F454608

General Info

Members Datasets Scaffolds Average Seq Length
494 250 988 128

Family's Representative Sequence

Representative Sequence 3300041459|Ga0451800_1102745|Ga0451800_1102745_53_490
Length 145
Sequence VAVRAVRGATQLDADDREHMLERVAEMVVDVMNANGLEVDDFISVIFTATSDLVSEFPAYAARRLGFGEVPLICARELEIEGSMPRVVRMMAHIETDLARQDVTHVYLHGAAALRRDLSRVRAVPDEPPHETARSAHAPAGTPDE

Samples

Sample ID Description Type Environment
1 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
52 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
53 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
126 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
127 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
128 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
129 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
130 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
131 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
132 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
133 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
134 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
135 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
136 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
137 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
138 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
139 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
140 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
141 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
142 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
143 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
144 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
145 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
146 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
147 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
148 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
149 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
150 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
151 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
152 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
153 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
154 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
155 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
156 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
157 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
158 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
159 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
160 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
161 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
162 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
163 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
164 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
165 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
166 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
167 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
168 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
169 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
170 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
171 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
172 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
173 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
174 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
175 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
176 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
177 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
178 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
179 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
180 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
181 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
182 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
183 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
184 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
185 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
186 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
187 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
188 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
189 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
190 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
191 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
192 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
193 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
194 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
195 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
211 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
212 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
213 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
214 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
215 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
216 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
217 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
218 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
219 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
220 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
221 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
222 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
223 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
224 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
225 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
226 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
229 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
230 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
231 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
232 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
233 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
234 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
235 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
236 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
237 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
238 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
239 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
240 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
241 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
242 2643221561 Nocardioides sp. Root151 Isolate Unclassified
243 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
244 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
245 2643221696 Nocardioides sp. Root140 Isolate Unclassified
246 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
247 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
248 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
249 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
250 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.77
Metatranscriptomes 0.4
Isolates 1.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.42
Nodule 0
Rhizoplane 10.12
Rhizosphere 86.23
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451800_1102745 3300041459 Bacteria 544
2 LJQas_1010768 3300000549 Bacteria 1092
3 JGI24741J21665_1048514 3300001915 Bacteria 625
4 JGI24740J21852_10008869 3300001979 Bacteria 3981
5 JGI24737J22298_10023182 3300001990 Bacteria 1970
6 JGI24737J22298_10178322 3300001990 Bacteria 627
7 JGI24737J22298_10205239 3300001990 Bacteria 581
8 JGI24735J21928_10067491 3300002067 Bacteria 1026
9 JGI24735J21928_10078074 3300002067 Bacteria 948
10 JGI24735J21928_10087465 3300002067 Bacteria 893
11 Ga0070658_10029702 3300005327 Bacteria 4393
12 Ga0070658_10500238 3300005327 Bacteria 1050
13 Ga0070683_100001330 3300005329 Bacteria 18823
14 Ga0070683_100038795 3300005329 Bacteria 4368
15 Ga0070683_100665457 3300005329 Bacteria 997
16 Ga0070683_100848856 3300005329 Bacteria 876
17 Ga0070690_101487339 3300005330 Bacteria 547
18 Ga0068869_100760513 3300005334 Bacteria 830
19 Ga0070666_10391713 3300005335 Bacteria 998
20 Ga0070680_100224036 3300005336 Bacteria 1587
21 Ga0070680_101146958 3300005336 Bacteria 672
22 Ga0070682_100068471 3300005337 Bacteria 2264
23 Ga0070660_100148356 3300005339 Bacteria 1885
24 Ga0070691_10277256 3300005341 Bacteria 908
25 Ga0070687_100338547 3300005343 Bacteria 967
26 Ga0070692_10092125 3300005345 Bacteria 1649
27 Ga0070669_100592297 3300005353 Bacteria 928
28 Ga0070671_100287019 3300005355 Bacteria 1400
29 Ga0070674_100041292 3300005356 Bacteria 3125
30 Ga0070674_101860773 3300005356 Bacteria 546
31 Ga0070659_100798948 3300005366 Bacteria 820
32 Ga0070667_100459859 3300005367 Bacteria 1163
33 Ga0070700_101499730 3300005441 Bacteria 573
34 Ga0070694_100742125 3300005444 Bacteria 801
35 Ga0070678_100102112 3300005456 Bacteria 2225
36 Ga0070678_100488662 3300005456 Bacteria 1084
37 Ga0070681_10135259 3300005458 Bacteria 2396
38 Ga0068867_101638964 3300005459 Bacteria 602
39 Ga0070685_10050502 3300005466 Bacteria 2403
40 Ga0070679_100009217 3300005530 Bacteria 9326
41 Ga0070679_100202191 3300005530 Bacteria 1952
42 Ga0070684_100005034 3300005535 Bacteria 10093
43 Ga0070684_100304728 3300005535 Bacteria 1462
44 Ga0070684_101027248 3300005535 Bacteria 774
45 Ga0068853_100187526 3300005539 Bacteria 1878
46 Ga0070686_100494720 3300005544 Bacteria 948
47 Ga0070693_100100012 3300005547 Bacteria 1765
48 Ga0070693_101328444 3300005547 Bacteria 557
49 Ga0070693_101576032 3300005547 Bacteria 515
50 Ga0070665_100329250 3300005548 Bacteria 1532
51 Ga0068855_100372335 3300005563 Bacteria 1570
52 Ga0070664_100034574 3300005564 Bacteria 4240
53 Ga0068857_100013830 3300005577 Bacteria 7028
54 Ga0068857_100146319 3300005577 Bacteria 2138
55 Ga0068854_100188712 3300005578 Bacteria 1614
56 Ga0068856_100173765 3300005614 Bacteria 2167
57 Ga0070702_100356185 3300005615 Bacteria 1032
58 Ga0068852_100071126 3300005616 Bacteria 3054
59 Ga0068852_101657246 3300005616 Bacteria 662
60 Ga0068864_100083479 3300005618 Bacteria 2805
61 Ga0068861_100474382 3300005719 Bacteria 1126
62 Ga0068851_10490854 3300005834 Bacteria 735
63 Ga0068851_10586055 3300005834 Bacteria 677
64 Ga0068870_11020678 3300005840 Bacteria 591
65 Ga0068863_100961292 3300005841 Bacteria 856
66 Ga0068858_100443874 3300005842 Bacteria 1250
67 Ga0068860_100978231 3300005843 Bacteria 864
68 Ga0068862_100128900 3300005844 Bacteria 2236
69 Ga0068862_101210888 3300005844 Bacteria 754
70 Ga0081539_10015245 3300005985 Bacteria 5600
71 Ga0075365_10002243 3300006038 Bacteria 9356
72 Ga0075365_10411322 3300006038 Bacteria 955
73 Ga0070715_10596151 3300006163 Bacteria 647
74 Ga0075369_10187970 3300006186 Bacteria 951
75 Ga0097621_100894274 3300006237 Bacteria 827
76 Ga0068871_100523947 3300006358 Bacteria 1071
77 Ga0097620_102958378 3300006931 Bacteria 520
78 Ga0105240_11518043 3300009093 Bacteria 702
79 Ga0105245_10008624 3300009098 Bacteria 8893
80 Ga0105245_10866131 3300009098 Bacteria 944
81 Ga0105245_11905271 3300009098 Bacteria 648
82 Ga0105245_11973620 3300009098 Bacteria 637
83 Ga0105243_10066708 3300009148 Bacteria 2895
84 Ga0105243_10093568 3300009148 Bacteria 2481
85 Ga0105243_10139695 3300009148 Bacteria 2065
86 Ga0105243_10530358 3300009148 Bacteria 1121
87 Ga0105243_10631953 3300009148 Bacteria 1035
88 Ga0105243_10737962 3300009148 Bacteria 964
89 Ga0105243_10907551 3300009148 Bacteria 877
90 Ga0105248_10207852 3300009177 Bacteria 2206
91 Ga0105237_11405351 3300009545 Bacteria 704
92 Ga0105237_11529694 3300009545 Bacteria 674
93 Ga0105238_10448851 3300009551 Bacteria 1286
94 Ga0105249_10036042 3300009553 Bacteria 4487
95 Ga0105249_10406536 3300009553 Bacteria 1393
96 Ga0105239_10021433 3300010375 Bacteria 7124
97 Ga0105246_10000580 3300011119 Bacteria 20306
98 Ga0105246_10116209 3300011119 Bacteria 1974
99 Ga0105246_10130658 3300011119 Bacteria 1875
100 Ga0105246_10868438 3300011119 Bacteria 806
101 Ga0157371_10104683 3300013102 Bacteria 2008
102 Ga0157370_11010680 3300013104 Bacteria 752
103 Ga0157370_11478794 3300013104 Bacteria 611
104 Ga0157369_10173843 3300013105 Bacteria 2268
105 Ga0157369_10690579 3300013105 Bacteria 1051
106 Ga0157374_11385703 3300013296 Bacteria 726
107 Ga0157378_10996965 3300013297 Bacteria 872
108 Ga0163162_10125482 3300013306 Bacteria 2673
109 Ga0163162_11217490 3300013306 Bacteria 855
110 Ga0157372_10034276 3300013307 Bacteria 5580
111 Ga0157372_10135633 3300013307 Bacteria 2834
112 Ga0157372_10201322 3300013307 Bacteria 2306
113 Ga0157372_10282152 3300013307 Bacteria 1931
114 Ga0157372_11357257 3300013307 Bacteria 820
115 Ga0157372_12165238 3300013307 Bacteria 639
116 Ga0157375_10469115 3300013308 Bacteria 1424
117 Ga0163163_10030016 3300014325 Bacteria 5234
118 Ga0163163_10171509 3300014325 Bacteria 2216
119 Ga0163163_11882946 3300014325 Bacteria 658
120 Ga0182008_10026796 3300014497 Bacteria 2922
121 Ga0182008_10097445 3300014497 Bacteria 1452
122 Ga0157377_10359228 3300014745 Bacteria 980
123 Ga0157377_10675253 3300014745 Bacteria 747
124 Ga0157379_10029792 3300014968 Bacteria 4854
125 Ga0163161_10022763 3300017792 Bacteria 4414
126 Ga0163161_10979505 3300017792 Bacteria 721
127 Ga0163161_11213532 3300017792 Bacteria 653
128 Ga0206354_10537817 3300020081 Bacteria 719
129 Ga0206353_10198898 3300020082 Bacteria 3468
130 Ga0207688_10012295 3300025901 Bacteria 4657
131 Ga0207688_10317562 3300025901 Bacteria 955
132 Ga0207647_10026173 3300025904 Bacteria 3820
133 Ga0207647_10187183 3300025904 Bacteria 1200
134 Ga0207645_11128399 3300025907 Bacteria 528
135 Ga0207643_10131642 3300025908 Bacteria 1489
136 Ga0207705_10063091 3300025909 Bacteria 2677
137 Ga0207705_10097496 3300025909 Bacteria 2159
138 Ga0207707_10161828 3300025912 Bacteria 1957
139 Ga0207660_10023347 3300025917 Bacteria 4176
140 Ga0207660_10392535 3300025917 Bacteria 1117
141 Ga0207657_10149397 3300025919 Bacteria 1904
142 Ga0207657_10295618 3300025919 Bacteria 1283
143 Ga0207649_10221831 3300025920 Bacteria 1347
144 Ga0207652_10216718 3300025921 Bacteria 1724
145 Ga0207652_10535108 3300025921 Bacteria 1054
146 Ga0207681_10430298 3300025923 Bacteria 1071
147 Ga0207694_10246674 3300025924 Bacteria 1460
148 Ga0207694_10337380 3300025924 Bacteria 1246
149 Ga0207687_10005735 3300025927 Bacteria 8218
150 Ga0207687_10941797 3300025927 Bacteria 740
151 Ga0207644_10333389 3300025931 Bacteria 1229
152 Ga0207690_10753978 3300025932 Bacteria 803
153 Ga0207709_10919873 3300025935 Bacteria 712
154 Ga0207709_11235960 3300025935 Bacteria 616
155 Ga0207709_11802255 3300025935 Bacteria 509
156 Ga0207669_10089326 3300025937 Bacteria 2001
157 Ga0207704_10030772 3300025938 Bacteria 3014
158 Ga0207704_10872507 3300025938 Bacteria 755
159 Ga0207704_11180110 3300025938 Bacteria 652
160 Ga0207665_10867126 3300025939 Bacteria 715
161 Ga0207691_10182526 3300025940 Bacteria 1833
162 Ga0207711_10087906 3300025941 Bacteria 2728
163 Ga0207689_10164841 3300025942 Bacteria 1826
164 Ga0207661_10027084 3300025944 Bacteria 4376
165 Ga0207661_10044783 3300025944 Bacteria 3499
166 Ga0207661_10675872 3300025944 Bacteria 949
167 Ga0207661_11879395 3300025944 Bacteria 544
168 Ga0207679_10244372 3300025945 Bacteria 1522
169 Ga0207667_10322408 3300025949 Bacteria 1578
170 Ga0207712_10031716 3300025961 Bacteria 3562
171 Ga0207668_10112342 3300025972 Bacteria 2047
172 Ga0207668_10120221 3300025972 Bacteria 1988
173 Ga0207640_10226524 3300025981 Bacteria 1435
174 Ga0207640_10407104 3300025981 Bacteria 1109
175 Ga0207640_10695954 3300025981 Bacteria 871
176 Ga0207658_10014138 3300025986 Bacteria 5467
177 Ga0207658_10375960 3300025986 Bacteria 1243
178 Ga0207677_10867997 3300026023 Bacteria 812
179 Ga0207703_10051920 3300026035 Bacteria 3326
180 Ga0207639_10273198 3300026041 Bacteria 1483
181 Ga0207639_10794322 3300026041 Bacteria 882
182 Ga0207678_10059960 3300026067 Bacteria 3273
183 Ga0207708_10521919 3300026075 Bacteria 998
184 Ga0207708_11257572 3300026075 Bacteria 648
185 Ga0207708_11295844 3300026075 Bacteria 638
186 Ga0207702_10034187 3300026078 Bacteria 4249
187 Ga0207702_10376249 3300026078 Bacteria 1365
188 Ga0207702_10510096 3300026078 Bacteria 1173
189 Ga0207676_10162719 3300026095 Bacteria 1935
190 Ga0207676_10400375 3300026095 Bacteria 1283
191 Ga0207676_10770148 3300026095 Bacteria 937
192 Ga0207674_10019067 3300026116 Bacteria 7435
193 Ga0207674_10164233 3300026116 Bacteria 2175
194 Ga0207674_10500621 3300026116 Bacteria 1174
195 Ga0207675_100215270 3300026118 Bacteria 1849
196 Ga0207675_100539096 3300026118 Bacteria 1165
197 Ga0207675_100542586 3300026118 Bacteria 1161
198 Ga0207675_101969281 3300026118 Bacteria 602
199 Ga0207683_10076793 3300026121 Bacteria 2958
200 Ga0207683_10300595 3300026121 Bacteria 1468
201 Ga0207683_10450349 3300026121 Bacteria 1187
202 Ga0207683_10747234 3300026121 Bacteria 907
203 Ga0207683_11403902 3300026121 Bacteria 646
204 Ga0207698_10126955 3300026142 Bacteria 2171
205 Ga0207698_11629622 3300026142 Bacteria 661
206 Ga0207428_11249231 3300027907 Bacteria 516
207 Ga0268266_10012291 3300028379 Bacteria 7407
208 Ga0268266_10217760 3300028379 Bacteria 1754
209 Ga0268265_10238878 3300028380 Bacteria 1602
210 Ga0268265_12196148 3300028380 Bacteria 559
211 Ga0268264_10413335 3300028381 Bacteria 1299
212 Ga0307408_101424471 3300031548 Bacteria 653
213 Ga0316575_10003929 3300031665 Bacteria 5197
214 Ga0316579_10052515 3300031691 Bacteria 1908
215 Ga0316576_10000475 3300031727 Bacteria 18819
216 Ga0316576_10015176 3300031727 Bacteria 5163
217 Ga0316578_10058534 3300031728 Bacteria 2266
218 Ga0316578_10093336 3300031728 Bacteria 1799
219 Ga0307405_10427230 3300031731 Bacteria 1044
220 Ga0307405_11248892 3300031731 Bacteria 644
221 Ga0307405_11369315 3300031731 Bacteria 618
222 Ga0316577_10103848 3300031733 Bacteria 1593
223 Ga0307410_10360798 3300031852 Bacteria 1164
224 Ga0307406_10281564 3300031901 Bacteria 1269
225 Ga0307412_10169432 3300031911 Bacteria 1631
226 Ga0307412_10587516 3300031911 Bacteria 941
227 Ga0307412_10729137 3300031911 Bacteria 854
228 Ga0307409_100009270 3300031995 Bacteria 6038
229 Ga0307409_100193020 3300031995 Bacteria 1815
230 Ga0307409_100270245 3300031995 Bacteria 1565
231 Ga0307409_100370080 3300031995 Bacteria 1359
232 Ga0307409_101072048 3300031995 Bacteria 826
233 Ga0307409_101254918 3300031995 Bacteria 765
234 Ga0307416_100003451 3300032002 Bacteria 9283
235 Ga0307416_100415995 3300032002 Bacteria 1387
236 Ga0307416_101254234 3300032002 Bacteria 847
237 Ga0307416_101421779 3300032002 Bacteria 799
238 Ga0307414_11933877 3300032004 Bacteria 551
239 Ga0307415_100004810 3300032126 Bacteria 7077
240 Ga0307415_100917772 3300032126 Bacteria 808
241 Ga0307415_101070609 3300032126 Bacteria 753
242 Ga0316583_10001940 3300032133 Bacteria 7073
243 Ga0316585_10003225 3300032137 Bacteria 4463
244 Ga0316580_10057020 3300032139 Bacteria 1200
245 Ga0373939_0444399 3300035114 Bacteria 545
246 Ga0373960_0434693 3300035121 Bacteria 512
247 Ga0373961_0215961 3300035241 Bacteria 682
248 Ga0373947_1123799 3300035725 Bacteria 536
249 Ga0395899_0371764 3300037312 Bacteria 952
250 Ga0395898_0161945 3300037466 Bacteria 2140
251 Ga0395905_1115777 3300037471 Bacteria 692
252 Ga0395901_0088769 3300038443 Bacteria 3234
253 Ga0436365_0254737 3300039437 Bacteria 1797
254 Ga0439461_0026863 3300041410 Bacteria 1177
255 Ga0451791_1724110 3300041451 Bacteria 501
256 Ga0451795_0025622 3300041456 Bacteria 854
257 Ga0451800_0716814 3300041459 Bacteria 915
258 Ga0451843_1396140 3300041509 Bacteria 666
259 Ga0451853_0676030 3300041512 Bacteria 591
260 Ga0451853_2818307 3300041512 Bacteria 650
261 Ga0451853_3961865 3300041512 Bacteria 571
262 Ga0439445_0022077 3300042004 Bacteria 1603
263 Ga0466972_0024691 3300044658 Bacteria 2983
264 Ga0466965_0201227 3300044683 Bacteria 1056
265 Ga0466966_0210427 3300044684 Bacteria 1175
266 Ga0466961_0096109 3300044693 Bacteria 1868
267 Ga0466961_0159598 3300044693 Bacteria 1406
268 Ga0466963_0098446 3300044694 Bacteria 1999
269 Ga0466968_0286648 3300044735 Bacteria 789
270 Ga0466970_0010133 3300044765 Bacteria 4776
271 Ga0466970_0056059 3300044765 Bacteria 2106
272 Ga0466970_0172463 3300044765 Bacteria 1199
273 Ga0466970_0483006 3300044765 Bacteria 712
274 Ga0466957_0256390 3300044842 Bacteria 1164
275 Ga0466957_0699573 3300044842 Bacteria 715
276 Ga0466960_0031422 3300044901 Bacteria 2450
277 Ga0466960_0190670 3300044901 Bacteria 1115
278 Ga0466960_0217382 3300044901 Bacteria 1050
279 Ga0466960_0592265 3300044901 Bacteria 657
280 Ga0466959_0555129 3300045049 Bacteria 774
281 Ga0451576_0457559 3300045051 Bacteria 1340
282 Ga0466967_0033346 3300045976 Bacteria 4358
283 Ga0466967_0068211 3300045976 Bacteria 3175
284 Ga0466967_0149418 3300045976 Bacteria 2182
285 Ga0466967_0350181 3300045976 Bacteria 1429
286 Ga0466967_1206791 3300045976 Bacteria 754
287 Ga0495596_0357494 3300046500 Bacteria 569
288 Ga0495618_0358133 3300046514 Bacteria 898
289 Ga0495656_0290803 3300046615 Bacteria 835
290 Ga0495634_0566832 3300046642 Bacteria 661
291 Ga0495625_0194536 3300046660 Bacteria 1342
292 Ga0495658_0164829 3300046683 Bacteria 1369
293 Ga0495676_0586129 3300047321 Bacteria 727
294 Ga0495684_0514114 3300047471 Bacteria 821
295 Ga0495614_0200716 3300048089 Bacteria 902
296 Ga0496100_0119585 3300048903 Bacteria 1841
297 Ga0496100_0609133 3300048903 Bacteria 848
298 Ga0496100_0756488 3300048903 Bacteria 760
299 Ga0496101_0130037 3300048904 Bacteria 1911
300 Ga0496101_0325922 3300048904 Bacteria 1205
301 Ga0496101_1245399 3300048904 Bacteria 582
302 Ga0496102_0016612 3300048905 Bacteria 6434
303 Ga0496102_0089201 3300048905 Bacteria 2852
304 Ga0496102_1077173 3300048905 Bacteria 724
305 Ga0496103_0016695 3300048906 Bacteria 4384
306 Ga0496103_0042046 3300048906 Bacteria 2811
307 Ga0496103_0644945 3300048906 Bacteria 673
308 Ga0496104_0010552 3300048907 Bacteria 8249
309 Ga0496104_0363978 3300048907 Bacteria 1359
310 Ga0496104_0715317 3300048907 Bacteria 909
311 Ga0496105_0012954 3300048908 Bacteria 6607
312 Ga0496106_0028363 3300048909 Bacteria 4170
313 Ga0496106_0202930 3300048909 Bacteria 1578
314 Ga0496107_0009526 3300048910 Bacteria 6739
315 Ga0496107_0055989 3300048910 Bacteria 2848
316 Ga0496107_0063094 3300048910 Bacteria 2685
317 Ga0496107_0854237 3300048910 Bacteria 665
318 Ga0496108_0339589 3300048911 Bacteria 1310
319 Ga0496108_0618635 3300048911 Bacteria 943
320 Ga0496109_0120466 3300048912 Bacteria 2444
321 Ga0496109_0142278 3300048912 Bacteria 2243
322 Ga0496109_0184305 3300048912 Bacteria 1961
323 Ga0496109_0685182 3300048912 Bacteria 962
324 Ga0496109_0825723 3300048912 Bacteria 865
325 Ga0496110_0034163 3300048913 Bacteria 4403
326 Ga0496110_0046118 3300048913 Bacteria 3812
327 Ga0496110_0542693 3300048913 Bacteria 1057
328 Ga0496110_1612192 3300048913 Bacteria 559
329 Ga0496111_0358756 3300048914 Bacteria 1079
330 Ga0496112_0313494 3300048915 Bacteria 1514
331 Ga0496112_0584449 3300048915 Bacteria 1049
332 Ga0496113_0028575 3300048916 Bacteria 4013
333 Ga0496114_0003134 3300048917 Bacteria 12684
334 Ga0496114_0173256 3300048917 Bacteria 1881
335 Ga0496114_0322860 3300048917 Bacteria 1364
336 Ga0496114_0535892 3300048917 Bacteria 1035
337 Ga0496114_0742972 3300048917 Bacteria 858
338 Ga0496114_0837460 3300048917 Bacteria 800
339 Ga0496114_1324193 3300048917 Bacteria 607
340 Ga0496115_0004348 3300048918 Bacteria 10250
341 Ga0496115_0026132 3300048918 Bacteria 4553
342 Ga0501293_040180 3300049516 Bacteria 529
343 Ga0501031_0040761 3300049568 Bacteria 3031
344 Ga0501032_0302337 3300049569 Bacteria 1034
345 Ga0501032_0496739 3300049569 Bacteria 780
346 Ga0501032_0801790 3300049569 Bacteria 595
347 Ga0501033_0101318 3300049570 Bacteria 2101
348 Ga0501033_0653537 3300049570 Bacteria 718
349 Ga0501034_0002758 3300049571 Bacteria 20635
350 Ga0501034_0043282 3300049571 Bacteria 4558
351 Ga0501036_0137891 3300049572 Bacteria 2059
352 Ga0501036_1406237 3300049572 Bacteria 565
353 Ga0501037_0060315 3300049573 Bacteria 2767
354 Ga0501037_0393674 3300049573 Bacteria 951
355 Ga0501037_1054337 3300049573 Bacteria 528
356 Ga0501038_0013249 3300049574 Bacteria 7520
357 Ga0501038_0136325 3300049574 Bacteria 2011
358 Ga0501038_0354002 3300049574 Bacteria 1143
359 Ga0501039_0031433 3300049575 Bacteria 4093
360 Ga0501039_0233281 3300049575 Bacteria 1447
361 Ga0501039_0361139 3300049575 Bacteria 1141
362 Ga0501039_0942412 3300049575 Bacteria 671
363 Ga0501039_1118089 3300049575 Bacteria 610
364 Ga0501040_0004140 3300049576 Bacteria 9436
365 Ga0501040_0157554 3300049576 Bacteria 1604
366 Ga0501041_0005862 3300049577 Bacteria 7183
367 Ga0501041_0140681 3300049577 Bacteria 1505
368 Ga0501041_0199787 3300049577 Bacteria 1253
369 Ga0501042_0006403 3300049578 Bacteria 7634
370 Ga0501042_0191002 3300049578 Bacteria 1477
371 Ga0501042_0512994 3300049578 Bacteria 871
372 Ga0501043_0209183 3300049579 Bacteria 1512
373 Ga0501043_0420189 3300049579 Bacteria 1008
374 Ga0501043_0555136 3300049579 Bacteria 853
375 Ga0501043_0644924 3300049579 Bacteria 778
376 Ga0501046_0166743 3300049580 Bacteria 1655
377 Ga0501047_0581658 3300049581 Bacteria 942
378 Ga0501048_0003751 3300049582 Bacteria 11593
379 Ga0501048_0116685 3300049582 Bacteria 1886
380 Ga0501067_0000254 3300049583 Bacteria 29273
381 Ga0501067_0002563 3300049583 Bacteria 10040
382 Ga0501067_0013211 3300049583 Bacteria 4572
383 Ga0501067_0063558 3300049583 Bacteria 2044
384 Ga0501067_0084612 3300049583 Bacteria 1759
385 Ga0501067_0113244 3300049583 Bacteria 1508
386 Ga0501068_0043011 3300049584 Bacteria 2717
387 Ga0501068_0114610 3300049584 Bacteria 1678
388 Ga0501068_0119737 3300049584 Bacteria 1641
389 Ga0501068_0211622 3300049584 Bacteria 1231
390 Ga0501068_0224038 3300049584 Bacteria 1195
391 Ga0501068_0244491 3300049584 Bacteria 1142
392 Ga0501069_0004080 3300049585 Bacteria 7533
393 Ga0501069_0035469 3300049585 Bacteria 2749
394 Ga0501069_0042201 3300049585 Bacteria 2523
395 Ga0501069_0092380 3300049585 Bacteria 1712
396 Ga0501069_0213297 3300049585 Bacteria 1121
397 Ga0501069_0444381 3300049585 Bacteria 770
398 Ga0501070_0000490 3300049586 Bacteria 35973
399 Ga0501070_0000870 3300049586 Bacteria 27482
400 Ga0501070_0008513 3300049586 Bacteria 8670
401 Ga0501070_0247295 3300049586 Bacteria 1459
402 Ga0501070_0318311 3300049586 Bacteria 1266
403 Ga0501070_0461431 3300049586 Bacteria 1023
404 Ga0501071_0010096 3300049587 Bacteria 6314
405 Ga0501071_0012213 3300049587 Bacteria 5816
406 Ga0501071_0067157 3300049587 Bacteria 2608
407 Ga0501071_0139619 3300049587 Bacteria 1804
408 Ga0501071_0256215 3300049587 Bacteria 1321
409 Ga0501071_0747010 3300049587 Bacteria 754
410 Ga0501071_1099252 3300049587 Bacteria 614
411 Ga0501071_1194005 3300049587 Bacteria 588
412 Ga0501071_1467279 3300049587 Bacteria 527
413 Ga0501072_0071357 3300049588 Bacteria 2744
414 Ga0501072_0149178 3300049588 Bacteria 1864
415 Ga0501072_0166507 3300049588 Bacteria 1759
416 Ga0501072_0198769 3300049588 Bacteria 1598
417 Ga0501073_0000587 3300049589 Bacteria 25678
418 Ga0501073_0001797 3300049589 Bacteria 15961
419 Ga0501073_0308505 3300049589 Bacteria 1092
420 Ga0501074_0001920 3300049590 Bacteria 14291
421 Ga0501074_0003025 3300049590 Bacteria 11843
422 Ga0501074_0013705 3300049590 Bacteria 5893
423 Ga0501074_0238770 3300049590 Bacteria 1293
424 Ga0501074_0351984 3300049590 Bacteria 1045
425 Ga0501075_0022060 3300049591 Bacteria 4648
426 Ga0501075_0311708 3300049591 Bacteria 1199
427 Ga0501075_0448201 3300049591 Bacteria 984
428 Ga0501075_0829495 3300049591 Bacteria 703
429 Ga0501076_0011603 3300049592 Bacteria 6573
430 Ga0501076_0348205 3300049592 Bacteria 1216
431 Ga0501076_1047217 3300049592 Bacteria 672
432 Ga0501076_1237451 3300049592 Bacteria 614
433 Ga0501077_0360133 3300049593 Bacteria 929
434 Ga0501077_0707551 3300049593 Bacteria 647
435 Ga0501079_0007385 3300049741 Bacteria 8316
436 Ga0501079_0064700 3300049741 Bacteria 2821
437 Ga0501079_0117892 3300049741 Bacteria 2064
438 Ga0501079_0524525 3300049741 Bacteria 931
439 Ga0501080_0003190 3300049742 Bacteria 14456
440 Ga0501080_0008936 3300049742 Bacteria 9110
441 Ga0501080_0032751 3300049742 Bacteria 4849
442 Ga0501080_0512435 3300049742 Bacteria 1071
443 Ga0501080_0836008 3300049742 Bacteria 806
444 Ga0501081_0075660 3300049743 Bacteria 2351
445 Ga0501081_0090451 3300049743 Bacteria 2152
446 Ga0501081_0177197 3300049743 Bacteria 1541
447 Ga0501081_0202191 3300049743 Bacteria 1441
448 Ga0501081_0485007 3300049743 Bacteria 920
449 Ga0501083_0036125 3300049744 Bacteria 3371
450 Ga0501083_0049929 3300049744 Bacteria 2818
451 Ga0501271_046137 3300049768 Bacteria 580
452 Ga0501035_0575025 3300049822 Bacteria 921
453 Ga0501044_0210100 3300049823 Bacteria 1901
454 Ga0501045_0117370 3300049824 Bacteria 1975
455 Ga0501045_0173265 3300049824 Bacteria 1607
456 Ga0501045_0608957 3300049824 Bacteria 808
457 Ga0501045_1205099 3300049824 Bacteria 552
458 nmdc:mga0yw44_337675_c1 3300050492 Bacteria 1013
459 nmdc:mga0sz30_73129_c1 3300050516 Bacteria 1477
460 Ga0495655_0242440 3300053083 Bacteria 604
461 Ga0495595_0261282 3300053084 Bacteria 868
462 Ga0495619_0071506 3300053085 Bacteria 2322
463 Ga0500556_0016865 3300053104 Bacteria 2279
464 Ga0500620_101610 3300053155 Bacteria 1006
465 Ga0501084_0018179 3300054114 Bacteria 5853
466 Ga0501084_0057214 3300054114 Bacteria 3263
467 Ga0501084_0244609 3300054114 Bacteria 1514
468 Ga0501084_0616226 3300054114 Bacteria 917
469 Ga0501084_1820132 3300054114 Bacteria 508
470 Ga0590071_179136 3300059421 Bacteria 555
471 Ga0590074_062013 3300059423 Bacteria 696
472 Ga0590075_014286 3300059424 Bacteria 1941
473 Ga0501082_0016170 3300060353 Bacteria 6421
474 Ga0501082_0023774 3300060353 Bacteria 5284
475 Ga0501082_0092815 3300060353 Bacteria 2608
476 Ga0501082_0433030 3300060353 Bacteria 1149
477 Ga0501082_0599338 3300060353 Bacteria 964
478 Ga0501082_0854026 3300060353 Bacteria 796
479 Ga0501082_0991926 3300060353 Bacteria 734
480 Ga0530510_0107672 3300061734 Bacteria 2040
481 Ga0530510_0306290 3300061734 Bacteria 1189
482 Ga0530510_0355220 3300061734 Bacteria 1101
483 Ga0530510_0727641 3300061734 Bacteria 756
484 Ga0530510_1259364 3300061734 Bacteria 567
485 Ga0530510_1304218 3300061734 Bacteria 557
486 2643828225 2643221561 Bacteria 4984412
487 2643944144 2643221587 Bacteria 7586415
488 2644430992 2643221677 Bacteria 7584031
489 2644535039 2643221696 Bacteria 5431823
490 2676476613 2675903058 Bacteria 6822861
491 2827630660 2827628540 Bacteria 6858585
492 2855391004 2855386786 Bacteria 4752232
493 2918502825 2918501144 Bacteria 8668083
494 8056066219 8056060235 Bacteria 7259403
495 Ga0451800_1102745
496 LJQas_1010768
497 JGI24741J21665_1048514
498 JGI24740J21852_10008869
499 JGI24737J22298_10023182
500 JGI24737J22298_10178322
501 JGI24737J22298_10205239
502 JGI24735J21928_10067491
503 JGI24735J21928_10078074
504 JGI24735J21928_10087465
505 Ga0070658_10029702
506 Ga0070658_10500238
507 Ga0070683_100001330
508 Ga0070683_100038795
509 Ga0070683_100665457
510 Ga0070683_100848856
511 Ga0070690_101487339
512 Ga0068869_100760513
513 Ga0070666_10391713
514 Ga0070680_100224036
515 Ga0070680_101146958
516 Ga0070682_100068471
517 Ga0070660_100148356
518 Ga0070691_10277256
519 Ga0070687_100338547
520 Ga0070692_10092125
521 Ga0070669_100592297
522 Ga0070671_100287019
523 Ga0070674_100041292
524 Ga0070674_101860773
525 Ga0070659_100798948
526 Ga0070667_100459859
527 Ga0070700_101499730
528 Ga0070694_100742125
529 Ga0070678_100102112
530 Ga0070678_100488662
531 Ga0070681_10135259
532 Ga0068867_101638964
533 Ga0070685_10050502
534 Ga0070679_100009217
535 Ga0070679_100202191
536 Ga0070684_100005034
537 Ga0070684_100304728
538 Ga0070684_101027248
539 Ga0068853_100187526
540 Ga0070686_100494720
541 Ga0070693_100100012
542 Ga0070693_101328444
543 Ga0070693_101576032
544 Ga0070665_100329250
545 Ga0068855_100372335
546 Ga0070664_100034574
547 Ga0068857_100013830
548 Ga0068857_100146319
549 Ga0068854_100188712
550 Ga0068856_100173765
551 Ga0070702_100356185
552 Ga0068852_100071126
553 Ga0068852_101657246
554 Ga0068864_100083479
555 Ga0068861_100474382
556 Ga0068851_10490854
557 Ga0068851_10586055
558 Ga0068870_11020678
559 Ga0068863_100961292
560 Ga0068858_100443874
561 Ga0068860_100978231
562 Ga0068862_100128900
563 Ga0068862_101210888
564 Ga0081539_10015245
565 Ga0075365_10002243
566 Ga0075365_10411322
567 Ga0070715_10596151
568 Ga0075369_10187970
569 Ga0097621_100894274
570 Ga0068871_100523947
571 Ga0097620_102958378
572 Ga0105240_11518043
573 Ga0105245_10008624
574 Ga0105245_10866131
575 Ga0105245_11905271
576 Ga0105245_11973620
577 Ga0105243_10066708
578 Ga0105243_10093568
579 Ga0105243_10139695
580 Ga0105243_10530358
581 Ga0105243_10631953
582 Ga0105243_10737962
583 Ga0105243_10907551
584 Ga0105248_10207852
585 Ga0105237_11405351
586 Ga0105237_11529694
587 Ga0105238_10448851
588 Ga0105249_10036042
589 Ga0105249_10406536
590 Ga0105239_10021433
591 Ga0105246_10000580
592 Ga0105246_10116209
593 Ga0105246_10130658
594 Ga0105246_10868438
595 Ga0157371_10104683
596 Ga0157370_11010680
597 Ga0157370_11478794
598 Ga0157369_10173843
599 Ga0157369_10690579
600 Ga0157374_11385703
601 Ga0157378_10996965
602 Ga0163162_10125482
603 Ga0163162_11217490
604 Ga0157372_10034276
605 Ga0157372_10135633
606 Ga0157372_10201322
607 Ga0157372_10282152
608 Ga0157372_11357257
609 Ga0157372_12165238
610 Ga0157375_10469115
611 Ga0163163_10030016
612 Ga0163163_10171509
613 Ga0163163_11882946
614 Ga0182008_10026796
615 Ga0182008_10097445
616 Ga0157377_10359228
617 Ga0157377_10675253
618 Ga0157379_10029792
619 Ga0163161_10022763
620 Ga0163161_10979505
621 Ga0163161_11213532
622 Ga0206354_10537817
623 Ga0206353_10198898
624 Ga0207688_10012295
625 Ga0207688_10317562
626 Ga0207647_10026173
627 Ga0207647_10187183
628 Ga0207645_11128399
629 Ga0207643_10131642
630 Ga0207705_10063091
631 Ga0207705_10097496
632 Ga0207707_10161828
633 Ga0207660_10023347
634 Ga0207660_10392535
635 Ga0207657_10149397
636 Ga0207657_10295618
637 Ga0207649_10221831
638 Ga0207652_10216718
639 Ga0207652_10535108
640 Ga0207681_10430298
641 Ga0207694_10246674
642 Ga0207694_10337380
643 Ga0207687_10005735
644 Ga0207687_10941797
645 Ga0207644_10333389
646 Ga0207690_10753978
647 Ga0207709_10919873
648 Ga0207709_11235960
649 Ga0207709_11802255
650 Ga0207669_10089326
651 Ga0207704_10030772
652 Ga0207704_10872507
653 Ga0207704_11180110
654 Ga0207665_10867126
655 Ga0207691_10182526
656 Ga0207711_10087906
657 Ga0207689_10164841
658 Ga0207661_10027084
659 Ga0207661_10044783
660 Ga0207661_10675872
661 Ga0207661_11879395
662 Ga0207679_10244372
663 Ga0207667_10322408
664 Ga0207712_10031716
665 Ga0207668_10112342
666 Ga0207668_10120221
667 Ga0207640_10226524
668 Ga0207640_10407104
669 Ga0207640_10695954
670 Ga0207658_10014138
671 Ga0207658_10375960
672 Ga0207677_10867997
673 Ga0207703_10051920
674 Ga0207639_10273198
675 Ga0207639_10794322
676 Ga0207678_10059960
677 Ga0207708_10521919
678 Ga0207708_11257572
679 Ga0207708_11295844
680 Ga0207702_10034187
681 Ga0207702_10376249
682 Ga0207702_10510096
683 Ga0207676_10162719
684 Ga0207676_10400375
685 Ga0207676_10770148
686 Ga0207674_10019067
687 Ga0207674_10164233
688 Ga0207674_10500621
689 Ga0207675_100215270
690 Ga0207675_100539096
691 Ga0207675_100542586
692 Ga0207675_101969281
693 Ga0207683_10076793
694 Ga0207683_10300595
695 Ga0207683_10450349
696 Ga0207683_10747234
697 Ga0207683_11403902
698 Ga0207698_10126955
699 Ga0207698_11629622
700 Ga0207428_11249231
701 Ga0268266_10012291
702 Ga0268266_10217760
703 Ga0268265_10238878
704 Ga0268265_12196148
705 Ga0268264_10413335
706 Ga0307408_101424471
707 Ga0316575_10003929
708 Ga0316579_10052515
709 Ga0316576_10000475
710 Ga0316576_10015176
711 Ga0316578_10058534
712 Ga0316578_10093336
713 Ga0307405_10427230
714 Ga0307405_11248892
715 Ga0307405_11369315
716 Ga0316577_10103848
717 Ga0307410_10360798
718 Ga0307406_10281564
719 Ga0307412_10169432
720 Ga0307412_10587516
721 Ga0307412_10729137
722 Ga0307409_100009270
723 Ga0307409_100193020
724 Ga0307409_100270245
725 Ga0307409_100370080
726 Ga0307409_101072048
727 Ga0307409_101254918
728 Ga0307416_100003451
729 Ga0307416_100415995
730 Ga0307416_101254234
731 Ga0307416_101421779
732 Ga0307414_11933877
733 Ga0307415_100004810
734 Ga0307415_100917772
735 Ga0307415_101070609
736 Ga0316583_10001940
737 Ga0316585_10003225
738 Ga0316580_10057020
739 Ga0373939_0444399
740 Ga0373960_0434693
741 Ga0373961_0215961
742 Ga0373947_1123799
743 Ga0395899_0371764
744 Ga0395898_0161945
745 Ga0395905_1115777
746 Ga0395901_0088769
747 Ga0436365_0254737
748 Ga0439461_0026863
749 Ga0451791_1724110
750 Ga0451795_0025622
751 Ga0451800_0716814
752 Ga0451843_1396140
753 Ga0451853_0676030
754 Ga0451853_2818307
755 Ga0451853_3961865
756 Ga0439445_0022077
757 Ga0466972_0024691
758 Ga0466965_0201227
759 Ga0466966_0210427
760 Ga0466961_0096109
761 Ga0466961_0159598
762 Ga0466963_0098446
763 Ga0466968_0286648
764 Ga0466970_0010133
765 Ga0466970_0056059
766 Ga0466970_0172463
767 Ga0466970_0483006
768 Ga0466957_0256390
769 Ga0466957_0699573
770 Ga0466960_0031422
771 Ga0466960_0190670
772 Ga0466960_0217382
773 Ga0466960_0592265
774 Ga0466959_0555129
775 Ga0451576_0457559
776 Ga0466967_0033346
777 Ga0466967_0068211
778 Ga0466967_0149418
779 Ga0466967_0350181
780 Ga0466967_1206791
781 Ga0495596_0357494
782 Ga0495618_0358133
783 Ga0495656_0290803
784 Ga0495634_0566832
785 Ga0495625_0194536
786 Ga0495658_0164829
787 Ga0495676_0586129
788 Ga0495684_0514114
789 Ga0495614_0200716
790 Ga0496100_0119585
791 Ga0496100_0609133
792 Ga0496100_0756488
793 Ga0496101_0130037
794 Ga0496101_0325922
795 Ga0496101_1245399
796 Ga0496102_0016612
797 Ga0496102_0089201
798 Ga0496102_1077173
799 Ga0496103_0016695
800 Ga0496103_0042046
801 Ga0496103_0644945
802 Ga0496104_0010552
803 Ga0496104_0363978
804 Ga0496104_0715317
805 Ga0496105_0012954
806 Ga0496106_0028363
807 Ga0496106_0202930
808 Ga0496107_0009526
809 Ga0496107_0055989
810 Ga0496107_0063094
811 Ga0496107_0854237
812 Ga0496108_0339589
813 Ga0496108_0618635
814 Ga0496109_0120466
815 Ga0496109_0142278
816 Ga0496109_0184305
817 Ga0496109_0685182
818 Ga0496109_0825723
819 Ga0496110_0034163
820 Ga0496110_0046118
821 Ga0496110_0542693
822 Ga0496110_1612192
823 Ga0496111_0358756
824 Ga0496112_0313494
825 Ga0496112_0584449
826 Ga0496113_0028575
827 Ga0496114_0003134
828 Ga0496114_0173256
829 Ga0496114_0322860
830 Ga0496114_0535892
831 Ga0496114_0742972
832 Ga0496114_0837460
833 Ga0496114_1324193
834 Ga0496115_0004348
835 Ga0496115_0026132
836 Ga0501293_040180
837 Ga0501031_0040761
838 Ga0501032_0302337
839 Ga0501032_0496739
840 Ga0501032_0801790
841 Ga0501033_0101318
842 Ga0501033_0653537
843 Ga0501034_0002758
844 Ga0501034_0043282
845 Ga0501036_0137891
846 Ga0501036_1406237
847 Ga0501037_0060315
848 Ga0501037_0393674
849 Ga0501037_1054337
850 Ga0501038_0013249
851 Ga0501038_0136325
852 Ga0501038_0354002
853 Ga0501039_0031433
854 Ga0501039_0233281
855 Ga0501039_0361139
856 Ga0501039_0942412
857 Ga0501039_1118089
858 Ga0501040_0004140
859 Ga0501040_0157554
860 Ga0501041_0005862
861 Ga0501041_0140681
862 Ga0501041_0199787
863 Ga0501042_0006403
864 Ga0501042_0191002
865 Ga0501042_0512994
866 Ga0501043_0209183
867 Ga0501043_0420189
868 Ga0501043_0555136
869 Ga0501043_0644924
870 Ga0501046_0166743
871 Ga0501047_0581658
872 Ga0501048_0003751
873 Ga0501048_0116685
874 Ga0501067_0000254
875 Ga0501067_0002563
876 Ga0501067_0013211
877 Ga0501067_0063558
878 Ga0501067_0084612
879 Ga0501067_0113244
880 Ga0501068_0043011
881 Ga0501068_0114610
882 Ga0501068_0119737
883 Ga0501068_0211622
884 Ga0501068_0224038
885 Ga0501068_0244491
886 Ga0501069_0004080
887 Ga0501069_0035469
888 Ga0501069_0042201
889 Ga0501069_0092380
890 Ga0501069_0213297
891 Ga0501069_0444381
892 Ga0501070_0000490
893 Ga0501070_0000870
894 Ga0501070_0008513
895 Ga0501070_0247295
896 Ga0501070_0318311
897 Ga0501070_0461431
898 Ga0501071_0010096
899 Ga0501071_0012213
900 Ga0501071_0067157
901 Ga0501071_0139619
902 Ga0501071_0256215
903 Ga0501071_0747010
904 Ga0501071_1099252
905 Ga0501071_1194005
906 Ga0501071_1467279
907 Ga0501072_0071357
908 Ga0501072_0149178
909 Ga0501072_0166507
910 Ga0501072_0198769
911 Ga0501073_0000587
912 Ga0501073_0001797
913 Ga0501073_0308505
914 Ga0501074_0001920
915 Ga0501074_0003025
916 Ga0501074_0013705
917 Ga0501074_0238770
918 Ga0501074_0351984
919 Ga0501075_0022060
920 Ga0501075_0311708
921 Ga0501075_0448201
922 Ga0501075_0829495
923 Ga0501076_0011603
924 Ga0501076_0348205
925 Ga0501076_1047217
926 Ga0501076_1237451
927 Ga0501077_0360133
928 Ga0501077_0707551
929 Ga0501079_0007385
930 Ga0501079_0064700
931 Ga0501079_0117892
932 Ga0501079_0524525
933 Ga0501080_0003190
934 Ga0501080_0008936
935 Ga0501080_0032751
936 Ga0501080_0512435
937 Ga0501080_0836008
938 Ga0501081_0075660
939 Ga0501081_0090451
940 Ga0501081_0177197
941 Ga0501081_0202191
942 Ga0501081_0485007
943 Ga0501083_0036125
944 Ga0501083_0049929
945 Ga0501271_046137
946 Ga0501035_0575025
947 Ga0501044_0210100
948 Ga0501045_0117370
949 Ga0501045_0173265
950 Ga0501045_0608957
951 Ga0501045_1205099
952 nmdc:mga0yw44_337675_c1
953 nmdc:mga0sz30_73129_c1
954 Ga0495655_0242440
955 Ga0495595_0261282
956 Ga0495619_0071506
957 Ga0500556_0016865
958 Ga0500620_101610
959 Ga0501084_0018179
960 Ga0501084_0057214
961 Ga0501084_0244609
962 Ga0501084_0616226
963 Ga0501084_1820132
964 Ga0590071_179136
965 Ga0590074_062013
966 Ga0590075_014286
967 Ga0501082_0016170
968 Ga0501082_0023774
969 Ga0501082_0092815
970 Ga0501082_0433030
971 Ga0501082_0599338
972 Ga0501082_0854026
973 Ga0501082_0991926
974 Ga0530510_0107672
975 Ga0530510_0306290
976 Ga0530510_0355220
977 Ga0530510_0727641
978 Ga0530510_1259364
979 Ga0530510_1304218
980 2643828225
981 2643944144
982 2644430992
983 2644535039
984 2676476613
985 2827630660
986 2855391004
987 2918502825
988 8056066219

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07736

CM_1

Chorismate mutase type I

3

118

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xho-assembly1.cif.gz_B chorismate mutase from clostridium thermocellum cth-682 0.991 5 113
8cuv-assembly1.cif.gz_B accurate computational design of genetically encoded 3d protein crystals 0.9726 2 117
1com-assembly3.cif.gz_D the monofunctional chorismate mutase from bacillus subtilis: structure determination of chorismate mutase and its complexes with a transition state analog and prephenate, and implications on the mechanism of enzymatic reaction 0.9701 2 113
1ufy-assembly1.cif.gz_A crystal analysis of chorismate mutase from thermus thermophilus 0.9687 2 118
1fnj-assembly1.cif.gz_A crystal structure analysis of chorismate mutase mutant c88s/r90k 0.9675 2 115
ID Description Score Start End Superfamily
1xhoC00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9852 6 113 3.30.1330.40
2chsI00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9724 2 113 3.30.1330.40
1ufyA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9687 2 118 3.30.1330.40
2chsI00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9476 2 113 3.30.1330.40
1xhoC00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9397 6 113 3.30.1330.40
ID Description Score Start End GO Terms
AF-A0A3N0GFU3-F1-model_v4 chorismate mutase (EC 5.4.99.5) 1 1 127 GO:0004106
GO:0008652
GO:0009073
GO:0046417
AF-A0A3D9V9T0-F1-model_v4 chorismate mutase (EC 5.4.99.5) 0.9988 1 128 GO:0004106
GO:0008652
GO:0009073
GO:0046417
AF-A0A6J7L8R1-F1-model_v4 Unannotated protein 0.9975 1 123 GO:0004106
GO:0046417
AF-A0A1H1W276-F1-model_v4 chorismate mutase (EC 5.4.99.5) 0.9972 1 127 GO:0004106
GO:0008652
GO:0009073
GO:0046417
AF-A0A6P2BYJ0-F1-model_v4 chorismate mutase (EC 5.4.99.5) 0.997 1 114 GO:0004106
GO:0008652
GO:0009073
GO:0046417

Map