
387 Ga0495667_0018911 3300046559 Bacteria 4652
388 Ga0495667_0044869 3300046559 Bacteria 2927
389 Ga0495634_0042764 3300046642 Bacteria 3072
390 Ga0495635_0079079 3300046663 Bacteria 2251
391 Ga0495588_0146735 3300046674 Bacteria 1247
392 Ga0495657_0069612 3300046675 Bacteria 2302
393 Ga0495657_0077251 3300046675 Bacteria 2160
394 Ga0495657_0078402 3300046675 Bacteria 2141
395 Ga0495599_0013814 3300046678 Bacteria 4996
396 Ga0495599_0057610 3300046678 Bacteria 2431
397 Ga0495599_0071282 3300046678 Bacteria 2169
398 Ga0495623_0039839 3300046679 Bacteria 3002
399 Ga0495647_0002273 3300046681 Bacteria 6027
400 Ga0495647_0009490 3300046681 Bacteria 3298
401 Ga0495658_0016613 3300046683 Bacteria 3788
402 Ga0495613_0006614 3300046689 Bacteria 8662
403 Ga0495624_0157416 3300046690 Bacteria 1388
404 Ga0495600_0014986 3300046809 Bacteria 4895
405 Ga0495674_0010170 3300047319 Bacteria 8913
406 Ga0495680_0007888 3300047322 Bacteria 9717
407 Ga0495675_0146920 3300047444 Bacteria 1458
408 Ga0495684_0045126 3300047471 Bacteria 3373
409 Ga0495614_0042246 3300048089 Bacteria 1955
410 Ga0495615_0036797 3300048090 Bacteria 1203
411 Ga0496105_0318788 3300048908 Bacteria 1246
412 Ga0496115_0423906 3300048918 Bacteria 1078
413 Ga0501303_009653 3300049526 Bacteria 894
414 Ga0501033_0003706 3300049570 Bacteria 12433
415 Ga0501034_0560093 3300049571 Bacteria 1052
416 Ga0501036_0000381 3300049572 Bacteria 31374
417 Ga0501037_0075668 3300049573 Bacteria 2445
418 Ga0501038_0006387 3300049574 Bacteria 10916
419 Ga0501038_0331108 3300049574 Bacteria 1189
420 Ga0501039_0000492 3300049575 Bacteria 28646
421 Ga0501040_0000262 3300049576 Bacteria 30759
422 Ga0501041_0001364 3300049577 Bacteria 13461
423 Ga0501041_0115293 3300049577 Bacteria 1668
424 Ga0501042_0006295 3300049578 Bacteria 7700
425 Ga0501042_0081272 3300049578 Bacteria 2322
426 Ga0501042_0302586 3300049578 Bacteria 1155
427 Ga0501042_0418033 3300049578 Bacteria 971
428 Ga0501043_0015747 3300049579 Bacteria 5928
429 Ga0501046_0000630 3300049580 Bacteria 34607
430 Ga0501047_0001297 3300049581 Bacteria 24634
431 Ga0501047_0070883 3300049581 Bacteria 3355
432 Ga0501048_0553802 3300049582 Bacteria 825
433 Ga0501068_0004695 3300049584 Bacteria 7440
434 Ga0501070_0002745 3300049586 Bacteria 15364
435 Ga0501070_0133316 3300049586 Bacteria 2052
436 Ga0501070_0167855 3300049586 Bacteria 1808
437 Ga0501071_0002087 3300049587 Bacteria 11993
438 Ga0501072_0001764 3300049588 Bacteria 16084
439 Ga0501072_0001942 3300049588 Bacteria 15415
440 Ga0501072_0019783 3300049588 Bacteria 5209
441 Ga0501073_0002251 3300049589 Bacteria 14445
442 Ga0501074_0000448 3300049590 Bacteria 24676
443 Ga0501075_0001050 3300049591 Bacteria 17750
444 Ga0501076_0000475 3300049592 Bacteria 25328
445 Ga0501076_0070329 3300049592 Bacteria 2798
446 Ga0501077_0002163 3300049593 Bacteria 11874
447 Ga0501079_0000671 3300049741 Bacteria 22952
448 Ga0501079_0003004 3300049741 Bacteria 12333
449 Ga0501079_0014611 3300049741 Bacteria 5987
450 Ga0501079_0087777 3300049741 Bacteria 2408
451 Ga0501080_0002123 3300049742 Bacteria 17214
452 Ga0501080_0045761 3300049742 Bacteria 4074
453 Ga0501081_0002319 3300049743 Bacteria 11982
454 Ga0501081_0107944 3300049743 Bacteria 1974
455 Ga0501083_0015019 3300049744 Bacteria 5420
456 Ga0501035_0074043 3300049822 Bacteria 3013
457 Ga0501044_0053400 3300049823 Bacteria 4158
458 Ga0501045_0000167 3300049824 Bacteria 35865
459 Ga0501045_0042273 3300049824 Bacteria 3318
460 Ga0501045_0295258 3300049824 Bacteria 1206
461 Ga0501045_0350900 3300049824 Bacteria 1098
462 nmdc:mga0k408_5448_c1 3300050493 Bacteria 6777
463 nmdc:mga0k408_7108_c1 3300050493 Bacteria 5981
464 nmdc:mga06z11_74746_c1 3300050494 Bacteria 1802
465 nmdc:mga05p37_198104_c1 3300050507 Bacteria 2434
466 nmdc:mga05p37_36268_c1 3300050507 Bacteria 6051
467 nmdc:mga05p37_818_c1 3300050507 Bacteria 34846
468 nmdc:mga05p37_987057_c1 3300050507 Bacteria 896
469 nmdc:mga09592_317933_c1 3300050508 Bacteria 1349
470 nmdc:mga09592_506_c1 3300050508 Bacteria 29447
471 nmdc:mga06r32_278559_c1 3300050510 Bacteria 1660
472 nmdc:mga06r32_351845_c1 3300050510 Bacteria 1458
473 nmdc:mga08y16_2876_c1 3300050511 Bacteria 17716
474 nmdc:mga08y16_5671_c1 3300050511 Bacteria 13081
475 nmdc:mga0n895_214176_c1 3300050512 Bacteria 1956
476 nmdc:mga0rr50_12845_c1 3300050513 Bacteria 5428
477 nmdc:mga0rr50_18066_c1 3300050513 Bacteria 4728
478 nmdc:mga08x19_134665_c1 3300050514 Bacteria 1665
479 nmdc:mga08x19_189142_c1 3300050514 Bacteria 1408
480 nmdc:mga08x19_2868_c1 3300050514 Bacteria 10388
481 nmdc:mga08x19_44131_c1 3300050514 Bacteria 2846
482 nmdc:mga08x19_66810_c1 3300050514 Bacteria 2338
483 nmdc:mga08x19_7175_c1 3300050514 Bacteria 6621
484 nmdc:mga08x19_9954_c1 3300050514 Bacteria 5699
485 nmdc:mga0a205_16619_c1 3300050515 Bacteria 6891
486 Ga0495601_0006211 3300053077 Bacteria 6979
487 Ga0495601_0048132 3300053077 Bacteria 2685
488 Ga0495595_0014571 3300053084 Bacteria 3339
489 Ga0495619_0006023 3300053085 Bacteria 7684
490 Ga0500566_0155405 3300053094 Bacteria 1198
491 Ga0501084_0001772 3300054114 Bacteria 17179
492 Ga0501084_0069144 3300054114 Bacteria 2956
493 Ga0501084_0233157 3300054114 Bacteria 1554
494 Ga0501082_0019318 3300060353 Bacteria 5874
495 Ga0530510_0004376 3300061734 Bacteria 9774
496 Ga0070687_100054413
497 JGI25406J46586_10011256
498 Ga0065712_10109429
499 Ga0070658_10199533
500 Ga0070683_100147244
501 Ga0068869_100000362
502 Ga0070680_100011013
503 Ga0070680_100371745
504 Ga0070680_100412775
505 Ga0068868_100000248
506 Ga0070689_100003039
507 Ga0070689_100013902
508 Ga0070689_100153066
509 Ga0070691_10067723
510 Ga0070687_100000207
511 Ga0070692_10003330
512 Ga0070692_10038567
513 Ga0070692_10097674
514 Ga0070692_10243035
515 Ga0070669_100076379
516 Ga0070671_100123789
517 Ga0070674_100076881
518 Ga0070674_100439122
519 Ga0070703_10030853
520 Ga0070709_10076888
521 Ga0070714_100068678
522 Ga0070714_100310306
523 Ga0070713_100020106
524 Ga0070701_10000076
525 Ga0070705_100002993
526 Ga0070705_100021580
527 Ga0070700_100000605
528 Ga0070694_100000270
529 Ga0070694_100014663
530 Ga0070694_100015279
531 Ga0070694_100018802
532 Ga0070678_100196805
533 Ga0070662_100441511
534 Ga0070681_10151443
535 Ga0070681_10209849
536 Ga0068867_100000406
537 Ga0068867_100002930
538 Ga0068867_100238168
539 Ga0070699_100011783
540 Ga0070699_100038313
541 Ga0070699_100234535
542 Ga0070679_100019907
543 Ga0070679_100026208
544 Ga0070684_100057706
545 Ga0070697_100018736
546 Ga0070697_100057002
547 Ga0068853_100040798
548 Ga0070686_100009529
549 Ga0070695_100000673
550 Ga0070695_100001966
551 Ga0070695_100064011
552 Ga0070695_100131781
553 Ga0070696_100137590
554 Ga0070696_100246257
555 Ga0070696_100290713
556 Ga0070696_100532859
557 Ga0070693_100001687
558 Ga0070693_100003308
559 Ga0070693_100371838
560 Ga0070665_100007682
561 Ga0070704_100000068
562 Ga0070704_100063308
563 Ga0070704_100268051
564 Ga0068855_100002155
565 Ga0068855_100009221
566 Ga0068855_100015772
567 Ga0068855_100069114
568 Ga0068855_100070308
569 Ga0068854_100001464
570 Ga0070702_100000140
571 Ga0070702_100053639
572 Ga0070702_100124883
573 Ga0070702_100168433
574 Ga0070702_100172686
575 Ga0068852_100012260
576 Ga0068852_100038055
577 Ga0068852_100078816
578 Ga0068859_100000543
579 Ga0068859_100194469
580 Ga0068859_100372974
581 Ga0068859_100413583
582 Ga0068864_100063944
583 Ga0068864_100149771
584 Ga0068866_10000166
585 Ga0068861_100000836
586 Ga0068851_10000495
587 Ga0068870_10035543
588 Ga0068870_10060965
589 Ga0068863_100438491
590 Ga0068858_100001484
591 Ga0068858_100020711
592 Ga0068858_100039119
593 Ga0068860_100001630
594 Ga0068862_100008793
595 Ga0068862_100014794
596 Ga0081539_10000556
597 Ga0081539_10031092
598 Ga0075364_10006346
599 Ga0070715_10044217
600 Ga0070716_100040281
601 Ga0070716_100042445
602 Ga0075366_10003769
603 Ga0075366_10081452
604 Ga0097621_100000836
605 Ga0097621_100015938
606 Ga0097621_100020933
607 Ga0068871_100069421
608 Ga0068871_100184990
609 Ga0068871_100210710
610 Ga0075428_100002620
611 Ga0075428_100030402
612 Ga0075428_100184392
613 Ga0075430_100177231
614 Ga0075430_100190743
615 Ga0075431_100022160
616 Ga0075431_100086900
617 Ga0075431_100129965
618 Ga0075431_100270429
619 Ga0075433_10014589
620 Ga0075433_10199756
621 Ga0075434_100005026
622 Ga0075434_100140026
623 Ga0075429_100000155
624 Ga0075429_100177346
625 Ga0075429_100286785
626 Ga0075429_100686005
627 Ga0068865_100000254
628 Ga0068865_100063534
629 Ga0075436_100001941
630 Ga0075436_100014360
631 Ga0075436_100022069
632 Ga0075436_100032169
633 Ga0075436_100140572
634 Ga0097620_100000543
635 Ga0097620_100194475
636 Ga0097620_100372975
637 Ga0097620_100413605
638 Ga0075435_100017813
639 Ga0075435_100039774
640 Ga0099794_10091225
641 Ga0099795_10065985
642 Ga0105250_10047163
643 Ga0105240_10021131
644 Ga0105240_10110621
645 Ga0111539_10003080
646 Ga0105245_10001077
647 Ga0114129_10000730
648 Ga0114129_10051503
649 Ga0105243_10000508
650 Ga0105243_10005293
651 Ga0105241_10107786
652 Ga0105241_10116738
653 Ga0105242_10000746
654 Ga0105242_10001748
655 Ga0105242_10043933
656 Ga0105242_10138485
657 Ga0105248_10025887
658 Ga0105248_10085372
659 Ga0105238_10022708
660 Ga0105238_10332304
661 Ga0105249_10004637
662 Ga0105249_10005738
663 Ga0105239_10525976
664 Ga0157371_10170932
665 Ga0157370_10001120
666 Ga0157369_10003403
667 Ga0157369_10501055
668 Ga0157378_10000714
669 Ga0157378_10196667
670 Ga0157378_10226480
671 Ga0163162_10014655
672 Ga0163162_10057164
673 Ga0163162_10073588
674 Ga0163162_10149794
675 Ga0163162_10225032
676 Ga0157372_10027720
677 Ga0157372_10061683
678 Ga0157372_10111439
679 Ga0157375_10119539
680 Ga0157380_10034720
681 Ga0157380_10082466
682 Ga0157380_10321184
683 Ga0157380_10505840
684 Ga0157377_10015794
685 Ga0157377_10128832
686 Ga0157379_10077510
687 Ga0157379_10228462
688 Ga0157376_10010239
689 Ga0207696_1023473
690 Ga0207642_10002976
691 Ga0207688_10021600
692 Ga0207680_10230684
693 Ga0207647_10048082
694 Ga0207699_10049383
695 Ga0207645_10028645
696 Ga0207643_10046507
697 Ga0207643_10101639
698 Ga0207654_10034904
699 Ga0207654_10093118
700 Ga0207707_10060492
701 Ga0207695_10035546
702 Ga0207695_10073383
703 Ga0207695_10143262
704 Ga0207693_10235584
705 Ga0207660_10000830
706 Ga0207662_10000364
707 Ga0207662_10098743
708 Ga0207649_10094903
709 Ga0207652_10036937
710 Ga0207646_10165874
711 Ga0207681_10017204
712 Ga0207681_10142960
713 Ga0207694_10299514
714 Ga0207650_10195526
715 Ga0207659_10013064
716 Ga0207687_10002931
717 Ga0207700_10104668
718 Ga0207700_10385302
719 Ga0207664_10053227
720 Ga0207664_10104416
721 Ga0207664_10334594
722 Ga0207644_10294543
723 Ga0207690_10028963
724 Ga0207706_10236378
725 Ga0207686_10000852
726 Ga0207686_10071326
727 Ga0207709_10001202
728 Ga0207670_10008031
729 Ga0207670_10378025
730 Ga0207669_10109008
731 Ga0207704_10000714
732 Ga0207665_10019635
733 Ga0207665_10031147
734 Ga0207691_10013842
735 Ga0207691_10030356
736 Ga0207711_10015871
737 Ga0207711_10065614
738 Ga0207711_10123450
739 Ga0207689_10001501
740 Ga0207689_10069479
741 Ga0207661_10085710
742 Ga0207667_10016568
743 Ga0207667_10030499
744 Ga0207667_10046275
745 Ga0207667_10133631
746 Ga0207651_10115260
747 Ga0207651_10226943
748 Ga0207712_10014499
749 Ga0207640_10008038
750 Ga0207640_10257814
751 Ga0207677_10001272
752 Ga0207703_10008048
753 Ga0207703_10025071
754 Ga0207639_10074930
755 Ga0207708_10000327
756 Ga0207708_10003562
757 Ga0207708_10240469
758 Ga0207702_10058142
759 Ga0207641_10557479
760 Ga0207641_10791768
761 Ga0207648_10000706
762 Ga0207648_10032751
763 Ga0207648_10356311
764 Ga0207676_10443298
765 Ga0207675_100000616
766 Ga0207675_100011216
767 Ga0207683_10199586
768 Ga0207698_10001184
769 Ga0207698_10057027
770 Ga0209969_1009165
771 Ga0209981_1002061
772 Ga0209996_1011263
773 Ga0210000_1003078
774 Ga0210000_1005999
775 Ga0209995_1013536
776 Ga0209968_1025859
777 Ga0209999_1007498
778 Ga0209970_1008995
779 Ga0209983_1019305
780 Ga0209588_1002802
781 Ga0209588_1038307
782 Ga0209588_1040053
783 Ga0209971_1005795
784 Ga0209966_1000921
785 Ga0209998_10009810
786 Ga0209974_10018488
787 Ga0209974_10029126
788 Ga0207428_10014894
789 Ga0207428_10103522
790 Ga0268265_10006683
791 Ga0268264_10001855
792 Ga0268264_10123956
793 Ga0307408_100184757
794 Ga0307408_100311229
795 Ga0307405_10204381
796 Ga0307412_10083102
797 Ga0307416_100111250
798 Ga0307416_100178080
799 Ga0307416_100471697
800 Ga0307411_10317076
801 Ga0307411_10456007
802 Ga0373938_0019053
803 Ga0373926_0000292
804 Ga0373929_0031126
805 Ga0373934_0008580
806 Ga0373940_0002024
807 Ga0373944_0003363
808 Ga0373923_0005014
809 Ga0373936_0000564
810 Ga0373936_0008416
811 Ga0373939_0003332
812 Ga0373941_0042931
813 Ga0373953_0001352
814 Ga0373954_0000018
815 Ga0373954_0000178
816 Ga0373954_0001750
817 Ga0373954_0011251
818 Ga0373956_0000012
819 Ga0373956_0013655
820 Ga0373957_0002207
821 Ga0373946_0012967
822 Ga0373946_0015781
823 Ga0373955_0001278
824 Ga0373955_0235762
825 Ga0373924_0003836
826 Ga0373931_0000901
827 Ga0373931_0073158
828 Ga0373935_0076951
829 Ga0373935_0118509
830 Ga0373935_0172410
831 Ga0373927_0247212
832 Ga0373933_0000864
833 Ga0373933_0004498
834 Ga0373933_0011996
835 Ga0373947_0126977
836 Ga0373947_0206964
837 Ga0373937_0000290
838 Ga0373937_0001545
839 Ga0373925_0023384
840 Ga0373925_0026436
841 Ga0395899_0092349
842 Ga0395900_0020660
843 Ga0395905_0013444
844 Ga0439453_0003793
845 Ga0451807_0274805
846 Ga0439441_005808
847 Ga0439446_0003707
848 Ga0439434_0001977
849 Ga0439435_0001667
850 Ga0439435_0001863
851 Ga0439435_0006379
852 Ga0439435_0011913
853 Ga0439444_0004012
854 Ga0439460_0002028
855 Ga0439460_0004453
856 Ga0451577_0282379
857 Ga0451577_0313474
858 Ga0453683_0301747
859 Ga0466957_0014852
860 Ga0451576_0011180
861 Ga0495641_0002580
862 Ga0495651_0000027
863 Ga0495651_0018592
864 Ga0495651_0086828
865 Ga0495651_0214419
866 Ga0495653_0103107
867 Ga0495580_0021572
868 Ga0495580_0058597
869 Ga0495582_0270502
870 Ga0495639_0094550
871 Ga0495664_0019323
872 Ga0495608_0000486
873 Ga0495618_0016449
874 Ga0495666_0007006
875 Ga0495666_0010130
876 Ga0495652_0100702
877 Ga0495665_0068400
878 Ga0495587_0179732
879 Ga0495598_0036743
880 Ga0495621_0071740
881 Ga0495645_0002550
882 Ga0495667_0018911
883 Ga0495667_0044869
884 Ga0495634_0042764
885 Ga0495635_0079079
886 Ga0495588_0146735
887 Ga0495657_0069612
888 Ga0495657_0077251
889 Ga0495657_0078402
890 Ga0495599_0013814
891 Ga0495599_0057610
892 Ga0495599_0071282
893 Ga0495623_0039839
894 Ga0495647_0002273
895 Ga0495647_0009490
896 Ga0495658_0016613
897 Ga0495613_0006614
898 Ga0495624_0157416
899 Ga0495600_0014986
900 Ga0495674_0010170
901 Ga0495680_0007888
902 Ga0495675_0146920
903 Ga0495684_0045126
904 Ga0495614_0042246
905 Ga0495615_0036797
906 Ga0496105_0318788
907 Ga0496115_0423906
908 Ga0501303_009653
909 Ga0501033_0003706
910 Ga0501034_0560093
911 Ga0501036_0000381
912 Ga0501037_0075668
913 Ga0501038_0006387
914 Ga0501038_0331108
915 Ga0501039_0000492
916 Ga0501040_0000262
917 Ga0501041_0001364
918 Ga0501041_0115293
919 Ga0501042_0006295
920 Ga0501042_0081272
921 Ga0501042_0302586
922 Ga0501042_0418033
923 Ga0501043_0015747
924 Ga0501046_0000630
925 Ga0501047_0001297
926 Ga0501047_0070883
927 Ga0501048_0553802
928 Ga0501068_0004695
929 Ga0501070_0002745
930 Ga0501070_0133316
931 Ga0501070_0167855
932 Ga0501071_0002087
933 Ga0501072_0001764
934 Ga0501072_0001942
935 Ga0501072_0019783
936 Ga0501073_0002251
937 Ga0501074_0000448
938 Ga0501075_0001050
939 Ga0501076_0000475
940 Ga0501076_0070329
941 Ga0501077_0002163
942 Ga0501079_0000671
943 Ga0501079_0003004
944 Ga0501079_0014611
945 Ga0501079_0087777
946 Ga0501080_0002123
947 Ga0501080_0045761
948 Ga0501081_0002319
949 Ga0501081_0107944
950 Ga0501083_0015019
951 Ga0501035_0074043
952 Ga0501044_0053400
953 Ga0501045_0000167
954 Ga0501045_0042273
955 Ga0501045_0295258
956 Ga0501045_0350900
957 nmdc:mga0k408_5448_c1
958 nmdc:mga0k408_7108_c1
959 nmdc:mga06z11_74746_c1
960 nmdc:mga05p37_198104_c1
961 nmdc:mga05p37_36268_c1
962 nmdc:mga05p37_818_c1
963 nmdc:mga05p37_987057_c1
964 nmdc:mga09592_317933_c1
965 nmdc:mga09592_506_c1
966 nmdc:mga06r32_278559_c1
967 nmdc:mga06r32_351845_c1
968 nmdc:mga08y16_2876_c1
969 nmdc:mga08y16_5671_c1
970 nmdc:mga0n895_214176_c1
971 nmdc:mga0rr50_12845_c1
972 nmdc:mga0rr50_18066_c1
973 nmdc:mga08x19_134665_c1
974 nmdc:mga08x19_189142_c1
975 nmdc:mga08x19_2868_c1
976 nmdc:mga08x19_44131_c1
977 nmdc:mga08x19_66810_c1
978 nmdc:mga08x19_7175_c1
979 nmdc:mga08x19_9954_c1
980 nmdc:mga0a205_16619_c1
981 Ga0495601_0006211
982 Ga0495601_0048132
983 Ga0495595_0014571
984 Ga0495619_0006023
985 Ga0500566_0155405
986 Ga0501084_0001772
987 Ga0501084_0069144
988 Ga0501084_0233157
989 Ga0501082_0019318
990 Ga0530510_0004376

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10502

Peptidase_S26

Signal peptidase, peptidase S26

98

315

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1b12-assembly4.cif.gz_D crystal structure of type 1 signal peptidase from escherichia coli in complex with a beta-lactam inhibitor 0.6784 82 286
4n31-assembly1.cif.gz_B structure and activity of streptococcus pyogenes sipa: a signal peptidase homologue essential for pilus polymerisation 0.6743 89 274
4n31-assembly1.cif.gz_A structure and activity of streptococcus pyogenes sipa: a signal peptidase homologue essential for pilus polymerisation 0.6732 89 273
3s04-assembly3.cif.gz_A crystal structure of escherichia coli type i signal peptidase in complex with an arylomycin lipoglycopeptide antibiotic 0.6679 84 286
1t7d-assembly1.cif.gz_B crystal structure of escherichia coli type i signal peptidase in complex with a lipopeptide inhibitor 0.6599 87 286
ID Description Score Start End Superfamily
af_A0A0P0VT29_3_120_2.10.109.10 Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A 0.7471 103 286 2.10.109.10
af_A0A5K1K8B7_164_341_2.10.109.10 Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A 0.721 131 284 2.10.109.10
af_Q54RP1_162_281_2.10.109.10 Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A 0.7094 80 277 2.10.109.10
1kn9D01 Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A 0.702 86 282 2.10.109.10
af_Q54RP1_162_281_2.10.109.10 Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A 0.6937 80 277 2.10.109.10
ID Description Score Start End GO Terms
AF-A0A537A3V0-F1-model_v4 Signal peptidase I (EC 3.4.21.89) 0.9083 117 237 GO:0004252
GO:0006465
GO:0016020
AF-A0A537A3V0-F1-model_v4 Signal peptidase I (EC 3.4.21.89) 0.8944 117 237 GO:0004252
GO:0006465
GO:0016020
AF-A0A353Y9B1-F1-model_v4 Signal peptidase I (EC 3.4.21.89) 0.8933 101 286 GO:0004252
GO:0006465
GO:0016020
AF-A0A2M7C0R8-F1-model_v4 Signal peptidase I (EC 3.4.21.89) 0.8811 102 284 GO:0004252
GO:0006465
GO:0016020
AF-A0A5C7K7B0-F1-model_v4 deleted 0.8803 76 286

Map