F454643

General Info

Members Datasets Scaffolds Average Seq Length
494 251 988 271

Family's Representative Sequence

Representative Sequence 3300050511|nmdc:mga08y16_629270_c1|nmdc:mga08y16_629270_c1_72_1067
Length 331
Sequence MPMITTSTRTSSNPSTIVAMVRGNEHPDRPVQRVPVDSVRVRRQSRRHEEPMTIHDDGRERWALVLGASSGFGGAAGTAWARAGYNILGVHLDLRGTIALADAVREGIAATGVDVVFHNVNAADDEKRAGVVAAIGELFAERRAAGREPYIAAFLHSLAFGATLPYLAAQEGGKELSRKQMEMTADVMAHSLLYWVRDLFHAGLLGRGSRLFAMTSEGATLAVPTYGAVSAAKAALEAHVRQLALELMPHGITVNAIRAGVTDTPALHRIPNWEHLLAEAQRRNPGRRTTRPEDVADALVALASPLTHWMTGNIIGVDGGEVMGQRDPEGM

Samples

Sample ID Description Type Environment
1 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
2 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
69 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
133 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
134 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
135 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
136 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
137 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
138 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
139 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
140 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
141 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
142 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
143 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
144 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
145 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
146 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
147 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
148 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
149 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
150 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
151 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
152 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
153 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
154 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
155 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
156 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
157 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
158 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
159 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
160 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
161 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
162 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
163 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
164 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
165 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
166 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
167 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
169 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
170 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
171 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
172 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
173 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
174 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
175 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
176 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
177 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
178 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
179 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
180 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
181 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
182 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
183 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
184 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
185 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
186 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
187 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
188 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
189 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
190 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
191 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
192 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
193 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
194 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
195 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
196 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
197 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
198 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
199 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
200 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
201 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
202 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
203 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
204 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
205 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
206 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
207 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
208 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
220 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
221 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
222 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
223 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
224 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
225 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
226 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
227 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
228 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
229 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
230 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
231 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
232 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
233 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
234 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
235 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
236 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
237 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
238 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
239 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
240 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
241 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
242 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
243 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
244 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
245 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
246 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
247 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
248 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
249 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
250 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
251 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.8
Metatranscriptomes 0
Isolates 0.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.2
Nodule 0
Rhizoplane 8.3
Rhizosphere 91.5
Stem 0
Stem Tuber 0
Unclassified 9.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga08y16_629270_c1 3300050511 Unclassified 1079
2 JGI24033J26618_1010231 3300002155 Bacteria 1103
3 JGI25407J50210_10027546 3300003373 Eukaryota 1474
4 Ga0070676_10189178 3300005328 Unclassified 1343
5 Ga0070690_100012648 3300005330 Bacteria 4968
6 Ga0070690_100269902 3300005330 Bacteria 1210
7 Ga0070670_100089274 3300005331 Unclassified 2649
8 Ga0068869_100286600 3300005334 Bacteria 1326
9 Ga0068869_100404314 3300005334 Unclassified 1124
10 Ga0070666_10204632 3300005335 Unclassified 1389
11 Ga0070680_100000148 3300005336 Bacteria 43138
12 Ga0070680_100080770 3300005336 Bacteria 2682
13 Ga0068868_100123419 3300005338 Bacteria 2114
14 Ga0068868_100192228 3300005338 Bacteria 1698
15 Ga0068868_100404494 3300005338 Bacteria 1179
16 Ga0070687_100004577 3300005343 Bacteria 5527
17 Ga0070687_100045672 3300005343 Bacteria 2238
18 Ga0070661_100478974 3300005344 Bacteria 994
19 Ga0070692_10053548 3300005345 Bacteria 2104
20 Ga0070668_100527929 3300005347 Bacteria 1025
21 Ga0070675_100012105 3300005354 Bacteria 6764
22 Ga0070675_100077821 3300005354 Unclassified 2761
23 Ga0070675_100371971 3300005354 Bacteria 1271
24 Ga0070671_100379735 3300005355 Bacteria 1208
25 Ga0070674_100110286 3300005356 Bacteria 2019
26 Ga0070674_100157275 3300005356 Bacteria 1721
27 Ga0070673_100179095 3300005364 Bacteria 1814
28 Ga0070688_100058382 3300005365 Bacteria 2429
29 Ga0070659_100096198 3300005366 Bacteria 2378
30 Ga0070659_100302720 3300005366 Bacteria 1334
31 Ga0070659_100491836 3300005366 Bacteria 1045
32 Ga0070703_10010502 3300005406 Bacteria 2612
33 Ga0070701_10037251 3300005438 Bacteria 2454
34 Ga0070701_10250183 3300005438 Bacteria 1070
35 Ga0070705_100003654 3300005440 Bacteria 7530
36 Ga0070705_100012378 3300005440 Bacteria 4335
37 Ga0070705_100051640 3300005440 Bacteria 2399
38 Ga0070705_100113230 3300005440 Bacteria 1738
39 Ga0070705_100176082 3300005440 Bacteria 1444
40 Ga0070700_100043887 3300005441 Bacteria 2751
41 Ga0070694_100070597 3300005444 Bacteria 2405
42 Ga0070694_100240792 3300005444 Bacteria 1365
43 Ga0070708_100002635 3300005445 Bacteria 13889
44 Ga0070708_100007889 3300005445 Bacteria 8525
45 Ga0070708_100008786 3300005445 Bacteria 8124
46 Ga0070708_100057027 3300005445 Bacteria 3476
47 Ga0070708_100114093 3300005445 Unclassified 2486
48 Ga0070708_100180698 3300005445 Bacteria 1972
49 Ga0070663_100260803 3300005455 Bacteria 1375
50 Ga0070662_100049963 3300005457 Bacteria 3017
51 Ga0070662_100269414 3300005457 Bacteria 1374
52 Ga0068867_100012371 3300005459 Bacteria 6036
53 Ga0070685_10034083 3300005466 Bacteria 2865
54 Ga0070706_100000306 3300005467 Bacteria 59517
55 Ga0070706_100029564 3300005467 Bacteria 5047
56 Ga0070706_100044920 3300005467 Bacteria 4080
57 Ga0070706_100287463 3300005467 Bacteria 1534
58 Ga0070706_100372259 3300005467 Bacteria 1331
59 Ga0070707_100000496 3300005468 Bacteria 39058
60 Ga0070707_100003976 3300005468 Bacteria 13916
61 Ga0070707_100004754 3300005468 Bacteria 12714
62 Ga0070707_100018791 3300005468 Bacteria 6507
63 Ga0070707_100020173 3300005468 Bacteria 6285
64 Ga0070707_100043889 3300005468 Bacteria 4280
65 Ga0070698_100001366 3300005471 Bacteria 27170
66 Ga0070698_100012002 3300005471 Bacteria 9187
67 Ga0070698_100066484 3300005471 Bacteria 3628
68 Ga0070698_100075832 3300005471 Bacteria 3366
69 Ga0070698_100111409 3300005471 Bacteria 2702
70 Ga0070698_100193607 3300005471 Bacteria 1970
71 Ga0070698_100488682 3300005471 Bacteria 1168
72 Ga0070699_100001683 3300005518 Bacteria 20129
73 Ga0070699_100046686 3300005518 Bacteria 3747
74 Ga0070699_100054560 3300005518 Bacteria 3459
75 Ga0070699_100271625 3300005518 Unclassified 1518
76 Ga0070699_100635805 3300005518 Bacteria 974
77 Ga0070684_100020432 3300005535 Bacteria 5494
78 Ga0070684_100062439 3300005535 Bacteria 3263
79 Ga0070697_100001677 3300005536 Bacteria 16910
80 Ga0070697_100007462 3300005536 Bacteria 8513
81 Ga0070697_100158420 3300005536 Unclassified 1912
82 Ga0070697_100403841 3300005536 Unclassified 1186
83 Ga0070686_100016444 3300005544 Bacteria 4304
84 Ga0070695_100006386 3300005545 Bacteria 6967
85 Ga0070695_100007929 3300005545 Bacteria 6287
86 Ga0070695_100016811 3300005545 Bacteria 4432
87 Ga0070696_100003431 3300005546 Bacteria 10564
88 Ga0070696_100006680 3300005546 Bacteria 7706
89 Ga0070696_100010423 3300005546 Bacteria 6228
90 Ga0070696_100129075 3300005546 Bacteria 1837
91 Ga0070693_100027382 3300005547 Bacteria 3089
92 Ga0070704_100004252 3300005549 Bacteria 8274
93 Ga0070704_100020105 3300005549 Bacteria 4299
94 Ga0070704_100020849 3300005549 Bacteria 4236
95 Ga0070704_100027250 3300005549 Bacteria 3787
96 Ga0070704_100204698 3300005549 Bacteria 1595
97 Ga0070664_100237998 3300005564 Bacteria 1633
98 Ga0068857_100099702 3300005577 Bacteria 2606
99 Ga0068857_100185975 3300005577 Bacteria 1891
100 Ga0070702_100026536 3300005615 Bacteria 3113
101 Ga0068852_100014831 3300005616 Bacteria 6021
102 Ga0068859_100257509 3300005617 Bacteria 1836
103 Ga0068859_100472877 3300005617 Bacteria 1349
104 Ga0068859_100478628 3300005617 Bacteria 1341
105 Ga0068864_100003863 3300005618 Bacteria 12339
106 Ga0068864_100237494 3300005618 Bacteria 1688
107 Ga0068864_100300048 3300005618 Bacteria 1504
108 Ga0068861_100123999 3300005719 Bacteria 2088
109 Ga0068861_100773625 3300005719 Bacteria 899
110 Ga0068870_10048164 3300005840 Bacteria 2244
111 Ga0068860_100019061 3300005843 Bacteria 6662
112 Ga0068860_100023311 3300005843 Bacteria 5982
113 Ga0068862_100686621 3300005844 Bacteria 991
114 Ga0081455_10007928 3300005937 Bacteria 11111
115 Ga0081538_10001566 3300005981 Bacteria 23471
116 Ga0081538_10002340 3300005981 Bacteria 18675
117 Ga0081538_10022057 3300005981 Bacteria 4625
118 Ga0081539_10003693 3300005985 Bacteria 18283
119 Ga0081539_10007736 3300005985 Bacteria 9634
120 Ga0075365_10252411 3300006038 Bacteria 1239
121 Ga0070715_10157421 3300006163 Unclassified 1119
122 Ga0070716_100088608 3300006173 Bacteria 1867
123 Ga0070716_100223950 3300006173 Unclassified 1265
124 Ga0068871_100149954 3300006358 Bacteria 1988
125 Ga0075428_100223153 3300006844 Unclassified 2034
126 Ga0075428_100226832 3300006844 Bacteria 2016
127 Ga0075430_100038013 3300006846 Unclassified 4079
128 Ga0075431_100124873 3300006847 Bacteria 2656
129 Ga0075431_100473698 3300006847 Bacteria 1246
130 Ga0075433_10189704 3300006852 Bacteria 1829
131 Ga0075434_100039977 3300006871 Bacteria 4645
132 Ga0075434_100087546 3300006871 Bacteria 3116
133 Ga0075434_100105936 3300006871 Bacteria 2821
134 Ga0075434_100739544 3300006871 Bacteria 1001
135 Ga0068865_100016519 3300006881 Bacteria 4726
136 Ga0075436_100200992 3300006914 Unclassified 1411
137 Ga0097620_100257497 3300006931 Bacteria 1836
138 Ga0097620_100472957 3300006931 Bacteria 1349
139 Ga0097620_100478596 3300006931 Bacteria 1341
140 Ga0075435_100184363 3300007076 Bacteria 1765
141 Ga0075435_100226583 3300007076 Bacteria 1588
142 Ga0075435_100413697 3300007076 Unclassified 1161
143 Ga0099794_10102075 3300007265 Bacteria 1432
144 Ga0105251_10102157 3300009011 Bacteria 1310
145 Ga0111539_10007156 3300009094 Bacteria 14302
146 Ga0111539_10025667 3300009094 Bacteria 7221
147 Ga0111539_10578190 3300009094 Bacteria 1308
148 Ga0111539_10827278 3300009094 Bacteria 1077
149 Ga0105245_10081015 3300009098 Bacteria 2966
150 Ga0105245_10093552 3300009098 Bacteria 2770
151 Ga0105245_10448655 3300009098 Bacteria 1298
152 Ga0114129_10006341 3300009147 Bacteria 16774
153 Ga0114129_10022882 3300009147 Bacteria 8863
154 Ga0114129_10198841 3300009147 Bacteria 2716
155 Ga0114129_10304779 3300009147 Bacteria 2122
156 Ga0114129_10718579 3300009147 Bacteria 1282
157 Ga0114129_10782728 3300009147 Bacteria 1219
158 Ga0105243_10007032 3300009148 Bacteria 8657
159 Ga0105243_10257746 3300009148 Bacteria 1560
160 Ga0105243_10352090 3300009148 Bacteria 1353
161 Ga0105241_10245321 3300009174 Bacteria 1516
162 Ga0105248_10101332 3300009177 Bacteria 3246
163 Ga0105248_10174266 3300009177 Bacteria 2425
164 Ga0105248_10578439 3300009177 Unclassified 1267
165 Ga0105238_10124215 3300009551 Bacteria 2560
166 Ga0105249_10001955 3300009553 Bacteria 17870
167 Ga0105249_10052028 3300009553 Bacteria 3739
168 Ga0105249_10574154 3300009553 Bacteria 1180
169 Ga0105239_10020160 3300010375 Bacteria 7355
170 Ga0105239_11110251 3300010375 Bacteria 910
171 Ga0157374_10376572 3300013296 Bacteria 1413
172 Ga0157374_10523013 3300013296 Bacteria 1192
173 Ga0157378_10013779 3300013297 Bacteria 7072
174 Ga0157378_10614399 3300013297 Bacteria 1099
175 Ga0157375_10006623 3300013308 Bacteria 10081
176 Ga0157375_10176594 3300013308 Bacteria 2286
177 Ga0157375_10262039 3300013308 Bacteria 1890
178 Ga0157375_10558673 3300013308 Bacteria 1306
179 Ga0163163_10197383 3300014325 Bacteria 2060
180 Ga0157380_10063035 3300014326 Bacteria 2971
181 Ga0157380_10095126 3300014326 Bacteria 2467
182 Ga0157377_10061793 3300014745 Bacteria 2142
183 Ga0157377_10170886 3300014745 Bacteria 1359
184 Ga0157379_10014331 3300014968 Bacteria 6956
185 Ga0157379_10047119 3300014968 Bacteria 3845
186 Ga0157376_10528228 3300014969 Bacteria 1164
187 Ga0163161_10267405 3300017792 Bacteria 1337
188 Ga0163161_10302256 3300017792 Bacteria 1260
189 Ga0207710_10086334 3300025900 Bacteria 1462
190 Ga0207688_10021384 3300025901 Bacteria 3535
191 Ga0207688_10070134 3300025901 Bacteria 1987
192 Ga0207680_10314292 3300025903 Unclassified 1094
193 Ga0207645_10194976 3300025907 Bacteria 1332
194 Ga0207645_10278278 3300025907 Bacteria 1111
195 Ga0207643_10002791 3300025908 Bacteria 9429
196 Ga0207684_10000418 3300025910 Bacteria 56722
197 Ga0207684_10030717 3300025910 Bacteria 4572
198 Ga0207684_10047991 3300025910 Bacteria 3622
199 Ga0207684_10071219 3300025910 Bacteria 2954
200 Ga0207684_10188969 3300025910 Bacteria 1776
201 Ga0207684_10289470 3300025910 Bacteria 1412
202 Ga0207654_10303242 3300025911 Unclassified 1087
203 Ga0207660_10000003 3300025917 Bacteria 675759
204 Ga0207662_10009673 3300025918 Bacteria 5314
205 Ga0207662_10011216 3300025918 Bacteria 4963
206 Ga0207662_10403085 3300025918 Bacteria 928
207 Ga0207646_10000431 3300025922 Bacteria 55919
208 Ga0207646_10008862 3300025922 Bacteria 10021
209 Ga0207646_10019139 3300025922 Bacteria 6366
210 Ga0207646_10075511 3300025922 Unclassified 3011
211 Ga0207646_10080900 3300025922 Bacteria 2905
212 Ga0207646_10131318 3300025922 Bacteria 2254
213 Ga0207681_10218309 3300025923 Bacteria 1474
214 Ga0207694_10456876 3300025924 Unclassified 1067
215 Ga0207650_10049055 3300025925 Unclassified 3116
216 Ga0207659_10158463 3300025926 Bacteria 1774
217 Ga0207687_10055842 3300025927 Bacteria 2768
218 Ga0207687_10106128 3300025927 Bacteria 2076
219 Ga0207687_10130074 3300025927 Bacteria 1896
220 Ga0207690_10082756 3300025932 Bacteria 2245
221 Ga0207706_10017229 3300025933 Bacteria 6513
222 Ga0207706_10119979 3300025933 Bacteria 2312
223 Ga0207706_10620517 3300025933 Bacteria 928
224 Ga0207686_10235116 3300025934 Bacteria 1331
225 Ga0207709_10171314 3300025935 Bacteria 1524
226 Ga0207669_10009422 3300025937 Bacteria 4650
227 Ga0207669_10195281 3300025937 Bacteria 1464
228 Ga0207704_10065316 3300025938 Bacteria 2277
229 Ga0207711_10071113 3300025941 Bacteria 3018
230 Ga0207689_10143515 3300025942 Bacteria 1967
231 Ga0207689_10277623 3300025942 Bacteria 1387
232 Ga0207689_10367095 3300025942 Bacteria 1197
233 Ga0207689_10427941 3300025942 Unclassified 1105
234 Ga0207667_10859012 3300025949 Bacteria 901
235 Ga0207651_10166155 3300025960 Bacteria 1735
236 Ga0207668_10123875 3300025972 Bacteria 1962
237 Ga0207668_10127070 3300025972 Bacteria 1941
238 Ga0207668_10263272 3300025972 Bacteria 1406
239 Ga0207640_10055223 3300025981 Bacteria 2601
240 Ga0207640_10394455 3300025981 Unclassified 1125
241 Ga0207658_10249378 3300025986 Bacteria 1508
242 Ga0207703_10172387 3300026035 Bacteria 1904
243 Ga0207703_10531160 3300026035 Unclassified 1107
244 Ga0207678_10157579 3300026067 Bacteria 1939
245 Ga0207648_10001311 3300026089 Bacteria 27670
246 Ga0207648_10045066 3300026089 Bacteria 3870
247 Ga0207676_10200533 3300026095 Bacteria 1763
248 Ga0207676_10482521 3300026095 Unclassified 1174
249 Ga0207674_10120748 3300026116 Bacteria 2588
250 Ga0207675_100340366 3300026118 Bacteria 1468
251 Ga0207675_100437778 3300026118 Bacteria 1294
252 Ga0207683_10013506 3300026121 Bacteria 6968
253 Ga0207698_10351693 3300026142 Bacteria 1392
254 Ga0209996_1011572 3300027395 Bacteria 1179
255 Ga0209999_1006930 3300027543 Bacteria 2038
256 Ga0209983_1002106 3300027665 Bacteria 4385
257 Ga0209998_10014708 3300027717 Bacteria 1635
258 Ga0209974_10007128 3300027876 Bacteria 3863
259 Ga0207428_10036096 3300027907 Bacteria 4035
260 Ga0207428_10061966 3300027907 Bacteria 2959
261 Ga0268265_10289088 3300028380 Unclassified 1471
262 Ga0268264_10314768 3300028381 Bacteria 1478
263 Ga0265337_1051307 3300028556 Bacteria 1161
264 Ga0265319_1001929 3300028563 Bacteria 11762
265 Ga0265319_1003466 3300028563 Bacteria 8211
266 Ga0265319_1023311 3300028563 Bacteria 2244
267 Ga0265334_10001880 3300028573 Bacteria 9969
268 Ga0265318_10075479 3300028577 Bacteria 1247
269 Ga0265336_10008525 3300028666 Bacteria 3593
270 Ga0265336_10041973 3300028666 Bacteria 1397
271 Ga0265338_10042571 3300028800 Bacteria 4227
272 Ga0265324_10002287 3300029957 Bacteria 9969
273 Ga0265332_10008311 3300031238 Bacteria 4664
274 Ga0265332_10047915 3300031238 Bacteria 1839
275 Ga0265328_10013301 3300031239 Bacteria 3261
276 Ga0265320_10009676 3300031240 Bacteria 5793
277 Ga0265320_10019980 3300031240 Bacteria 3644
278 Ga0265325_10021649 3300031241 Bacteria 3529
279 Ga0265325_10026369 3300031241 Bacteria 3148
280 Ga0265329_10014833 3300031242 Bacteria 2741
281 Ga0265340_10001048 3300031247 Bacteria 15758
282 Ga0265339_10008515 3300031249 Bacteria 6521
283 Ga0265339_10045536 3300031249 Bacteria 2414
284 Ga0265339_10108222 3300031249 Bacteria 1441
285 Ga0265331_10026927 3300031250 Bacteria 2887
286 Ga0265316_10030797 3300031344 Bacteria 4393
287 Ga0307408_100101603 3300031548 Bacteria 2192
288 Ga0265314_10001669 3300031711 Bacteria 24176
289 Ga0265314_10009440 3300031711 Bacteria 8228
290 Ga0265342_10031294 3300031712 Bacteria 3291
291 Ga0265342_10036347 3300031712 Bacteria 3010
292 Ga0307405_10071552 3300031731 Bacteria 2232
293 Ga0307410_10323102 3300031852 Bacteria 1225
294 Ga0307416_100033887 3300032002 Bacteria 3879
295 Ga0307416_100679215 3300032002 Bacteria 1117
296 Ga0307416_100760947 3300032002 Unclassified 1062
297 Ga0307416_101140254 3300032002 Unclassified 885
298 Ga0307411_10119317 3300032005 Bacteria 1905
299 Ga0307411_10137624 3300032005 Bacteria 1796
300 Ga0307415_100506179 3300032126 Bacteria 1057
301 Ga0316583_10005309 3300032133 Bacteria 4622
302 Ga0373934_0042213 3300035086 Bacteria 1801
303 Ga0373934_0044468 3300035086 Unclassified 1756
304 Ga0373923_0005625 3300035111 Bacteria 4268
305 Ga0373954_0014592 3300035118 Bacteria 3503
306 Ga0373956_0009347 3300035119 Bacteria 3986
307 Ga0373957_0046041 3300035120 Bacteria 1655
308 Ga0373943_0223936 3300035170 Bacteria 1048
309 Ga0373955_0026150 3300035172 Bacteria 3003
310 Ga0373955_0313639 3300035172 Bacteria 947
311 Ga0373931_0250666 3300035691 Unclassified 1076
312 Ga0373927_0067967 3300035695 Unclassified 2305
313 Ga0373933_0025548 3300035724 Bacteria 3388
314 Ga0373937_0000755 3300036401 Bacteria 27949
315 Ga0373937_0141487 3300036401 Unclassified 2251
316 Ga0373937_0276715 3300036401 Unclassified 1585
317 Ga0373925_0013375 3300037068 Bacteria 5938
318 Ga0373925_0452316 3300037068 Bacteria 1052
319 Ga0450920_006751 3300042122 Bacteria 2068
320 Ga0450910_007155 3300042147 Bacteria 1552
321 Ga0439434_0035071 3300042435 Unclassified 1533
322 Ga0451577_0009326 3300042876 Bacteria 9460
323 Ga0451577_0081655 3300042876 Bacteria 2883
324 Ga0451577_0228628 3300042876 Bacteria 1682
325 Ga0451577_0292506 3300042876 Unclassified 1476
326 Ga0453683_0308086 3300044673 Bacteria 1013
327 Ga0453684_0020377 3300044712 Bacteria 10007
328 Ga0453684_0219209 3300044712 Bacteria 2205
329 Ga0453684_0394588 3300044712 Bacteria 1551
330 Ga0453684_1015946 3300044712 Bacteria 881
331 Ga0466960_0391688 3300044901 Bacteria 799
332 Ga0451576_0087439 3300045051 Bacteria 3242
333 Ga0451576_0135146 3300045051 Bacteria 2571
334 Ga0451576_0162073 3300045051 Bacteria 2334
335 Ga0451576_0432093 3300045051 Unclassified 1382
336 Ga0451576_0957671 3300045051 Bacteria 897
337 Ga0495592_0063331 3300046454 Bacteria 2713
338 Ga0495651_0027955 3300046462 Bacteria 4396
339 Ga0495582_0112336 3300046473 Bacteria 1531
340 Ga0495628_0027121 3300046516 Bacteria 4663
341 Ga0495640_0076033 3300046533 Bacteria 2241
342 Ga0495640_0213321 3300046533 Bacteria 1220
343 Ga0495587_0070030 3300046536 Bacteria 2042
344 Ga0495587_0116504 3300046536 Bacteria 1532
345 Ga0495645_0066167 3300046543 Bacteria 2613
346 Ga0495634_0208953 3300046642 Unclassified 1209
347 Ga0495635_0117059 3300046663 Bacteria 1819
348 Ga0495588_0172970 3300046674 Bacteria 1142
349 Ga0495657_0055583 3300046675 Bacteria 2640
350 Ga0495599_0220770 3300046678 Bacteria 1160
351 Ga0495613_0181221 3300046689 Bacteria 1492
352 Ga0495624_0278239 3300046690 Bacteria 1011
353 Ga0495674_0137015 3300047319 Bacteria 2059
354 Ga0495674_0161874 3300047319 Unclassified 1872
355 Ga0495680_0156711 3300047322 Bacteria 1656
356 Ga0496100_0016369 3300048903 Bacteria 4354
357 Ga0496101_0014295 3300048904 Bacteria 5331
358 Ga0496102_0003345 3300048905 Bacteria 13591
359 Ga0496102_0076656 3300048905 Bacteria 3076
360 Ga0496102_0150616 3300048905 Bacteria 2186
361 Ga0496102_0231571 3300048905 Bacteria 1742
362 Ga0496102_0453034 3300048905 Bacteria 1204
363 Ga0496103_0005778 3300048906 Bacteria 7387
364 Ga0496103_0138162 3300048906 Bacteria 1558
365 Ga0496104_0009664 3300048907 Bacteria 8591
366 Ga0496104_0043907 3300048907 Bacteria 4199
367 Ga0496105_0003379 3300048908 Bacteria 11798
368 Ga0496105_0015476 3300048908 Bacteria 6081
369 Ga0496105_0102325 3300048908 Bacteria 2365
370 Ga0496106_0018232 3300048909 Bacteria 5190
371 Ga0496106_0528897 3300048909 Bacteria 947
372 Ga0496107_0009972 3300048910 Bacteria 6591
373 Ga0496107_0073752 3300048910 Bacteria 2483
374 Ga0496108_0004151 3300048911 Bacteria 11652
375 Ga0496108_0010848 3300048911 Bacteria 7396
376 Ga0496108_0341107 3300048911 Bacteria 1307
377 Ga0496108_0362441 3300048911 Bacteria 1265
378 Ga0496109_0035391 3300048912 Bacteria 4504
379 Ga0496109_0098820 3300048912 Bacteria 2706
380 Ga0496109_0227252 3300048912 Bacteria 1755
381 Ga0496110_0004043 3300048913 Bacteria 11316
382 Ga0496110_0036769 3300048913 Bacteria 4253
383 Ga0496110_0127995 3300048913 Bacteria 2292
384 Ga0496111_0038830 3300048914 Bacteria 3412
385 Ga0496111_0044017 3300048914 Bacteria 3209
386 Ga0496111_0083557 3300048914 Bacteria 2333
387 Ga0496111_0129100 3300048914 Bacteria 1870
388 Ga0496112_0000001 3300048915 Bacteria 1346031
389 Ga0496112_0065191 3300048915 Bacteria 3594
390 Ga0496112_0150908 3300048915 Bacteria 2291
391 Ga0496112_0245303 3300048915 Bacteria 1743
392 Ga0496113_0073713 3300048916 Bacteria 2601
393 Ga0496113_0090309 3300048916 Bacteria 2359
394 Ga0496113_0319718 3300048916 Bacteria 1244
395 Ga0496114_0052716 3300048917 Bacteria 3389
396 Ga0496114_0405837 3300048917 Bacteria 1207
397 Ga0501031_0023754 3300049568 Bacteria 3996
398 Ga0501031_0172752 3300049568 Bacteria 1412
399 Ga0501032_0096523 3300049569 Bacteria 1959
400 Ga0501036_0134895 3300049572 Bacteria 2083
401 Ga0501037_0097578 3300049573 Bacteria 2123
402 Ga0501037_0216846 3300049573 Bacteria 1348
403 Ga0501038_0174072 3300049574 Bacteria 1740
404 Ga0501038_0477792 3300049574 Bacteria 955
405 Ga0501039_0061014 3300049575 Bacteria 2920
406 Ga0501039_0075148 3300049575 Bacteria 2626
407 Ga0501040_0015978 3300049576 Bacteria 4964
408 Ga0501040_0059375 3300049576 Bacteria 2627
409 Ga0501040_0241286 3300049576 Bacteria 1288
410 Ga0501041_0048288 3300049577 Bacteria 2592
411 Ga0501042_0045786 3300049578 Bacteria 3119
412 Ga0501042_0083224 3300049578 Unclassified 2294
413 Ga0501043_0327064 3300049579 Bacteria 1168
414 Ga0501046_0134302 3300049580 Bacteria 1875
415 Ga0501067_0023151 3300049583 Bacteria 3441
416 Ga0501067_0086113 3300049583 Unclassified 1744
417 Ga0501067_0144715 3300049583 Bacteria 1324
418 Ga0501068_0048074 3300049584 Bacteria 2575
419 Ga0501068_0119639 3300049584 Bacteria 1641
420 Ga0501068_0126842 3300049584 Bacteria 1594
421 Ga0501069_0041514 3300049585 Bacteria 2543
422 Ga0501069_0065923 3300049585 Bacteria 2025
423 Ga0501069_0148146 3300049585 Unclassified 1348
424 Ga0501070_0061048 3300049586 Bacteria 3124
425 Ga0501070_0086081 3300049586 Bacteria 2602
426 Ga0501070_0309919 3300049586 Bacteria 1285
427 Ga0501070_0536282 3300049586 Unclassified 938
428 Ga0501071_0035783 3300049587 Bacteria 3538
429 Ga0501071_0125247 3300049587 Bacteria 1906
430 Ga0501071_0192318 3300049587 Bacteria 1531
431 Ga0501072_0005089 3300049588 Bacteria 10008
432 Ga0501072_0076637 3300049588 Bacteria 2645
433 Ga0501072_0152043 3300049588 Bacteria 1845
434 Ga0501073_0181789 3300049589 Bacteria 1455
435 Ga0501073_0246042 3300049589 Bacteria 1235
436 Ga0501074_0137084 3300049590 Bacteria 1750
437 Ga0501075_0066130 3300049591 Bacteria 2728
438 Ga0501075_0101108 3300049591 Bacteria 2189
439 Ga0501075_0226500 3300049591 Unclassified 1426
440 Ga0501075_0289850 3300049591 Bacteria 1247
441 Ga0501075_0341105 3300049591 Bacteria 1142
442 Ga0501075_0390382 3300049591 Bacteria 1061
443 Ga0501076_0006192 3300049592 Bacteria 8658
444 Ga0501076_0065615 3300049592 Bacteria 2895
445 Ga0501076_0118725 3300049592 Bacteria 2141
446 Ga0501077_0050028 3300049593 Bacteria 2656
447 Ga0501080_0063353 3300049742 Bacteria 3441
448 Ga0501080_0143307 3300049742 Bacteria 2209
449 Ga0501080_0377716 3300049742 Unclassified 1277
450 Ga0501080_0649952 3300049742 Bacteria 933
451 Ga0501081_0085756 3300049743 Bacteria 2210
452 Ga0501083_0063208 3300049744 Bacteria 2469
453 Ga0501045_0003342 3300049824 Bacteria 10977
454 Ga0501045_0021459 3300049824 Bacteria 4619
455 Ga0501045_0124448 3300049824 Bacteria 1915
456 nmdc:mga05p37_286_c1 3300050507 Bacteria 52761
457 nmdc:mga05p37_37686_c1 3300050507 Bacteria 5930
458 nmdc:mga05p37_535142_c1 3300050507 Unclassified 1337
459 nmdc:mga05p37_97155_c1 3300050507 Bacteria 3628
460 nmdc:mga0qj67_12826_c1 3300050509 Bacteria 6321
461 nmdc:mga06r32_111617_c1 3300050510 Bacteria 2690
462 nmdc:mga06r32_208343_c1 3300050510 Bacteria 1943
463 nmdc:mga08y16_12638_c1 3300050511 Bacteria 8881
464 nmdc:mga0n895_117502_c1 3300050512 Bacteria 2679
465 nmdc:mga0n895_373527_c1 3300050512 Bacteria 1443
466 nmdc:mga0n895_45557_c1 3300050512 Bacteria 4280
467 nmdc:mga0n895_835463_c1 3300050512 Bacteria 910
468 nmdc:mga0rr50_164048_c1 3300050513 Bacteria 1805
469 nmdc:mga08x19_28660_c1 3300050514 Bacteria 3489
470 nmdc:mga0a205_165281_c1 3300050515 Bacteria 2108
471 nmdc:mga0a205_38996_c1 3300050515 Bacteria 4571
472 Ga0495601_0018098 3300053077 Bacteria 4284
473 Ga0495612_0000600 3300053078 Bacteria 14469
474 Ga0495595_0001266 3300053084 Bacteria 9840
475 Ga0495595_0081036 3300053084 Bacteria 1546
476 Ga0495619_0046618 3300053085 Bacteria 2850
477 Ga0495619_0054999 3300053085 Bacteria 2635
478 Ga0495619_0126631 3300053085 Bacteria 1753
479 Ga0495619_0375680 3300053085 Bacteria 982
480 Ga0501084_0033334 3300054114 Bacteria 4309
481 Ga0501084_0150192 3300054114 Bacteria 1963
482 Ga0501084_0357267 3300054114 Bacteria 1234
483 Ga0501084_0548511 3300054114 Bacteria 977
484 Ga0501084_0607812 3300054114 Unclassified 924
485 Ga0590071_001312 3300059421 Bacteria 6632
486 Ga0590075_025869 3300059424 Bacteria 1476
487 Ga0590077_019798 3300059426 Bacteria 1427
488 Ga0501082_0048252 3300060353 Bacteria 3670
489 Ga0501082_0306481 3300060353 Bacteria 1383
490 Ga0530510_0017188 3300061734 Bacteria 5124
491 Ga0530510_0056658 3300061734 Bacteria 2831
492 Ga0530510_0101328 3300061734 Bacteria 2106
493 Ga0530510_0103247 3300061734 Bacteria 2085
494 3006499218 3006493962 Bacteria 8825450
495 nmdc:mga08y16_629270_c1
496 JGI24033J26618_1010231
497 JGI25407J50210_10027546
498 Ga0070676_10189178
499 Ga0070690_100012648
500 Ga0070690_100269902
501 Ga0070670_100089274
502 Ga0068869_100286600
503 Ga0068869_100404314
504 Ga0070666_10204632
505 Ga0070680_100000148
506 Ga0070680_100080770
507 Ga0068868_100123419
508 Ga0068868_100192228
509 Ga0068868_100404494
510 Ga0070687_100004577
511 Ga0070687_100045672
512 Ga0070661_100478974
513 Ga0070692_10053548
514 Ga0070668_100527929
515 Ga0070675_100012105
516 Ga0070675_100077821
517 Ga0070675_100371971
518 Ga0070671_100379735
519 Ga0070674_100110286
520 Ga0070674_100157275
521 Ga0070673_100179095
522 Ga0070688_100058382
523 Ga0070659_100096198
524 Ga0070659_100302720
525 Ga0070659_100491836
526 Ga0070703_10010502
527 Ga0070701_10037251
528 Ga0070701_10250183
529 Ga0070705_100003654
530 Ga0070705_100012378
531 Ga0070705_100051640
532 Ga0070705_100113230
533 Ga0070705_100176082
534 Ga0070700_100043887
535 Ga0070694_100070597
536 Ga0070694_100240792
537 Ga0070708_100002635
538 Ga0070708_100007889
539 Ga0070708_100008786
540 Ga0070708_100057027
541 Ga0070708_100114093
542 Ga0070708_100180698
543 Ga0070663_100260803
544 Ga0070662_100049963
545 Ga0070662_100269414
546 Ga0068867_100012371
547 Ga0070685_10034083
548 Ga0070706_100000306
549 Ga0070706_100029564
550 Ga0070706_100044920
551 Ga0070706_100287463
552 Ga0070706_100372259
553 Ga0070707_100000496
554 Ga0070707_100003976
555 Ga0070707_100004754
556 Ga0070707_100018791
557 Ga0070707_100020173
558 Ga0070707_100043889
559 Ga0070698_100001366
560 Ga0070698_100012002
561 Ga0070698_100066484
562 Ga0070698_100075832
563 Ga0070698_100111409
564 Ga0070698_100193607
565 Ga0070698_100488682
566 Ga0070699_100001683
567 Ga0070699_100046686
568 Ga0070699_100054560
569 Ga0070699_100271625
570 Ga0070699_100635805
571 Ga0070684_100020432
572 Ga0070684_100062439
573 Ga0070697_100001677
574 Ga0070697_100007462
575 Ga0070697_100158420
576 Ga0070697_100403841
577 Ga0070686_100016444
578 Ga0070695_100006386
579 Ga0070695_100007929
580 Ga0070695_100016811
581 Ga0070696_100003431
582 Ga0070696_100006680
583 Ga0070696_100010423
584 Ga0070696_100129075
585 Ga0070693_100027382
586 Ga0070704_100004252
587 Ga0070704_100020105
588 Ga0070704_100020849
589 Ga0070704_100027250
590 Ga0070704_100204698
591 Ga0070664_100237998
592 Ga0068857_100099702
593 Ga0068857_100185975
594 Ga0070702_100026536
595 Ga0068852_100014831
596 Ga0068859_100257509
597 Ga0068859_100472877
598 Ga0068859_100478628
599 Ga0068864_100003863
600 Ga0068864_100237494
601 Ga0068864_100300048
602 Ga0068861_100123999
603 Ga0068861_100773625
604 Ga0068870_10048164
605 Ga0068860_100019061
606 Ga0068860_100023311
607 Ga0068862_100686621
608 Ga0081455_10007928
609 Ga0081538_10001566
610 Ga0081538_10002340
611 Ga0081538_10022057
612 Ga0081539_10003693
613 Ga0081539_10007736
614 Ga0075365_10252411
615 Ga0070715_10157421
616 Ga0070716_100088608
617 Ga0070716_100223950
618 Ga0068871_100149954
619 Ga0075428_100223153
620 Ga0075428_100226832
621 Ga0075430_100038013
622 Ga0075431_100124873
623 Ga0075431_100473698
624 Ga0075433_10189704
625 Ga0075434_100039977
626 Ga0075434_100087546
627 Ga0075434_100105936
628 Ga0075434_100739544
629 Ga0068865_100016519
630 Ga0075436_100200992
631 Ga0097620_100257497
632 Ga0097620_100472957
633 Ga0097620_100478596
634 Ga0075435_100184363
635 Ga0075435_100226583
636 Ga0075435_100413697
637 Ga0099794_10102075
638 Ga0105251_10102157
639 Ga0111539_10007156
640 Ga0111539_10025667
641 Ga0111539_10578190
642 Ga0111539_10827278
643 Ga0105245_10081015
644 Ga0105245_10093552
645 Ga0105245_10448655
646 Ga0114129_10006341
647 Ga0114129_10022882
648 Ga0114129_10198841
649 Ga0114129_10304779
650 Ga0114129_10718579
651 Ga0114129_10782728
652 Ga0105243_10007032
653 Ga0105243_10257746
654 Ga0105243_10352090
655 Ga0105241_10245321
656 Ga0105248_10101332
657 Ga0105248_10174266
658 Ga0105248_10578439
659 Ga0105238_10124215
660 Ga0105249_10001955
661 Ga0105249_10052028
662 Ga0105249_10574154
663 Ga0105239_10020160
664 Ga0105239_11110251
665 Ga0157374_10376572
666 Ga0157374_10523013
667 Ga0157378_10013779
668 Ga0157378_10614399
669 Ga0157375_10006623
670 Ga0157375_10176594
671 Ga0157375_10262039
672 Ga0157375_10558673
673 Ga0163163_10197383
674 Ga0157380_10063035
675 Ga0157380_10095126
676 Ga0157377_10061793
677 Ga0157377_10170886
678 Ga0157379_10014331
679 Ga0157379_10047119
680 Ga0157376_10528228
681 Ga0163161_10267405
682 Ga0163161_10302256
683 Ga0207710_10086334
684 Ga0207688_10021384
685 Ga0207688_10070134
686 Ga0207680_10314292
687 Ga0207645_10194976
688 Ga0207645_10278278
689 Ga0207643_10002791
690 Ga0207684_10000418
691 Ga0207684_10030717
692 Ga0207684_10047991
693 Ga0207684_10071219
694 Ga0207684_10188969
695 Ga0207684_10289470
696 Ga0207654_10303242
697 Ga0207660_10000003
698 Ga0207662_10009673
699 Ga0207662_10011216
700 Ga0207662_10403085
701 Ga0207646_10000431
702 Ga0207646_10008862
703 Ga0207646_10019139
704 Ga0207646_10075511
705 Ga0207646_10080900
706 Ga0207646_10131318
707 Ga0207681_10218309
708 Ga0207694_10456876
709 Ga0207650_10049055
710 Ga0207659_10158463
711 Ga0207687_10055842
712 Ga0207687_10106128
713 Ga0207687_10130074
714 Ga0207690_10082756
715 Ga0207706_10017229
716 Ga0207706_10119979
717 Ga0207706_10620517
718 Ga0207686_10235116
719 Ga0207709_10171314
720 Ga0207669_10009422
721 Ga0207669_10195281
722 Ga0207704_10065316
723 Ga0207711_10071113
724 Ga0207689_10143515
725 Ga0207689_10277623
726 Ga0207689_10367095
727 Ga0207689_10427941
728 Ga0207667_10859012
729 Ga0207651_10166155
730 Ga0207668_10123875
731 Ga0207668_10127070
732 Ga0207668_10263272
733 Ga0207640_10055223
734 Ga0207640_10394455
735 Ga0207658_10249378
736 Ga0207703_10172387
737 Ga0207703_10531160
738 Ga0207678_10157579
739 Ga0207648_10001311
740 Ga0207648_10045066
741 Ga0207676_10200533
742 Ga0207676_10482521
743 Ga0207674_10120748
744 Ga0207675_100340366
745 Ga0207675_100437778
746 Ga0207683_10013506
747 Ga0207698_10351693
748 Ga0209996_1011572
749 Ga0209999_1006930
750 Ga0209983_1002106
751 Ga0209998_10014708
752 Ga0209974_10007128
753 Ga0207428_10036096
754 Ga0207428_10061966
755 Ga0268265_10289088
756 Ga0268264_10314768
757 Ga0265337_1051307
758 Ga0265319_1001929
759 Ga0265319_1003466
760 Ga0265319_1023311
761 Ga0265334_10001880
762 Ga0265318_10075479
763 Ga0265336_10008525
764 Ga0265336_10041973
765 Ga0265338_10042571
766 Ga0265324_10002287
767 Ga0265332_10008311
768 Ga0265332_10047915
769 Ga0265328_10013301
770 Ga0265320_10009676
771 Ga0265320_10019980
772 Ga0265325_10021649
773 Ga0265325_10026369
774 Ga0265329_10014833
775 Ga0265340_10001048
776 Ga0265339_10008515
777 Ga0265339_10045536
778 Ga0265339_10108222
779 Ga0265331_10026927
780 Ga0265316_10030797
781 Ga0307408_100101603
782 Ga0265314_10001669
783 Ga0265314_10009440
784 Ga0265342_10031294
785 Ga0265342_10036347
786 Ga0307405_10071552
787 Ga0307410_10323102
788 Ga0307416_100033887
789 Ga0307416_100679215
790 Ga0307416_100760947
791 Ga0307416_101140254
792 Ga0307411_10119317
793 Ga0307411_10137624
794 Ga0307415_100506179
795 Ga0316583_10005309
796 Ga0373934_0042213
797 Ga0373934_0044468
798 Ga0373923_0005625
799 Ga0373954_0014592
800 Ga0373956_0009347
801 Ga0373957_0046041
802 Ga0373943_0223936
803 Ga0373955_0026150
804 Ga0373955_0313639
805 Ga0373931_0250666
806 Ga0373927_0067967
807 Ga0373933_0025548
808 Ga0373937_0000755
809 Ga0373937_0141487
810 Ga0373937_0276715
811 Ga0373925_0013375
812 Ga0373925_0452316
813 Ga0450920_006751
814 Ga0450910_007155
815 Ga0439434_0035071
816 Ga0451577_0009326
817 Ga0451577_0081655
818 Ga0451577_0228628
819 Ga0451577_0292506
820 Ga0453683_0308086
821 Ga0453684_0020377
822 Ga0453684_0219209
823 Ga0453684_0394588
824 Ga0453684_1015946
825 Ga0466960_0391688
826 Ga0451576_0087439
827 Ga0451576_0135146
828 Ga0451576_0162073
829 Ga0451576_0432093
830 Ga0451576_0957671
831 Ga0495592_0063331
832 Ga0495651_0027955
833 Ga0495582_0112336
834 Ga0495628_0027121
835 Ga0495640_0076033
836 Ga0495640_0213321
837 Ga0495587_0070030
838 Ga0495587_0116504
839 Ga0495645_0066167
840 Ga0495634_0208953
841 Ga0495635_0117059
842 Ga0495588_0172970
843 Ga0495657_0055583
844 Ga0495599_0220770
845 Ga0495613_0181221
846 Ga0495624_0278239
847 Ga0495674_0137015
848 Ga0495674_0161874
849 Ga0495680_0156711
850 Ga0496100_0016369
851 Ga0496101_0014295
852 Ga0496102_0003345
853 Ga0496102_0076656
854 Ga0496102_0150616
855 Ga0496102_0231571
856 Ga0496102_0453034
857 Ga0496103_0005778
858 Ga0496103_0138162
859 Ga0496104_0009664
860 Ga0496104_0043907
861 Ga0496105_0003379
862 Ga0496105_0015476
863 Ga0496105_0102325
864 Ga0496106_0018232
865 Ga0496106_0528897
866 Ga0496107_0009972
867 Ga0496107_0073752
868 Ga0496108_0004151
869 Ga0496108_0010848
870 Ga0496108_0341107
871 Ga0496108_0362441
872 Ga0496109_0035391
873 Ga0496109_0098820
874 Ga0496109_0227252
875 Ga0496110_0004043
876 Ga0496110_0036769
877 Ga0496110_0127995
878 Ga0496111_0038830
879 Ga0496111_0044017
880 Ga0496111_0083557
881 Ga0496111_0129100
882 Ga0496112_0000001
883 Ga0496112_0065191
884 Ga0496112_0150908
885 Ga0496112_0245303
886 Ga0496113_0073713
887 Ga0496113_0090309
888 Ga0496113_0319718
889 Ga0496114_0052716
890 Ga0496114_0405837
891 Ga0501031_0023754
892 Ga0501031_0172752
893 Ga0501032_0096523
894 Ga0501036_0134895
895 Ga0501037_0097578
896 Ga0501037_0216846
897 Ga0501038_0174072
898 Ga0501038_0477792
899 Ga0501039_0061014
900 Ga0501039_0075148
901 Ga0501040_0015978
902 Ga0501040_0059375
903 Ga0501040_0241286
904 Ga0501041_0048288
905 Ga0501042_0045786
906 Ga0501042_0083224
907 Ga0501043_0327064
908 Ga0501046_0134302
909 Ga0501067_0023151
910 Ga0501067_0086113
911 Ga0501067_0144715
912 Ga0501068_0048074
913 Ga0501068_0119639
914 Ga0501068_0126842
915 Ga0501069_0041514
916 Ga0501069_0065923
917 Ga0501069_0148146
918 Ga0501070_0061048
919 Ga0501070_0086081
920 Ga0501070_0309919
921 Ga0501070_0536282
922 Ga0501071_0035783
923 Ga0501071_0125247
924 Ga0501071_0192318
925 Ga0501072_0005089
926 Ga0501072_0076637
927 Ga0501072_0152043
928 Ga0501073_0181789
929 Ga0501073_0246042
930 Ga0501074_0137084
931 Ga0501075_0066130
932 Ga0501075_0101108
933 Ga0501075_0226500
934 Ga0501075_0289850
935 Ga0501075_0341105
936 Ga0501075_0390382
937 Ga0501076_0006192
938 Ga0501076_0065615
939 Ga0501076_0118725
940 Ga0501077_0050028
941 Ga0501080_0063353
942 Ga0501080_0143307
943 Ga0501080_0377716
944 Ga0501080_0649952
945 Ga0501081_0085756
946 Ga0501083_0063208
947 Ga0501045_0003342
948 Ga0501045_0021459
949 Ga0501045_0124448
950 nmdc:mga05p37_286_c1
951 nmdc:mga05p37_37686_c1
952 nmdc:mga05p37_535142_c1
953 nmdc:mga05p37_97155_c1
954 nmdc:mga0qj67_12826_c1
955 nmdc:mga06r32_111617_c1
956 nmdc:mga06r32_208343_c1
957 nmdc:mga08y16_12638_c1
958 nmdc:mga0n895_117502_c1
959 nmdc:mga0n895_373527_c1
960 nmdc:mga0n895_45557_c1
961 nmdc:mga0n895_835463_c1
962 nmdc:mga0rr50_164048_c1
963 nmdc:mga08x19_28660_c1
964 nmdc:mga0a205_165281_c1
965 nmdc:mga0a205_38996_c1
966 Ga0495601_0018098
967 Ga0495612_0000600
968 Ga0495595_0001266
969 Ga0495595_0081036
970 Ga0495619_0046618
971 Ga0495619_0054999
972 Ga0495619_0126631
973 Ga0495619_0375680
974 Ga0501084_0033334
975 Ga0501084_0150192
976 Ga0501084_0357267
977 Ga0501084_0548511
978 Ga0501084_0607812
979 Ga0590071_001312
980 Ga0590075_025869
981 Ga0590077_019798
982 Ga0501082_0048252
983 Ga0501082_0306481
984 Ga0530510_0017188
985 Ga0530510_0056658
986 Ga0530510_0101328
987 Ga0530510_0103247
988 3006499218

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

67

321

0.92

PF00106

adh_short

short chain dehydrogenase

61

275

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
5tii-assembly1.cif.gz_A comprehensive analysis of a novel ketoreductase for pentangular polyphenol biosynthesis 0.9207 5 267
5tii-assembly2.cif.gz_G comprehensive analysis of a novel ketoreductase for pentangular polyphenol biosynthesis 0.9178 5 267
5wva-assembly1.cif.gz_A-2 serratia marcescens short-chain dehydrogenase/reductase f98y/f202y mutant 0.889 5 268
5tii-assembly1.cif.gz_A comprehensive analysis of a novel ketoreductase for pentangular polyphenol biosynthesis 0.8881 5 267
4nbv-assembly1.cif.gz_A crystal structure of fabg from cupriavidus taiwanensis 0.8878 5 267
ID Description Score Start End Superfamily
3v2gA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9002 5 268 3.40.50.720
4mowD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8817 5 267 3.40.50.720
af_C6TLW3_3_253_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8796 5 267 3.40.50.720
af_Q2FZ14_1_233_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8776 8 268 3.40.50.720
4bmnA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8741 5 271 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A524IWC0-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9718 11 137
AF-A0A2V7JEW3-F1-model_v4 3-oxoacyl-ACP reductase 0.9647 4 184 GO:0016491
AF-A0A136MGV9-F1-model_v4 deleted 0.9641 4 217
AF-A0A7C4P7V8-F1-model_v4 SDR family oxidoreductase 0.9626 6 273 GO:0016491
AF-A0A7V3PLJ4-F1-model_v4 SDR family oxidoreductase 0.9583 5 185 GO:0016491

Map