F454566

General Info

Members Datasets Scaffolds Average Seq Length
494 278 441 334

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_10000002|Ga0105239_10000002290
Length 341
Sequence MSPNIVSFNHIQAAHCENGVTVGLLKNSGVGQITEPLAFGIGAGLFFVYIPLLKINNGPVIAFRTMPGLIFNRTCKALGIPVVRKKFRSKEAAEAFLNECLEAGHPVGCQVGVYYLPYFPKEYRFHFNAHNLIVYGSNDGNYMVSDPVMEGTNVMTAYELERVRFAKGALAPNGQLYYPKETRAVTDEQMKAAIISGIKKNVFNMISPFMGPIAGVNGIRYTGNKIKQWRDKLGLKEAGSYLAQLVRMQEEIGTGGGGFRYIYGAFLQEAYAYVPNDELLEISNSFTASGDLWRTAAVQAAGIYKGRIGSQEDFNTMGDYLLEIAEIERKAFTALKNIKWQ

Samples

Sample ID Description Type Environment
1 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
2 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
3 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
4 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
5 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
6 2582581873 Chryseobacterium sp. OV259 Isolate Rhizosphere
7 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
8 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
9 2585428061 Chryseobacterium sp. CF356 Isolate Rhizosphere
10 2585428095 Chryseobacterium sp. YR005 Isolate Rhizosphere
11 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
12 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
13 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
14 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
15 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
16 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
17 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
18 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
19 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
20 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
21 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
22 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
23 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
24 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
25 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
26 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
27 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
28 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
29 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
30 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
31 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
32 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
33 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
34 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
35 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
36 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
37 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
38 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
39 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
40 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
41 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
42 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
43 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
44 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
45 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
46 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
47 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
48 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
49 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
50 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
51 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
52 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere
53 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
54 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
55 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
56 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
57 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
58 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
59 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
60 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
61 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
62 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
63 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
64 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
65 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
66 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
67 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
68 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
69 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
70 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
71 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
72 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
73 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
74 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
75 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
76 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
77 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
78 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
79 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
80 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
81 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
82 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
83 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
84 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
85 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
86 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
87 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
88 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
89 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
90 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
91 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
92 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
93 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
94 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
95 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
96 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
97 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
98 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
99 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
100 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
101 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
102 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
103 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
104 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
106 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
107 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
108 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
109 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
110 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
111 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
112 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
113 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
114 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
115 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
116 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
117 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
118 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
119 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
120 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
121 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
122 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
123 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
124 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
125 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
126 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
127 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
128 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
129 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
130 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
131 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
132 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
133 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
134 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
135 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
136 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
137 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
138 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
139 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
140 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
141 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
142 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
143 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
144 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
191 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
192 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
195 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
198 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
199 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
200 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
201 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
202 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
203 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
204 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
205 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
206 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
207 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
208 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
209 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
210 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
211 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
212 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
213 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
214 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
215 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
216 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
217 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
218 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
219 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
220 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
221 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
222 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
223 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
224 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
225 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
226 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
227 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
228 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
229 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
230 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
231 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
232 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
233 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
234 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
235 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
236 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
237 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
238 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
239 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
240 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
241 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
242 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
243 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
244 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
245 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
246 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
247 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
248 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
249 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
250 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
251 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
252 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
253 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
254 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
255 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
256 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
257 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
262 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
263 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
264 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
265 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
266 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
267 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
268 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
269 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
270 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
271 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
272 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
273 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
274 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
275 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
276 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
277 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
278 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.07
Metatranscriptomes 0
Isolates 10.93

Biome Distribution

Category Percentage (%)
Aerial Root 0.4
Bulb 0
Endosphere 3.44
Nodule 1.42
Rhizoplane 0.81
Rhizosphere 82.59
Stem 0
Stem Tuber 0
Unclassified 11.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1002032 3300001915 Bacteria 5436
2 JGI24737J22298_10004123 3300001990 Bacteria 5078
3 JGI25162J39368_1001018 3300002737 Bacteria 17457
4 JGI25165J46597_1000957 3300003214 Bacteria 19672
5 rootH2_10040511 3300003320 Bacteria 7333
6 rootL2_10280896 3300003322 Bacteria 4993
7 rootH1_10000566 3300003316 Bacteria 33162
8 rootH1_10000566 3300003323 Bacteria 205679
9 rootH1_10030244 3300003323 Bacteria 7579
10 Ga0055534_1009364 3300003784 Bacteria 2134
11 Ga0065714_10014223 3300005288 Bacteria 2445
12 Ga0065714_10064456 3300005288 Bacteria 70947
13 Ga0065714_10097502 3300005288 Bacteria 1734
14 Ga0065704_10072550 3300005289 Bacteria 8335
15 Ga0065715_10007513 3300005293 Bacteria 2651
16 Ga0070658_10066481 3300005327 Bacteria 2945
17 Ga0070658_10141623 3300005327 Bacteria 2009
18 Ga0070676_10000262 3300005328 Bacteria 22949
19 Ga0070676_10058847 3300005328 Unclassified 2278
20 Ga0070676_10164203 3300005328 Bacteria 1432
21 Ga0070683_100002098 3300005329 Bacteria 15741
22 Ga0070670_100033641 3300005331 Bacteria 4415
23 Ga0070670_100120234 3300005331 Bacteria 2266
24 Ga0070670_100256190 3300005331 Bacteria 1525
25 Ga0070670_100291781 3300005331 Bacteria 1425
26 Ga0070670_100344651 3300005331 Bacteria 1308
27 Ga0068869_100093235 3300005334 Bacteria 2268
28 Ga0070666_10000039 3300005335 Bacteria 115360
29 Ga0070666_10013535 3300005335 Bacteria 5178
30 Ga0070680_100004495 3300005336 Bacteria 10508
31 Ga0070682_100000106 3300005337 Bacteria 74029
32 Ga0070682_100000133 3300005337 Bacteria 61302
33 Ga0070682_100010447 3300005337 Bacteria 5269
34 Ga0068868_100001486 3300005338 Bacteria 16186
35 Ga0068868_100011655 3300005338 Bacteria 6406
36 Ga0068868_100015137 3300005338 Bacteria 5699
37 Ga0070660_100008755 3300005339 Bacteria 7088
38 Ga0070660_100056862 3300005339 Bacteria 3028
39 Ga0070689_100192275 3300005340 Bacteria 1662
40 Ga0070691_10024066 3300005341 Bacteria 2829
41 Ga0070661_100156522 3300005344 Bacteria 1724
42 Ga0070668_100000036 3300005347 Bacteria 81256
43 Ga0070668_100085521 3300005347 Bacteria 2478
44 Ga0070675_100086939 3300005354 Bacteria 2614
45 Ga0070671_100118400 3300005355 Bacteria 2228
46 Ga0070671_100162442 3300005355 Bacteria 1888
47 Ga0070671_100379302 3300005355 Bacteria 1208
48 Ga0070673_100000580 3300005364 Bacteria 19823
49 Ga0070673_100201891 3300005364 Bacteria 1712
50 Ga0070659_100001045 3300005366 Bacteria 20218
51 Ga0070667_100000151 3300005367 Bacteria 86629
52 Ga0070667_100008389 3300005367 Bacteria 8567
53 Ga0070667_100015079 3300005367 Bacteria 6384
54 Ga0070663_100013428 3300005455 Bacteria 5223
55 Ga0070662_100001317 3300005457 Bacteria 15266
56 Ga0070681_10035380 3300005458 Bacteria 5017
57 Ga0070681_10078206 3300005458 Bacteria 3265
58 Ga0068867_100001155 3300005459 Bacteria 18059
59 Ga0068867_100017794 3300005459 Bacteria 5047
60 Ga0068867_100021893 3300005459 Bacteria 4565
61 Ga0070679_100002055 3300005530 Bacteria 18077
62 Ga0070679_100097257 3300005530 Bacteria 2931
63 Ga0070679_100267738 3300005530 Unclassified 1663
64 Ga0070684_100023412 3300005535 Bacteria 5166
65 Ga0068853_100010474 3300005539 Bacteria 7502
66 Ga0068853_100026708 3300005539 Bacteria 4850
67 Ga0068853_100096833 3300005539 Bacteria 2604
68 Ga0070672_100000225 3300005543 Bacteria 31458
69 Ga0070693_100024304 3300005547 Bacteria 3248
70 Ga0068855_100387850 3300005563 Bacteria 1533
71 Ga0068857_100013369 3300005577 Bacteria 7149
72 Ga0068856_100000044 3300005614 Bacteria 111437
73 Ga0068856_100020596 3300005614 Bacteria 6408
74 Ga0068856_100240828 3300005614 Bacteria 1824
75 Ga0068852_100091369 3300005616 Bacteria 2724
76 Ga0068852_100117656 3300005616 Bacteria 2427
77 Ga0068859_100000006 3300005617 Bacteria 421509
78 Ga0068859_100028907 3300005617 Bacteria 5560
79 Ga0068859_100288601 3300005617 Unclassified 1733
80 Ga0068864_100001963 3300005618 Bacteria 16908
81 Ga0068864_100008085 3300005618 Bacteria 8676
82 Ga0068864_100247214 3300005618 Bacteria 1655
83 Ga0068851_10000910 3300005834 Bacteria 12739
84 Ga0068851_10006636 3300005834 Bacteria 5296
85 Ga0068870_10081869 3300005840 Bacteria 1786
86 Ga0068863_100000510 3300005841 Bacteria 39514
87 Ga0068863_100000808 3300005841 Bacteria 31389
88 Ga0068863_100009631 3300005841 Bacteria 9424
89 Ga0068858_100004985 3300005842 Bacteria 13009
90 Ga0068858_100079999 3300005842 Bacteria 3036
91 Ga0068858_100249069 3300005842 Bacteria 1687
92 Ga0068858_100336273 3300005842 Bacteria 1445
93 Ga0068860_100004849 3300005843 Bacteria 13713
94 Ga0068860_100008104 3300005843 Bacteria 10464
95 Ga0068860_100008374 3300005843 Bacteria 10298
96 Ga0068860_100048712 3300005843 Bacteria 4038
97 Ga0068860_100076353 3300005843 Bacteria 3187
98 Ga0075366_10000091 3300006195 Bacteria 36066
99 Ga0097621_100001898 3300006237 Bacteria 14275
100 Ga0097621_100010967 3300006237 Bacteria 6655
101 Ga0097621_100017257 3300006237 Bacteria 5477
102 Ga0097621_100027628 3300006237 Bacteria 4464
103 Ga0097621_100057664 3300006237 Bacteria 3177
104 Ga0097621_100251812 3300006237 Bacteria 1547
105 Ga0068871_100120227 3300006358 Bacteria 2218
106 Ga0068871_100160150 3300006358 Unclassified 1924
107 Ga0068865_100005575 3300006881 Bacteria 7637
108 Ga0068865_100046368 3300006881 Bacteria 2982
109 Ga0097620_100000006 3300006931 Bacteria 421509
110 Ga0097620_100028907 3300006931 Bacteria 5560
111 Ga0097620_100288623 3300006931 Unclassified 1733
112 Ga0099824_1014579 3300006942 Bacteria 7751
113 Ga0079104_1000079 3300006946 Bacteria 141480
114 Ga0099826_10001967 3300006948 Bacteria 12887
115 Ga0105244_10000013 3300009036 Bacteria 258350
116 Ga0105250_10003528 3300009092 Bacteria 7376
117 Ga0105250_10017310 3300009092 Bacteria 2931
118 Ga0105240_10012464 3300009093 Bacteria 11730
119 Ga0105240_10014907 3300009093 Bacteria 10589
120 Ga0105240_10054067 3300009093 Bacteria 5034
121 Ga0105240_10188674 3300009093 Bacteria 2426
122 Ga0105247_10003395 3300009101 Bacteria 10415
123 Ga0105243_10000416 3300009148 Bacteria 44803
124 Ga0105243_10254848 3300009148 Bacteria 1568
125 Ga0105241_10002398 3300009174 Bacteria 14076
126 Ga0105241_10004171 3300009174 Bacteria 10671
127 Ga0105241_10141537 3300009174 Bacteria 1959
128 Ga0105242_10046774 3300009176 Unclassified 3511
129 Ga0105242_10087583 3300009176 Bacteria 2614
130 Ga0105242_10198095 3300009176 Bacteria 1782
131 Ga0105242_10260118 3300009176 Bacteria 1567
132 Ga0105242_10278139 3300009176 Bacteria 1519
133 Ga0105237_10010099 3300009545 Bacteria 10068
134 Ga0105237_10016270 3300009545 Bacteria 7731
135 Ga0105237_10134018 3300009545 Bacteria 2472
136 Ga0105237_10663877 3300009545 Bacteria 1049
137 Ga0105249_10000514 3300009553 Bacteria 35783
138 Ga0105249_10003735 3300009553 Bacteria 13135
139 Ga0105249_10045567 3300009553 Bacteria 3989
140 Ga0105249_10518733 3300009553 Unclassified 1239
141 Ga0105239_10000002 3300010375 Bacteria 610298
142 Ga0105239_10000006 3300010375 Bacteria 442319
143 Ga0105239_10144574 3300010375 Bacteria 2652
144 Ga0105246_10078917 3300011119 Bacteria 2339
145 Ga0105246_10139401 3300011119 Bacteria 1822
146 Ga0157373_10000017 3300013100 Bacteria 173186
147 Ga0157373_10000035 3300013100 Bacteria 123284
148 Ga0157373_10024983 3300013100 Bacteria 4325
149 Ga0157371_10000269 3300013102 Bacteria 70787
150 Ga0157371_10001621 3300013102 Bacteria 23010
151 Ga0157371_10049232 3300013102 Bacteria 2994
152 Ga0157370_10000334 3300013104 Bacteria 59226
153 Ga0157370_10000844 3300013104 Bacteria 38898
154 Ga0157370_10001492 3300013104 Bacteria 28987
155 Ga0157370_10002126 3300013104 Bacteria 24195
156 Ga0157370_10003337 3300013104 Bacteria 18911
157 Ga0157370_10011599 3300013104 Bacteria 9200
158 Ga0157370_10021334 3300013104 Bacteria 6454
159 Ga0157370_10041718 3300013104 Bacteria 4424
160 Ga0157370_10213840 3300013104 Bacteria 1786
161 Ga0157370_10386939 3300013104 Unclassified 1288
162 Ga0157369_10000136 3300013105 Bacteria 104612
163 Ga0157369_10000235 3300013105 Bacteria 76779
164 Ga0157369_10012411 3300013105 Bacteria 9671
165 Ga0157369_10107756 3300013105 Bacteria 2964
166 Ga0157369_10191244 3300013105 Bacteria 2150
167 Ga0157374_10000498 3300013296 Bacteria 35652
168 Ga0157374_10017006 3300013296 Bacteria 6403
169 Ga0157374_10122394 3300013296 Bacteria 2512
170 Ga0157374_10350657 3300013296 Bacteria 1466
171 Ga0157378_10005867 3300013297 Bacteria 10757
172 Ga0157378_10020619 3300013297 Bacteria 5797
173 Ga0157378_10026055 3300013297 Bacteria 5154
174 Ga0157378_10465108 3300013297 Unclassified 1257
175 Ga0163162_10000504 3300013306 Bacteria 36390
176 Ga0163162_10000905 3300013306 Bacteria 27617
177 Ga0163162_10018680 3300013306 Bacteria 6792
178 Ga0163162_10033233 3300013306 Bacteria 5124
179 Ga0163162_10111313 3300013306 Bacteria 2835
180 Ga0163162_10567600 3300013306 Bacteria 1262
181 Ga0163162_10646184 3300013306 Bacteria 1182
182 Ga0157372_10000009 3300013307 Bacteria 302051
183 Ga0157372_10001087 3300013307 Bacteria 29605
184 Ga0157372_10291391 3300013307 Bacteria 1898
185 Ga0157372_10349014 3300013307 Bacteria 1724
186 Ga0157375_10000334 3300013308 Bacteria 42495
187 Ga0157375_10000476 3300013308 Bacteria 36510
188 Ga0157375_10072718 3300013308 Bacteria 3456
189 Ga0157375_10164053 3300013308 Bacteria 2365
190 Ga0157375_10183021 3300013308 Bacteria 2248
191 Ga0163163_10004719 3300014325 Bacteria 11678
192 Ga0163163_10105809 3300014325 Bacteria 2839
193 Ga0182008_10000036 3300014497 Bacteria 130349
194 Ga0157377_10071938 3300014745 Bacteria 2001
195 Ga0157379_10000114 3300014968 Bacteria 55633
196 Ga0157379_10095897 3300014968 Bacteria 2662
197 Ga0157379_10284757 3300014968 Unclassified 1504
198 Ga0157376_10000571 3300014969 Bacteria 23715
199 Ga0157376_10000596 3300014969 Bacteria 23325
200 Ga0157376_10030268 3300014969 Bacteria 4321
201 Ga0157376_10415363 3300014969 Bacteria 1304
202 Ga0182006_1000001 3300015261 Bacteria 1091090
203 Ga0182006_1002746 3300015261 Bacteria 9431
204 Ga0182006_1016041 3300015261 Bacteria 3201
205 Ga0163161_10005361 3300017792 Bacteria 8914
206 Ga0163161_10026385 3300017792 Bacteria 4115
207 Ga0163161_10027825 3300017792 Unclassified 4011
208 Ga0163161_10032934 3300017792 Bacteria 3702
209 Ga0163161_10052451 3300017792 Bacteria 2956
210 Ga0163161_10152920 3300017792 Bacteria 1754
211 Ga0163161_10206963 3300017792 Bacteria 1514
212 Ga0213876_10016894 3300021384 Bacteria 3856
213 Ga0207427_100093 3300025231 Bacteria 125910
214 Ga0209437_100008 3300025233 Bacteria 921142
215 Ga0209026_1002432 3300025250 Bacteria 7004
216 Ga0209233_1000024 3300025261 Bacteria 695418
217 Ga0209233_1001440 3300025261 Bacteria 9392
218 Ga0209675_1000034 3300025291 Bacteria 267827
219 Ga0207656_10003101 3300025321 Bacteria 5689
220 Ga0207656_10126162 3300025321 Bacteria 1196
221 Ga0207696_1011515 3300025711 Bacteria 3178
222 Ga0207655_1000031 3300025728 Bacteria 392265
223 Ga0207642_10065770 3300025899 Bacteria 1705
224 Ga0207688_10021799 3300025901 Bacteria 3503
225 Ga0207680_10000477 3300025903 Bacteria 18937
226 Ga0207680_10098854 3300025903 Bacteria 1871
227 Ga0207647_10000463 3300025904 Bacteria 32923
228 Ga0207647_10089267 3300025904 Bacteria 1840
229 Ga0207645_10000631 3300025907 Bacteria 29230
230 Ga0207645_10006683 3300025907 Bacteria 8237
231 Ga0207645_10064024 3300025907 Bacteria 2350
232 Ga0207643_10010665 3300025908 Bacteria 4952
233 Ga0207705_10092508 3300025909 Bacteria 2216
234 Ga0207705_10115262 3300025909 Bacteria 1988
235 Ga0207705_10243116 3300025909 Bacteria 1371
236 Ga0207654_10003746 3300025911 Bacteria 7669
237 Ga0207654_10075746 3300025911 Bacteria 2012
238 Ga0207707_10000611 3300025912 Bacteria 35815
239 Ga0207695_10043574 3300025913 Bacteria 4782
240 Ga0207695_10044680 3300025913 Bacteria 4709
241 Ga0207671_10000901 3300025914 Bacteria 37526
242 Ga0207671_10004440 3300025914 Bacteria 13411
243 Ga0207660_10012546 3300025917 Bacteria 5548
244 Ga0207657_10102049 3300025919 Bacteria 2380
245 Ga0207649_10156745 3300025920 Bacteria 1574
246 Ga0207652_10037362 3300025921 Bacteria 4110
247 Ga0207652_10075892 3300025921 Bacteria 2930
248 Ga0207681_10105412 3300025923 Bacteria 2041
249 Ga0207650_10196671 3300025925 Bacteria 1613
250 Ga0207650_10202701 3300025925 Bacteria 1590
251 Ga0207650_10219815 3300025925 Bacteria 1528
252 Ga0207650_10221907 3300025925 Bacteria 1521
253 Ga0207650_10262289 3300025925 Bacteria 1402
254 Ga0207659_10047244 3300025926 Bacteria 3044
255 Ga0207690_10000770 3300025932 Bacteria 20723
256 Ga0207706_10267843 3300025933 Bacteria 1491
257 Ga0207686_10139000 3300025934 Bacteria 1676
258 Ga0207709_10000216 3300025935 Bacteria 73193
259 Ga0207709_10160222 3300025935 Bacteria 1568
260 Ga0207704_10000928 3300025938 Bacteria 12957
261 Ga0207691_10000067 3300025940 Bacteria 84512
262 Ga0207691_10094598 3300025940 Bacteria 2673
263 Ga0207689_10000466 3300025942 Bacteria 37961
264 Ga0207689_10000822 3300025942 Bacteria 29903
265 Ga0207689_10004188 3300025942 Bacteria 13113
266 Ga0207679_10066637 3300025945 Bacteria 2699
267 Ga0207667_10073635 3300025949 Bacteria 3549
268 Ga0207667_10219840 3300025949 Bacteria 1946
269 Ga0207651_10013729 3300025960 Bacteria 4648
270 Ga0207651_10093510 3300025960 Bacteria 2208
271 Ga0207712_10002681 3300025961 Bacteria 11372
272 Ga0207712_10066122 3300025961 Bacteria 2583
273 Ga0207668_10004205 3300025972 Bacteria 8443
274 Ga0207658_10002592 3300025986 Bacteria 13130
275 Ga0207658_10004922 3300025986 Bacteria 9212
276 Ga0207658_10027154 3300025986 Bacteria 4020
277 Ga0207677_10000704 3300026023 Bacteria 19842
278 Ga0207677_10029370 3300026023 Bacteria 3493
279 Ga0207677_10033614 3300026023 Bacteria 3311
280 Ga0207677_10124907 3300026023 Bacteria 1943
281 Ga0207703_10006122 3300026035 Bacteria 9629
282 Ga0207639_10022439 3300026041 Bacteria 4547
283 Ga0207639_10193811 3300026041 Bacteria 1738
284 Ga0207678_10024761 3300026067 Bacteria 5240
285 Ga0207702_10000140 3300026078 Bacteria 87544
286 Ga0207641_10000186 3300026088 Bacteria 86601
287 Ga0207641_10001302 3300026088 Bacteria 24754
288 Ga0207641_10014663 3300026088 Bacteria 6427
289 Ga0207641_10333027 3300026088 Unclassified 1443
290 Ga0207648_10003938 3300026089 Bacteria 15449
291 Ga0207648_10004023 3300026089 Bacteria 15260
292 Ga0207648_10274131 3300026089 Unclassified 1508
293 Ga0207648_10323286 3300026089 Bacteria 1387
294 Ga0207676_10000785 3300026095 Bacteria 24783
295 Ga0207676_10006443 3300026095 Bacteria 8292
296 Ga0207676_10131584 3300026095 Bacteria 2128
297 Ga0207674_10054578 3300026116 Bacteria 4067
298 Ga0207675_100016499 3300026118 Bacteria 6896
299 Ga0207675_100018172 3300026118 Bacteria 6556
300 Ga0207675_100087005 3300026118 Bacteria 2934
301 Ga0207683_10005934 3300026121 Bacteria 10469
302 Ga0207683_10099198 3300026121 Bacteria 2599
303 Ga0207683_10302174 3300026121 Bacteria 1464
304 Ga0207698_10002015 3300026142 Bacteria 11981
305 Ga0209281_1000367 3300027111 Bacteria 73152
306 Ga0209489_112459 3300027361 Bacteria 7706
307 Ga0209995_1014177 3300027471 Bacteria 1307
308 Ga0209968_1003348 3300027526 Bacteria 2407
309 Ga0209282_1004798 3300027666 Bacteria 8199
310 Ga0268266_10065272 3300028379 Bacteria 3147
311 Ga0268264_10006912 3300028381 Bacteria 9522
312 Ga0268264_10026202 3300028381 Bacteria 4762
313 Ga0307515_10000001 3300028794 Bacteria 4259510
314 Ga0307515_10000021 3300028794 Bacteria 406008
315 Ga0307515_10000790 3300028794 Bacteria 72891
316 Ga0307515_10001523 3300028794 Bacteria 51822
317 Ga0307511_10000104 3300030521 Bacteria 75069
318 Ga0265327_10000410 3300031251 Bacteria 78900
319 Ga0265327_10013057 3300031251 Bacteria 5547
320 Ga0265327_10059149 3300031251 Bacteria 1964
321 Ga0265327_10099455 3300031251 Unclassified 1406
322 Ga0307509_10002733 3300031507 Bacteria 28113
323 Ga0307412_10000006 3300031911 Bacteria 506878
324 Ga0307412_10000215 3300031911 Bacteria 39239
325 Ga0307412_10004489 3300031911 Bacteria 7777
326 Ga0307416_100000016 3300032002 Bacteria 205465
327 Ga0307416_100000066 3300032002 Bacteria 94549
328 Ga0307414_10000224 3300032004 Bacteria 37374
329 Ga0307414_10031072 3300032004 Bacteria 3498
330 Ga0307414_10070071 3300032004 Bacteria 2523
331 Ga0307507_10000078 3300033179 Bacteria 151026
332 Ga0373927_0107847 3300035695 Bacteria 1814
333 Ga0373937_0398207 3300036401 Bacteria 1306
334 Ga0395899_0000001 3300037312 Bacteria 1750322
335 Ga0395899_0002957 3300037312 Bacteria 13598
336 Ga0395901_0276149 3300038443 Bacteria 1747
337 Ga0436365_0130893 3300039437 Bacteria 2491
338 Ga0436365_0905676 3300039437 Bacteria 4050
339 Ga0439465_0000003 3300041413 Bacteria 72076
340 Ga0439445_0000784 3300042004 Bacteria 6678
341 Ga0466966_0014474 3300044684 Bacteria 5221
342 Ga0466961_0185365 3300044693 Bacteria 1291
343 Ga0466959_0051529 3300045049 Bacteria 3018
344 Ga0495627_000030 3300046453 Bacteria 228883
345 Ga0495627_003089 3300046453 Bacteria 7559
346 Ga0495650_0025026 3300046471 Bacteria 2808
347 Ga0495650_0027320 3300046471 Bacteria 2639
348 Ga0495580_0103587 3300046472 Bacteria 1978
349 Ga0495580_0136953 3300046472 Bacteria 1698
350 Ga0495662_0151620 3300046476 Bacteria 1142
351 Ga0495585_0001288 3300046492 Bacteria 19979
352 Ga0495596_0003279 3300046500 Bacteria 8266
353 Ga0495606_0004317 3300046507 Bacteria 14307
354 Ga0495606_0005407 3300046507 Bacteria 12239
355 Ga0495606_0011271 3300046507 Bacteria 7313
356 Ga0495610_0000036 3300046512 Bacteria 186904
357 Ga0495628_0092528 3300046516 Bacteria 2339
358 Ga0495632_0009960 3300046519 Bacteria 5674
359 Ga0495644_0001493 3300046523 Bacteria 9535
360 Ga0495648_0005741 3300046524 Bacteria 10240
361 Ga0495663_0000014 3300046525 Bacteria 149657
362 Ga0495642_0073386 3300046528 Bacteria 1434
363 Ga0495654_0000142 3300046530 Bacteria 74610
364 Ga0495654_0051002 3300046530 Bacteria 2020
365 Ga0495609_0000137 3300046538 Bacteria 77538
366 Ga0495609_0024823 3300046538 Bacteria 2748
367 Ga0495622_0096016 3300046557 Bacteria 1360
368 Ga0495633_0000001 3300046558 Bacteria 801972
369 Ga0495633_0000074 3300046558 Bacteria 130197
370 Ga0495633_0001351 3300046558 Bacteria 19221
371 Ga0495668_0000017 3300046616 Bacteria 434025
372 Ga0495625_0000435 3300046660 Bacteria 62758
373 Ga0495625_0000818 3300046660 Bacteria 42880
374 Ga0495625_0001213 3300046660 Bacteria 32692
375 Ga0495625_0034761 3300046660 Bacteria 3718
376 Ga0495625_0248550 3300046660 Bacteria 1155
377 Ga0495661_0008787 3300046665 Bacteria 6969
378 Ga0495661_0021254 3300046665 Bacteria 4233
379 Ga0495658_0005676 3300046683 Bacteria 6131
380 Ga0495658_0046684 3300046683 Bacteria 2436
381 Ga0495624_0117151 3300046690 Bacteria 1637
382 Ga0495660_0095783 3300046810 Bacteria 1535
383 Ga0495672_0035325 3300047320 Bacteria 3079
384 Ga0495672_0071253 3300047320 Bacteria 1967
385 Ga0495686_0000327 3300047472 Bacteria 78430
386 Ga0495686_0001184 3300047472 Bacteria 30421
387 Ga0495614_0038317 3300048089 Bacteria 2057
388 Ga0496106_0525533 3300048909 Bacteria 950
389 Ga0496108_0101319 3300048911 Bacteria 2457
390 Ga0496113_0328962 3300048916 Bacteria 1225
391 Ga0496115_0133411 3300048918 Unclassified 2047
392 Ga0496116_0000002 3300048919 Bacteria 920291
393 Ga0496116_0000068 3300048919 Bacteria 259724
394 Ga0496117_0000062 3300048920 Bacteria 257535
395 Ga0496117_0055618 3300048920 Bacteria 2764
396 Ga0496118_0000113 3300048921 Bacteria 150726
397 Ga0496118_0034877 3300048921 Bacteria 4097
398 Ga0496119_0000024 3300048922 Bacteria 257750
399 Ga0496121_0071173 3300048924 Bacteria 2798
400 Ga0496122_0000245 3300048925 Bacteria 121737
401 Ga0496122_0000530 3300048925 Bacteria 79156
402 Ga0496122_0001937 3300048925 Bacteria 31087
403 Ga0496122_0002619 3300048925 Bacteria 25205
404 Ga0496122_0007266 3300048925 Bacteria 12387
405 Ga0496123_0000474 3300048926 Bacteria 69869
406 Ga0496123_0005619 3300048926 Bacteria 12529
407 Ga0496123_0044027 3300048926 Bacteria 3057
408 Ga0496124_0001349 3300048927 Bacteria 36791
409 Ga0496124_0014480 3300048927 Bacteria 7625
410 Ga0496125_0000024 3300048928 Bacteria 442149
411 Ga0496125_0000108 3300048928 Bacteria 196060
412 Ga0496125_0000454 3300048928 Bacteria 73947
413 Ga0496125_0021680 3300048928 Bacteria 5981
414 Ga0496125_0120072 3300048928 Bacteria 1877
415 Ga0496126_0000957 3300048929 Bacteria 49532
416 Ga0496126_0017909 3300048929 Bacteria 7048
417 Ga0495682_0005922 3300049460 Bacteria 5014
418 Ga0501034_0000002 3300049571 Bacteria 565510
419 Ga0501034_0061672 3300049571 Bacteria 3765
420 Ga0501034_0322880 3300049571 Bacteria 1476
421 Ga0501036_0174381 3300049572 Bacteria 1811
422 Ga0501043_0076249 3300049579 Bacteria 2634
423 Ga0501047_0055092 3300049581 Bacteria 3846
424 Ga0501069_0148885 3300049585 Bacteria 1344
425 Ga0501070_0062857 3300049586 Bacteria 3076
426 Ga0501074_0243011 3300049590 Bacteria 1280
427 Ga0501080_0156135 3300049742 Bacteria 2108
428 Ga0501083_0137613 3300049744 Bacteria 1599
429 Ga0501241_000004 3300049758 Bacteria 177326
430 Ga0501269_000218 3300049766 Bacteria 16758
431 Ga0501044_0039123 3300049823 Bacteria 4949
432 nmdc:mga0k408_323_c1 3300050493 Bacteria 26051
433 nmdc:mga0k408_424_c1 3300050493 Bacteria 23079
434 nmdc:mga0k408_8795_c1 3300050493 Bacteria 5433
435 Ga0500635_0003493 3300053080 Bacteria 3963
436 Ga0500583_0000075 3300053092 Bacteria 59561
437 Ga0500618_000020 3300053125 Bacteria 161356
438 Ga0500658_0055825 3300053134 Bacteria 1627
439 Ga0500622_0000719 3300053156 Bacteria 28939
440 Ga0501084_0113903 3300054114 Bacteria 2273
441 Ga0501082_0014134 3300060353 Bacteria 6869

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044693 Ga0466961_0185365 Ga0466961_0185365_130_948 259
2 3300046557 Ga0495622_0096016 Ga0495622_0096016_506_1330 262
3 3300046660 Ga0495625_0034761 Ga0495625_0034761_2828_3658 262
4 3300046472 Ga0495580_0136953 Ga0495580_0136953_60_929 275
5 3300046476 Ga0495662_0151620 Ga0495662_0151620_198_1067 275
6 3300048909 Ga0496106_0525533 Ga0496106_0525533_27_896 275
7 3300049585 Ga0501069_0148885 Ga0501069_0148885_461_1330 275
8 3300041413 Ga0439465_0000003 Ga0439465_0000003_38618_39517 286
9 3300046660 Ga0495625_0248550 Ga0495625_0248550_165_1067 293
10 3300047320 Ga0495672_0071253 Ga0495672_0071253_994_1923 295
11 3300031911 Ga0307412_10000215 Ga0307412_100002153 300
12 3300026121 Ga0207683_10302174 Ga0207683_103021742 301
13 3300005289 Ga0065704_10072550 Ga0065704_100725505 304
14 3300017792 Ga0163161_10005361 Ga0163161_100053612 305
15 3300005344 Ga0070661_100156522 Ga0070661_1001565222 306
16 3300025920 Ga0207649_10156745 Ga0207649_101567451 307
17 3300049571 Ga0501034_0000002 Ga0501034_0000002_191338_192351 308
18 3300013296 Ga0157374_10017006 Ga0157374_100170064 309
19 3300025940 Ga0207691_10094598 Ga0207691_100945983 312
20 3300046471 Ga0495650_0025026 Ga0495650_0025026_1358_2374 314
21 3300013100 Ga0157373_10000017 Ga0157373_10000017134 318
22 3300014497 Ga0182008_10000036 Ga0182008_1000003634 318
23 3300032004 Ga0307414_10000224 Ga0307414_1000022426 318
24 3300046525 Ga0495663_0000014 Ga0495663_0000014_134469_135464 318
25 3300049758 Ga0501241_000004 Ga0501241_000004_137683_138678 318
26 3300049766 Ga0501269_000218 Ga0501269_000218_8617_9612 318
27 3300009148 Ga0105243_10000416 Ga0105243_1000041620 320
28 3300025935 Ga0207709_10000216 Ga0207709_1000021649 320
29 3300048925 Ga0496122_0000245 Ga0496122_0000245_86163_87158 320
30 3300048926 Ga0496123_0005619 Ga0496123_0005619_7429_8424 320
31 3300013102 Ga0157371_10049232 Ga0157371_100492323 321
32 iso_pu_bacteria 2511231000 2511233461 321
33 iso_pu_bacteria 2519899754 2520880502 321
34 iso_pu_bacteria 2582581278 2585141914 321
35 iso_pu_bacteria 2582581281 2585157746 321
36 iso_pu_bacteria 2582581282 2585162121 321
37 iso_pu_bacteria 2582581873 2585426389 321
38 iso_pu_bacteria 2585428045 2587680351 321
39 iso_pu_bacteria 2585428060 2587747395 321
40 iso_pu_bacteria 2585428061 2587752816 321
41 iso_pu_bacteria 2585428095 2587866461 321
42 iso_pu_bacteria 2585428115 2587944729 321
43 iso_pu_bacteria 2585428183 2588216284 321
44 iso_pu_bacteria 2585428184 2588221146 321
45 iso_pu_bacteria 2585428187 2588231936 321
46 iso_pu_bacteria 2588253712 2588448065 321
47 iso_pu_bacteria 2588254255 2590604033 321
48 iso_pu_bacteria 2588254257 2590609344 321
49 iso_pu_bacteria 2643221600 2644012097 321
50 iso_pu_bacteria 2643221667 2644371323 321
51 iso_pu_bacteria 2643221716 2644641372 321
52 iso_pu_bacteria 2643221725 2644682508 321
53 iso_pu_bacteria 2728369107 2729203070 321
54 iso_pu_bacteria 2739367874 2740059626 321
55 iso_pu_bacteria 2751185877 2753674786 321
56 iso_pu_bacteria 2772190705 2772606156 321
57 iso_pu_bacteria 2775506739 2775675052 321
58 iso_pu_bacteria 2802428842 2802651281 321
59 iso_pu_bacteria 2816332280 2817414167 321
60 iso_pu_bacteria 2842083920 2842087106 321
61 iso_pu_bacteria 2871720351 2871721589 321
62 iso_pu_bacteria 2889290771 2889294641 321
63 iso_pu_bacteria 2903895155 2903895244 321
64 iso_pu_bacteria 2905999023 2906002754 321
65 iso_pu_bacteria 2919097161 2919100272 321
66 iso_pu_bacteria 2919191525 2919192437 321
67 iso_pu_bacteria 2919399522 2919402102 321
68 iso_pu_bacteria 2919683626 2919684156 321
69 iso_pu_bacteria 2929150217 2929151319 321
70 iso_pu_bacteria 2945924605 2945925526 321
71 iso_pu_bacteria 2946019816 2946023258 321
72 iso_pu_bacteria 2958458903 2958459591 321
73 iso_pu_bacteria 2958512119 2958512550 321
74 iso_pu_bacteria 2977243572 2977244362 321
75 iso_pu_bacteria 2977268062 2977272695 321
76 iso_pu_bacteria 2984572630 2984573750 321
77 iso_pu_bacteria 2984606641 2984607190 321
78 iso_pu_bacteria 2993372514 2993375832 321
79 iso_pu_bacteria 2993480792 2993482696 321
80 iso_pu_bacteria 8055419101 8055420086 321
81 iso_pu_bacteria 8055592153 8055596977 321
82 3300005614 Ga0068856_100020596 Ga0068856_1000205967 322
83 3300031251 Ga0265327_10013057 Ga0265327_100130575 322
84 3300001990 JGI24737J22298_10004123 JGI24737J22298_100041237 323
85 3300002737 JGI25162J39368_1001018 JGI25162J39368_10010189 323
86 3300003214 JGI25165J46597_1000957 JGI25165J46597_100095721 323
87 3300003323 rootH1_10000566 rootH1_10000566153 323
88 3300003323 rootH1_10030244 rootH1_100302442 323
89 3300005288 Ga0065714_10014223 Ga0065714_100142233 323
90 3300005288 Ga0065714_10097502 Ga0065714_100975022 323
91 3300005327 Ga0070658_10066481 Ga0070658_100664813 323
92 3300005327 Ga0070658_10141623 Ga0070658_101416232 323
93 3300005328 Ga0070676_10000262 Ga0070676_100002628 323
94 3300005328 Ga0070676_10058847 Ga0070676_100588472 323
95 3300005328 Ga0070676_10164203 Ga0070676_101642032 323
96 3300005331 Ga0070670_100033641 Ga0070670_1000336411 323
97 3300005331 Ga0070670_100120234 Ga0070670_1001202342 323
98 3300005331 Ga0070670_100256190 Ga0070670_1002561902 323
99 3300005331 Ga0070670_100291781 Ga0070670_1002917812 323
100 3300005331 Ga0070670_100344651 Ga0070670_1003446512 323
101 3300005334 Ga0068869_100093235 Ga0068869_1000932352 323
102 3300005335 Ga0070666_10000039 Ga0070666_1000003930 323
103 3300005335 Ga0070666_10013535 Ga0070666_100135352 323
104 3300005336 Ga0070680_100004495 Ga0070680_1000044954 323
105 3300005337 Ga0070682_100000106 Ga0070682_10000010611 323
106 3300005337 Ga0070682_100010447 Ga0070682_1000104474 323
107 3300005338 Ga0068868_100001486 Ga0068868_10000148614 323
108 3300005338 Ga0068868_100011655 Ga0068868_1000116556 323
109 3300005338 Ga0068868_100015137 Ga0068868_1000151375 323
110 3300005339 Ga0070660_100008755 Ga0070660_1000087557 323
111 3300005340 Ga0070689_100192275 Ga0070689_1001922752 323
112 3300005341 Ga0070691_10024066 Ga0070691_100240663 323
113 3300005347 Ga0070668_100000036 Ga0070668_10000003682 323
114 3300005347 Ga0070668_100085521 Ga0070668_1000855212 323
115 3300005354 Ga0070675_100086939 Ga0070675_1000869393 323
116 3300005355 Ga0070671_100118400 Ga0070671_1001184002 323
117 3300005355 Ga0070671_100162442 Ga0070671_1001624421 323
118 3300005355 Ga0070671_100379302 Ga0070671_1003793022 323
119 3300005364 Ga0070673_100000580 Ga0070673_1000005807 323
120 3300005364 Ga0070673_100201891 Ga0070673_1002018912 323
121 3300005366 Ga0070659_100001045 Ga0070659_10000104515 323
122 3300005367 Ga0070667_100000151 Ga0070667_10000015167 323
123 3300005367 Ga0070667_100008389 Ga0070667_1000083896 323
124 3300005367 Ga0070667_100015079 Ga0070667_1000150793 323
125 3300005455 Ga0070663_100013428 Ga0070663_1000134283 323
126 3300005457 Ga0070662_100001317 Ga0070662_1000013172 323
127 3300005458 Ga0070681_10035380 Ga0070681_100353801 323
128 3300005458 Ga0070681_10078206 Ga0070681_100782063 323
129 3300005459 Ga0068867_100001155 Ga0068867_10000115519 323
130 3300005459 Ga0068867_100017794 Ga0068867_1000177946 323
131 3300005459 Ga0068867_100021893 Ga0068867_1000218933 323
132 3300005530 Ga0070679_100002055 Ga0070679_10000205514 323
133 3300005530 Ga0070679_100097257 Ga0070679_1000972573 323
134 3300005530 Ga0070679_100267738 Ga0070679_1002677381 323
135 3300005539 Ga0068853_100010474 Ga0068853_1000104743 323
136 3300005539 Ga0068853_100026708 Ga0068853_1000267083 323
137 3300005539 Ga0068853_100096833 Ga0068853_1000968332 323
138 3300005543 Ga0070672_100000225 Ga0070672_1000002259 323
139 3300005563 Ga0068855_100387850 Ga0068855_1003878502 323
140 3300005577 Ga0068857_100013369 Ga0068857_1000133694 323
141 3300005614 Ga0068856_100000044 Ga0068856_10000004493 323
142 3300005614 Ga0068856_100240828 Ga0068856_1002408282 323
143 3300005616 Ga0068852_100091369 Ga0068852_1000913692 323
144 3300005616 Ga0068852_100117656 Ga0068852_1001176563 323
145 3300005617 Ga0068859_100000006 Ga0068859_100000006149 323
146 3300005617 Ga0068859_100028907 Ga0068859_1000289072 323
147 3300005617 Ga0068859_100288601 Ga0068859_1002886012 323
148 3300005618 Ga0068864_100001963 Ga0068864_10000196310 323
149 3300005618 Ga0068864_100008085 Ga0068864_1000080856 323
150 3300005618 Ga0068864_100247214 Ga0068864_1002472142 323
151 3300005834 Ga0068851_10000910 Ga0068851_1000091010 323
152 3300005834 Ga0068851_10006636 Ga0068851_100066362 323
153 3300005840 Ga0068870_10081869 Ga0068870_100818692 323
154 3300005841 Ga0068863_100000510 Ga0068863_10000051028 323
155 3300005841 Ga0068863_100000808 Ga0068863_1000008085 323
156 3300005841 Ga0068863_100009631 Ga0068863_1000096318 323
157 3300005842 Ga0068858_100004985 Ga0068858_1000049856 323
158 3300005842 Ga0068858_100079999 Ga0068858_1000799992 323
159 3300005842 Ga0068858_100249069 Ga0068858_1002490692 323
160 3300005842 Ga0068858_100336273 Ga0068858_1003362732 323
161 3300005843 Ga0068860_100004849 Ga0068860_1000048498 323
162 3300005843 Ga0068860_100008104 Ga0068860_1000081049 323
163 3300005843 Ga0068860_100008374 Ga0068860_1000083749 323
164 3300005843 Ga0068860_100048712 Ga0068860_1000487126 323
165 3300005843 Ga0068860_100076353 Ga0068860_1000763532 323
166 3300006195 Ga0075366_10000091 Ga0075366_100000913 323
167 3300006237 Ga0097621_100001898 Ga0097621_1000018987 323
168 3300006237 Ga0097621_100010967 Ga0097621_1000109672 323
169 3300006237 Ga0097621_100017257 Ga0097621_1000172575 323
170 3300006237 Ga0097621_100027628 Ga0097621_1000276285 323
171 3300006237 Ga0097621_100057664 Ga0097621_1000576643 323
172 3300006237 Ga0097621_100251812 Ga0097621_1002518122 323
173 3300006358 Ga0068871_100120227 Ga0068871_1001202271 323
174 3300006358 Ga0068871_100160150 Ga0068871_1001601503 323
175 3300006881 Ga0068865_100005575 Ga0068865_1000055755 323
176 3300006881 Ga0068865_100046368 Ga0068865_1000463683 323
177 3300006931 Ga0097620_100000006 Ga0097620_100000006149 323
178 3300006931 Ga0097620_100028907 Ga0097620_1000289072 323
179 3300006931 Ga0097620_100288623 Ga0097620_1002886232 323
180 3300009093 Ga0105240_10012464 Ga0105240_100124648 323
181 3300009093 Ga0105240_10014907 Ga0105240_100149072 323
182 3300009093 Ga0105240_10054067 Ga0105240_100540676 323
183 3300009093 Ga0105240_10188674 Ga0105240_101886741 323
184 3300009101 Ga0105247_10003395 Ga0105247_100033954 323
185 3300009174 Ga0105241_10002398 Ga0105241_1000239810 323
186 3300009174 Ga0105241_10004171 Ga0105241_1000417111 323
187 3300009174 Ga0105241_10141537 Ga0105241_101415373 323
188 3300009176 Ga0105242_10046774 Ga0105242_100467744 323
189 3300009176 Ga0105242_10087583 Ga0105242_100875833 323
190 3300009176 Ga0105242_10198095 Ga0105242_101980953 323
191 3300009176 Ga0105242_10260118 Ga0105242_102601182 323
192 3300009176 Ga0105242_10278139 Ga0105242_102781392 323
193 3300009545 Ga0105237_10010099 Ga0105237_1001009911 323
194 3300009545 Ga0105237_10016270 Ga0105237_100162707 323
195 3300009545 Ga0105237_10134018 Ga0105237_101340183 323
196 3300009545 Ga0105237_10663877 Ga0105237_106638771 323
197 3300009553 Ga0105249_10000514 Ga0105249_100005143 323
198 3300009553 Ga0105249_10003735 Ga0105249_100037356 323
199 3300009553 Ga0105249_10045567 Ga0105249_100455673 323
200 3300009553 Ga0105249_10518733 Ga0105249_105187332 323
201 3300010375 Ga0105239_10000002 Ga0105239_10000002290 323
202 3300010375 Ga0105239_10000006 Ga0105239_10000006194 323
203 3300010375 Ga0105239_10144574 Ga0105239_101445743 323
204 3300011119 Ga0105246_10078917 Ga0105246_100789173 323
205 3300011119 Ga0105246_10139401 Ga0105246_101394012 323
206 3300013100 Ga0157373_10024983 Ga0157373_100249833 323
207 3300013102 Ga0157371_10000269 Ga0157371_1000026922 323
208 3300013102 Ga0157371_10001621 Ga0157371_100016217 323
209 3300013104 Ga0157370_10002126 Ga0157370_100021263 323
210 3300013104 Ga0157370_10041718 Ga0157370_100417183 323
211 3300013104 Ga0157370_10213840 Ga0157370_102138402 323
212 3300013104 Ga0157370_10386939 Ga0157370_103869392 323
213 3300013105 Ga0157369_10012411 Ga0157369_100124118 323
214 3300013105 Ga0157369_10107756 Ga0157369_101077563 323
215 3300013105 Ga0157369_10191244 Ga0157369_101912443 323
216 3300013296 Ga0157374_10000498 Ga0157374_1000049828 323
217 3300013296 Ga0157374_10122394 Ga0157374_101223943 323
218 3300013296 Ga0157374_10350657 Ga0157374_103506572 323
219 3300013297 Ga0157378_10005867 Ga0157378_100058673 323
220 3300013297 Ga0157378_10020619 Ga0157378_100206197 323
221 3300013297 Ga0157378_10026055 Ga0157378_100260553 323
222 3300013297 Ga0157378_10465108 Ga0157378_104651082 323
223 3300013306 Ga0163162_10000504 Ga0163162_1000050430 323
224 3300013306 Ga0163162_10000905 Ga0163162_100009058 323
225 3300013306 Ga0163162_10018680 Ga0163162_100186803 323
226 3300013306 Ga0163162_10111313 Ga0163162_101113132 323
227 3300013306 Ga0163162_10567600 Ga0163162_105676002 323
228 3300013306 Ga0163162_10646184 Ga0163162_106461842 323
229 3300013307 Ga0157372_10000009 Ga0157372_10000009111 323
230 3300013307 Ga0157372_10001087 Ga0157372_100010875 323
231 3300013307 Ga0157372_10291391 Ga0157372_102913912 323
232 3300013307 Ga0157372_10349014 Ga0157372_103490142 323
233 3300013308 Ga0157375_10000476 Ga0157375_100004767 323
234 3300013308 Ga0157375_10072718 Ga0157375_100727182 323
235 3300013308 Ga0157375_10164053 Ga0157375_101640533 323
236 3300013308 Ga0157375_10183021 Ga0157375_101830213 323
237 3300014325 Ga0163163_10004719 Ga0163163_100047198 323
238 3300014325 Ga0163163_10105809 Ga0163163_101058093 323
239 3300014745 Ga0157377_10071938 Ga0157377_100719382 323
240 3300014968 Ga0157379_10000114 Ga0157379_1000011426 323
241 3300014968 Ga0157379_10095897 Ga0157379_100958972 323
242 3300014968 Ga0157379_10284757 Ga0157379_102847572 323
243 3300014969 Ga0157376_10000571 Ga0157376_1000057113 323
244 3300014969 Ga0157376_10000596 Ga0157376_1000059616 323
245 3300014969 Ga0157376_10030268 Ga0157376_100302683 323
246 3300014969 Ga0157376_10415363 Ga0157376_104153631 323
247 3300017792 Ga0163161_10026385 Ga0163161_100263853 323
248 3300017792 Ga0163161_10152920 Ga0163161_101529202 323
249 3300021384 Ga0213876_10016894 Ga0213876_100168945 323
250 3300025231 Ga0207427_100093 Ga0207427_10009366 323
251 3300025233 Ga0209437_100008 Ga0209437_100008484 323
252 3300025250 Ga0209026_1002432 Ga0209026_10024322 323
253 3300025261 Ga0209233_1000024 Ga0209233_1000024173 323
254 3300025261 Ga0209233_1001440 Ga0209233_10014403 323
255 3300025321 Ga0207656_10003101 Ga0207656_100031013 323
256 3300025321 Ga0207656_10126162 Ga0207656_101261622 323
257 3300025899 Ga0207642_10065770 Ga0207642_100657702 323
258 3300025901 Ga0207688_10021799 Ga0207688_100217993 323
259 3300025903 Ga0207680_10000477 Ga0207680_100004773 323
260 3300025903 Ga0207680_10098854 Ga0207680_100988542 323
261 3300025904 Ga0207647_10000463 Ga0207647_1000046334 323
262 3300025904 Ga0207647_10089267 Ga0207647_100892672 323
263 3300025907 Ga0207645_10000631 Ga0207645_1000063114 323
264 3300025907 Ga0207645_10006683 Ga0207645_100066832 323
265 3300025907 Ga0207645_10064024 Ga0207645_100640242 323
266 3300025908 Ga0207643_10010665 Ga0207643_100106654 323
267 3300025909 Ga0207705_10092508 Ga0207705_100925081 323
268 3300025909 Ga0207705_10115262 Ga0207705_101152622 323
269 3300025909 Ga0207705_10243116 Ga0207705_102431162 323
270 3300025911 Ga0207654_10003746 Ga0207654_100037462 323
271 3300025911 Ga0207654_10075746 Ga0207654_100757462 323
272 3300025912 Ga0207707_10000611 Ga0207707_1000061124 323
273 3300025913 Ga0207695_10043574 Ga0207695_100435745 323
274 3300025913 Ga0207695_10044680 Ga0207695_100446803 323
275 3300025914 Ga0207671_10000901 Ga0207671_1000090114 323
276 3300025914 Ga0207671_10004440 Ga0207671_100044406 323
277 3300025917 Ga0207660_10012546 Ga0207660_100125463 323
278 3300025919 Ga0207657_10102049 Ga0207657_101020493 323
279 3300025921 Ga0207652_10037362 Ga0207652_100373621 323
280 3300025921 Ga0207652_10075892 Ga0207652_100758923 323
281 3300025923 Ga0207681_10105412 Ga0207681_101054121 323
282 3300025925 Ga0207650_10196671 Ga0207650_101966712 323
283 3300025925 Ga0207650_10202701 Ga0207650_102027013 323
284 3300025925 Ga0207650_10219815 Ga0207650_102198152 323
285 3300025925 Ga0207650_10221907 Ga0207650_102219072 323
286 3300025925 Ga0207650_10262289 Ga0207650_102622892 323
287 3300025926 Ga0207659_10047244 Ga0207659_100472442 323
288 3300025932 Ga0207690_10000770 Ga0207690_1000077011 323
289 3300025933 Ga0207706_10267843 Ga0207706_102678432 323
290 3300025934 Ga0207686_10139000 Ga0207686_101390002 323
291 3300025938 Ga0207704_10000928 Ga0207704_1000092810 323
292 3300025940 Ga0207691_10000067 Ga0207691_1000006734 323
293 3300025942 Ga0207689_10000466 Ga0207689_1000046632 323
294 3300025942 Ga0207689_10000822 Ga0207689_1000082215 323
295 3300025942 Ga0207689_10004188 Ga0207689_100041887 323
296 3300025945 Ga0207679_10066637 Ga0207679_100666373 323
297 3300025949 Ga0207667_10073635 Ga0207667_100736353 323
298 3300025949 Ga0207667_10219840 Ga0207667_102198403 323
299 3300025960 Ga0207651_10013729 Ga0207651_100137293 323
300 3300025960 Ga0207651_10093510 Ga0207651_100935102 323
301 3300025961 Ga0207712_10002681 Ga0207712_100026814 323
302 3300025961 Ga0207712_10066122 Ga0207712_100661223 323
303 3300025972 Ga0207668_10004205 Ga0207668_100042054 323
304 3300025986 Ga0207658_10002592 Ga0207658_1000259210 323
305 3300025986 Ga0207658_10004922 Ga0207658_100049224 323
306 3300025986 Ga0207658_10027154 Ga0207658_100271543 323
307 3300026023 Ga0207677_10000704 Ga0207677_1000070410 323
308 3300026023 Ga0207677_10029370 Ga0207677_100293704 323
309 3300026023 Ga0207677_10033614 Ga0207677_100336143 323
310 3300026023 Ga0207677_10124907 Ga0207677_101249073 323
311 3300026035 Ga0207703_10006122 Ga0207703_100061225 323
312 3300026041 Ga0207639_10022439 Ga0207639_100224395 323
313 3300026041 Ga0207639_10193811 Ga0207639_101938112 323
314 3300026067 Ga0207678_10024761 Ga0207678_100247614 323
315 3300026078 Ga0207702_10000140 Ga0207702_1000014074 323
316 3300026088 Ga0207641_10000186 Ga0207641_1000018665 323
317 3300026088 Ga0207641_10001302 Ga0207641_100013029 323
318 3300026088 Ga0207641_10014663 Ga0207641_100146635 323
319 3300026088 Ga0207641_10333027 Ga0207641_103330272 323
320 3300026089 Ga0207648_10003938 Ga0207648_1000393813 323
321 3300026089 Ga0207648_10004023 Ga0207648_100040239 323
322 3300026089 Ga0207648_10274131 Ga0207648_102741312 323
323 3300026089 Ga0207648_10323286 Ga0207648_103232862 323
324 3300026095 Ga0207676_10000785 Ga0207676_1000078515 323
325 3300026095 Ga0207676_10006443 Ga0207676_100064436 323
326 3300026095 Ga0207676_10131584 Ga0207676_101315842 323
327 3300026116 Ga0207674_10054578 Ga0207674_100545783 323
328 3300026118 Ga0207675_100016499 Ga0207675_1000164997 323
329 3300026118 Ga0207675_100018172 Ga0207675_1000181723 323
330 3300026118 Ga0207675_100087005 Ga0207675_1000870053 323
331 3300026121 Ga0207683_10005934 Ga0207683_100059347 323
332 3300026121 Ga0207683_10099198 Ga0207683_100991983 323
333 3300026142 Ga0207698_10002015 Ga0207698_100020159 323
334 3300028379 Ga0268266_10065272 Ga0268266_100652722 323
335 3300028381 Ga0268264_10006912 Ga0268264_100069128 323
336 3300028381 Ga0268264_10026202 Ga0268264_100262024 323
337 3300028794 Ga0307515_10000001 Ga0307515_100000012394 323
338 3300028794 Ga0307515_10000021 Ga0307515_1000002164 323
339 3300028794 Ga0307515_10000790 Ga0307515_1000079027 323
340 3300028794 Ga0307515_10001523 Ga0307515_1000152312 323
341 3300030521 Ga0307511_10000104 Ga0307511_100001045 323
342 3300031251 Ga0265327_10000410 Ga0265327_1000041054 323
343 3300031251 Ga0265327_10059149 Ga0265327_100591493 323
344 3300031251 Ga0265327_10099455 Ga0265327_100994551 323
345 3300031507 Ga0307509_10002733 Ga0307509_1000273310 323
346 3300033179 Ga0307507_10000078 Ga0307507_10000078102 323
347 3300035695 Ga0373927_0107847 Ga0373927_0107847_489_1502 323
348 3300036401 Ga0373937_0398207 Ga0373937_0398207_115_1131 323
349 3300037312 Ga0395899_0000001 Ga0395899_0000001_1227969_1228982 323
350 3300037312 Ga0395899_0002957 Ga0395899_0002957_9068_10081 323
351 3300038443 Ga0395901_0276149 Ga0395901_0276149_569_1585 323
352 3300039437 Ga0436365_0130893 Ga0436365_0130893_1074_2087 323
353 3300039437 Ga0436365_0905676 Ga0436365_0905676_1315_2328 323
354 3300044684 Ga0466966_0014474 Ga0466966_0014474_219_1232 323
355 3300045049 Ga0466959_0051529 Ga0466959_0051529_439_1452 323
356 3300046471 Ga0495650_0027320 Ga0495650_0027320_184_1203 323
357 3300046472 Ga0495580_0103587 Ga0495580_0103587_722_1738 323
358 3300046492 Ga0495585_0001288 Ga0495585_0001288_9058_10068 323
359 3300046507 Ga0495606_0011271 Ga0495606_0011271_1529_2539 323
360 3300046516 Ga0495628_0092528 Ga0495628_0092528_898_1908 323
361 3300046523 Ga0495644_0001493 Ga0495644_0001493_2301_3311 323
362 3300046524 Ga0495648_0005741 Ga0495648_0005741_6832_7842 323
363 3300046528 Ga0495642_0073386 Ga0495642_0073386_232_1248 323
364 3300046530 Ga0495654_0051002 Ga0495654_0051002_827_1837 323
365 3300046538 Ga0495609_0024823 Ga0495609_0024823_1257_2267 323
366 3300046558 Ga0495633_0000074 Ga0495633_0000074_124451_125461 323
367 3300046616 Ga0495668_0000017 Ga0495668_0000017_269164_270174 323
368 3300046660 Ga0495625_0000435 Ga0495625_0000435_16928_17938 323
369 3300046660 Ga0495625_0001213 Ga0495625_0001213_30063_31073 323
370 3300046665 Ga0495661_0008787 Ga0495661_0008787_2088_3098 323
371 3300046665 Ga0495661_0021254 Ga0495661_0021254_304_1314 323
372 3300046683 Ga0495658_0005676 Ga0495658_0005676_4275_5285 323
373 3300046683 Ga0495658_0046684 Ga0495658_0046684_856_1872 323
374 3300046690 Ga0495624_0117151 Ga0495624_0117151_267_1283 323
375 3300046810 Ga0495660_0095783 Ga0495660_0095783_420_1430 323
376 3300047320 Ga0495672_0035325 Ga0495672_0035325_1754_2770 323
377 3300047472 Ga0495686_0001184 Ga0495686_0001184_17468_18484 323
378 3300048089 Ga0495614_0038317 Ga0495614_0038317_166_1176 323
379 3300048911 Ga0496108_0101319 Ga0496108_0101319_514_1530 323
380 3300048918 Ga0496115_0133411 Ga0496115_0133411_380_1396 323
381 3300049460 Ga0495682_0005922 Ga0495682_0005922_2469_3479 323
382 3300049586 Ga0501070_0062857 Ga0501070_0062857_303_1319 323
383 3300049590 Ga0501074_0243011 Ga0501074_0243011_108_1124 323
384 3300049742 Ga0501080_0156135 Ga0501080_0156135_157_1173 323
385 3300049744 Ga0501083_0137613 Ga0501083_0137613_426_1442 323
386 3300049823 Ga0501044_0039123 Ga0501044_0039123_431_1447 323
387 3300050493 nmdc:mga0k408_323_c1 nmdc:mga0k408_323_c1_9388_10404 323
388 3300050493 nmdc:mga0k408_424_c1 nmdc:mga0k408_424_c1_6063_7073 323
389 3300050493 nmdc:mga0k408_8795_c1 nmdc:mga0k408_8795_c1_4263_5273 323
390 3300053080 Ga0500635_0003493 Ga0500635_0003493_651_1664 323
391 3300053092 Ga0500583_0000075 Ga0500583_0000075_23262_24272 323
392 3300053125 Ga0500618_000020 Ga0500618_000020_150639_151649 323
393 3300053134 Ga0500658_0055825 Ga0500658_0055825_601_1611 323
394 3300053156 Ga0500622_0000719 Ga0500622_0000719_10676_11692 323
395 3300054114 Ga0501084_0113903 Ga0501084_0113903_336_1352 323
396 3300060353 Ga0501082_0014134 Ga0501082_0014134_3290_4306 323
397 3300005293 Ga0065715_10007513 Ga0065715_100075133 324
398 3300009036 Ga0105244_10000013 Ga0105244_1000001327 324
399 3300049571 Ga0501034_0322880 Ga0501034_0322880_135_1154 324
400 3300049572 Ga0501036_0174381 Ga0501036_0174381_342_1361 324
401 3300049579 Ga0501043_0076249 Ga0501043_0076249_697_1716 324
402 3300049581 Ga0501047_0055092 Ga0501047_0055092_1536_2555 324
403 3300001915 JGI24741J21665_1002032 JGI24741J21665_10020326 325
404 3300003320 rootH2_10040511 rootH2_100405118 325
405 3300003322 rootL2_10280896 rootL2_102808965 325
406 3300003784 Ga0055534_1009364 Ga0055534_10093642 325
407 3300005288 Ga0065714_10064456 Ga0065714_1006445634 325
408 3300005329 Ga0070683_100002098 Ga0070683_1000020983 325
409 3300005337 Ga0070682_100000133 Ga0070682_10000013327 325
410 3300005339 Ga0070660_100056862 Ga0070660_1000568624 325
411 3300005535 Ga0070684_100023412 Ga0070684_1000234125 325
412 3300005547 Ga0070693_100024304 Ga0070693_1000243041 325
413 3300006942 Ga0099824_1014579 Ga0099824_101457910 325
414 3300006946 Ga0079104_1000079 Ga0079104_100007992 325
415 3300006948 Ga0099826_10001967 Ga0099826_1000196713 325
416 3300009092 Ga0105250_10003528 Ga0105250_100035287 325
417 3300009092 Ga0105250_10017310 Ga0105250_100173103 325
418 3300009148 Ga0105243_10254848 Ga0105243_102548482 325
419 3300013100 Ga0157373_10000035 Ga0157373_1000003581 325
420 3300013104 Ga0157370_10000334 Ga0157370_1000033439 325
421 3300013104 Ga0157370_10000844 Ga0157370_1000084410 325
422 3300013104 Ga0157370_10001492 Ga0157370_1000149210 325
423 3300013104 Ga0157370_10003337 Ga0157370_100033378 325
424 3300013104 Ga0157370_10011599 Ga0157370_100115995 325
425 3300013104 Ga0157370_10021334 Ga0157370_100213348 325
426 3300013105 Ga0157369_10000136 Ga0157369_1000013648 325
427 3300013105 Ga0157369_10000235 Ga0157369_1000023518 325
428 3300013306 Ga0163162_10033233 Ga0163162_100332335 325
429 3300013308 Ga0157375_10000334 Ga0157375_1000033435 325
430 3300015261 Ga0182006_1000001 Ga0182006_100000128 325
431 3300015261 Ga0182006_1002746 Ga0182006_100274610 325
432 3300015261 Ga0182006_1016041 Ga0182006_10160412 325
433 3300017792 Ga0163161_10027825 Ga0163161_100278252 325
434 3300017792 Ga0163161_10032934 Ga0163161_100329345 325
435 3300017792 Ga0163161_10052451 Ga0163161_100524512 325
436 3300017792 Ga0163161_10206963 Ga0163161_102069632 325
437 3300025291 Ga0209675_1000034 Ga0209675_1000034217 325
438 3300025711 Ga0207696_1011515 Ga0207696_10115152 325
439 3300025728 Ga0207655_1000031 Ga0207655_100003127 325
440 3300025935 Ga0207709_10160222 Ga0207709_101602222 325
441 3300027111 Ga0209281_1000367 Ga0209281_100036716 325
442 3300027361 Ga0209489_112459 Ga0209489_1124593 325
443 3300027471 Ga0209995_1014177 Ga0209995_10141772 325
444 3300027526 Ga0209968_1003348 Ga0209968_10033483 325
445 3300027666 Ga0209282_1004798 Ga0209282_10047989 325
446 3300031911 Ga0307412_10000006 Ga0307412_1000000627 325
447 3300031911 Ga0307412_10004489 Ga0307412_100044893 325
448 3300032002 Ga0307416_100000016 Ga0307416_100000016161 325
449 3300032002 Ga0307416_100000066 Ga0307416_10000006647 325
450 3300032004 Ga0307414_10031072 Ga0307414_100310724 325
451 3300032004 Ga0307414_10070071 Ga0307414_100700712 325
452 3300042004 Ga0439445_0000784 Ga0439445_0000784_4074_5069 325
453 3300046453 Ga0495627_000030 Ga0495627_000030_33969_34964 325
454 3300046453 Ga0495627_003089 Ga0495627_003089_4677_5672 325
455 3300046500 Ga0495596_0003279 Ga0495596_0003279_7232_8227 325
456 3300046507 Ga0495606_0004317 Ga0495606_0004317_10909_11904 325
457 3300046507 Ga0495606_0005407 Ga0495606_0005407_5787_6782 325
458 3300046512 Ga0495610_0000036 Ga0495610_0000036_151408_152403 325
459 3300046519 Ga0495632_0009960 Ga0495632_0009960_2721_3716 325
460 3300046530 Ga0495654_0000142 Ga0495654_0000142_34728_35723 325
461 3300046538 Ga0495609_0000137 Ga0495609_0000137_39666_40661 325
462 3300046558 Ga0495633_0000001 Ga0495633_0000001_34510_35505 325
463 3300046558 Ga0495633_0001351 Ga0495633_0001351_6255_7250 325
464 3300046660 Ga0495625_0000818 Ga0495625_0000818_34295_35290 325
465 3300047472 Ga0495686_0000327 Ga0495686_0000327_40339_41334 325
466 3300048916 Ga0496113_0328962 Ga0496113_0328962_131_1147 325
467 3300048919 Ga0496116_0000002 Ga0496116_0000002_832010_833008 325
468 3300048919 Ga0496116_0000068 Ga0496116_0000068_226382_227398 325
469 3300048920 Ga0496117_0000062 Ga0496117_0000062_224317_225333 325
470 3300048920 Ga0496117_0055618 Ga0496117_0055618_1682_2680 325
471 3300048921 Ga0496118_0000113 Ga0496118_0000113_135443_136459 325
472 3300048921 Ga0496118_0034877 Ga0496118_0034877_1424_2422 325
473 3300048922 Ga0496119_0000024 Ga0496119_0000024_224328_225344 325
474 3300048924 Ga0496121_0071173 Ga0496121_0071173_946_1944 325
475 3300048925 Ga0496122_0000530 Ga0496122_0000530_27991_28986 325
476 3300048925 Ga0496122_0001937 Ga0496122_0001937_22373_23368 325
477 3300048925 Ga0496122_0002619 Ga0496122_0002619_3084_4100 325
478 3300048925 Ga0496122_0007266 Ga0496122_0007266_6177_7193 325
479 3300048926 Ga0496123_0000474 Ga0496123_0000474_36643_37659 325
480 3300048926 Ga0496123_0044027 Ga0496123_0044027_575_1591 325
481 3300048927 Ga0496124_0001349 Ga0496124_0001349_3473_4489 325
482 3300048927 Ga0496124_0014480 Ga0496124_0014480_3849_4847 325
483 3300048928 Ga0496125_0000024 Ga0496125_0000024_305154_306149 325
484 3300048928 Ga0496125_0000108 Ga0496125_0000108_84080_85078 325
485 3300048928 Ga0496125_0000454 Ga0496125_0000454_45859_46875 325
486 3300048928 Ga0496125_0021680 Ga0496125_0021680_2091_3107 325
487 3300048928 Ga0496125_0120072 Ga0496125_0120072_801_1796 325
488 3300048929 Ga0496126_0000957 Ga0496126_0000957_23818_24852 325
489 3300048929 Ga0496126_0017909 Ga0496126_0017909_4862_5857 325
490 3300049571 Ga0501034_0061672 Ga0501034_0061672_2176_3171 325
491 iso_pu_bacteria 2585428182 2588212055 325
492 iso_pu_bacteria 2585428185 2588225596 325
493 iso_pu_bacteria 2765235839 2765574806 325
494 iso_pu_bacteria 2816332188 2816876090 325

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14399

BtrH_N

Butirosin biosynthesis protein H, N-terminal

15

147

0.99

PF16169

DUF4872

Domain of unknown function (DUF4872)

158

335

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7wux-assembly1.cif.gz_D crystal structure of aziu3/u2 complexed with (5s,6s)-o7-sulfo dadh from streptomyces sahachiroi 0.6784 1 324
7wux-assembly1.cif.gz_D crystal structure of aziu3/u2 complexed with (5s,6s)-o7-sulfo dadh from streptomyces sahachiroi 0.6748 1 324
7yn2-assembly1.cif.gz_A crystal structure of ccbd with methylthiolincosamide 0.6392 6 325
7yn2-assembly1.cif.gz_A crystal structure of ccbd with methylthiolincosamide 0.6296 6 325
5ohq-assembly1.cif.gz_A crystal structure of the kow6-kow7 domain of human dsif 0.6234 96 149
ID Description Score Start End Superfamily
af_A5A8R3_1_166_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.6558 202 322 1.20.1270.60
af_I1MTQ0_31_190_1.20.120.520 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);nmb1532 protein domain like 0.641 202 323 1.20.120.520
af_Q5VSI4_773_839_2.40.50.90 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.6306 100 149 2.40.50.90
af_Q18826_258_405_1.20.1410.10 Mainly Alpha;Up-down Bundle;I/LWEQ domain;I/LWEQ domain 0.6221 178 320 1.20.1410.10
af_Q93484_1_232_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.6138 184 324 1.20.1270.60
ID Description Score Start End GO Terms
AF-A0A136LIF0-F1-model_v4 deleted 0.9505 4 321
AF-A0A550JF57-F1-model_v4 DUF4872 domain-containing protein 0.9495 1 324 GO:0016020
AF-A0A2N8NCI0-F1-model_v4 Peptidase 0.9483 1 324
AF-A0A2R4KJG4-F1-model_v4 deleted 0.9473 1 324
AF-A0A1H8ETA9-F1-model_v4 Butirosin biosynthesis protein H, N-terminal 0.9438 1 324

Feature Viewer

pLDDT pTM Quality
84.68 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map