F454566
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 494 | 278 | 441 | 334 |
Family's Representative Sequence
| Representative Sequence | 3300010375|Ga0105239_10000002|Ga0105239_10000002290 |
| Length | 341 |
| Sequence | MSPNIVSFNHIQAAHCENGVTVGLLKNSGVGQITEPLAFGIGAGLFFVYIPLLKINNGPVIAFRTMPGLIFNRTCKALGIPVVRKKFRSKEAAEAFLNECLEAGHPVGCQVGVYYLPYFPKEYRFHFNAHNLIVYGSNDGNYMVSDPVMEGTNVMTAYELERVRFAKGALAPNGQLYYPKETRAVTDEQMKAAIISGIKKNVFNMISPFMGPIAGVNGIRYTGNKIKQWRDKLGLKEAGSYLAQLVRMQEEIGTGGGGFRYIYGAFLQEAYAYVPNDELLEISNSFTASGDLWRTAAVQAAGIYKGRIGSQEDFNTMGDYLLEIAEIERKAFTALKNIKWQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231000 | Chryseobacterium populi CF314 | Isolate | Rhizosphere |
| 2 | 2519899754 | Flavobacterium sp. F52 | Isolate | Rhizosphere |
| 3 | 2582581278 | Chryseobacterium sp. CF365 | Isolate | Rhizosphere |
| 4 | 2582581281 | Chryseobacterium sp. CF284 | Isolate | Rhizosphere |
| 5 | 2582581282 | Chryseobacterium sp. CF299 | Isolate | Rhizosphere |
| 6 | 2582581873 | Chryseobacterium sp. OV259 | Isolate | Rhizosphere |
| 7 | 2585428045 | Chryseobacterium sp. OV705 | Isolate | Rhizosphere |
| 8 | 2585428060 | Chryseobacterium sp. OV715 | Isolate | Rhizosphere |
| 9 | 2585428061 | Chryseobacterium sp. CF356 | Isolate | Rhizosphere |
| 10 | 2585428095 | Chryseobacterium sp. YR005 | Isolate | Rhizosphere |
| 11 | 2585428115 | Chryseobacterium sp. YR561 | Isolate | Rhizosphere |
| 12 | 2585428182 | Chryseobacterium sp. YR477 | Isolate | Rhizosphere |
| 13 | 2585428183 | Chryseobacterium sp. YR485 | Isolate | Rhizosphere |
| 14 | 2585428184 | Chryseobacterium sp. YR480 | Isolate | Rhizosphere |
| 15 | 2585428185 | Chryseobacterium sp. YR459 | Isolate | Rhizosphere |
| 16 | 2585428187 | Chryseobacterium sp. YR460 | Isolate | Rhizosphere |
| 17 | 2588253712 | Chryseobacterium sp. OV279 | Isolate | Rhizosphere |
| 18 | 2588254255 | Chryseobacterium sp. YR221 | Isolate | Rhizosphere |
| 19 | 2588254257 | Chryseobacterium sp. YR203 | Isolate | Rhizosphere |
| 20 | 2643221600 | Flavobacterium sp. Root186 | Isolate | Unclassified |
| 21 | 2643221667 | Flavobacterium sp. Root420 | Isolate | Unclassified |
| 22 | 2643221716 | Flavobacterium sp. Root901 | Isolate | Unclassified |
| 23 | 2643221725 | Flavobacterium sp. Root935 | Isolate | Unclassified |
| 24 | 2728369107 | Chryseobacterium kwangjuense KJ1R5 | Isolate | Unclassified |
| 25 | 2739367874 | Chryseobacterium sp. T16E-39 | Isolate | Unclassified |
| 26 | 2751185877 | Chryseobacterium artocarpi UTM-3 | Isolate | Rhizosphere |
| 27 | 2765235839 | Chryseobacterium indologenes AA5 | Isolate | Unclassified |
| 28 | 2772190705 | Chryseobacterium contaminans C-26 | Isolate | Rhizosphere |
| 29 | 2775506739 | Chryseobacterium sp. 1335 | Isolate | Unclassified |
| 30 | 2802428842 | Flavobacterium sp. S87F.05.LMB.W.Kidney.N | Isolate | Unclassified |
| 31 | 2816332188 | Chryseobacterium aquifrigidense 110 (version 2) | Isolate | Unclassified |
| 32 | 2816332280 | Flavobacterium johnsoniae GSE09 | Isolate | Unclassified |
| 33 | 2842083920 | Chryseobacterium lathyri KCTC 22544 | Isolate | Rhizosphere |
| 34 | 2871720351 | Chryseobacterium sp. KLBC 52 | Isolate | Nodule |
| 35 | 2889290771 | Chryseobacterium sp. PvR013 | Isolate | Rhizosphere |
| 36 | 2903895155 | Flavobacterium sp. HBTb2-11-1 | Isolate | Rhizosphere |
| 37 | 2905999023 | Chryseobacterium elymi KCTC 22547 | Isolate | Rhizosphere |
| 38 | 2919097161 | Chryseobacterium ginsenosidimutans 1394 | Isolate | Rhizosphere |
| 39 | 2919191525 | Flavobacterium sp. 2755 | Isolate | Rhizosphere |
| 40 | 2919399522 | Chryseobacterium sp. 2987 | Isolate | Unclassified |
| 41 | 2919683626 | Flavobacterium piscis 4129 | Isolate | Unclassified |
| 42 | 2929150217 | Flavobacterium sp. R-74510 Hybrid assembly | Isolate | Unclassified |
| 43 | 2945924605 | Chryseobacterium ginsenosidimutans W1I9 | Isolate | Rhizosphere |
| 44 | 2946019816 | Chryseobacterium sp. W4I1 | Isolate | Rhizosphere |
| 45 | 2958458903 | Flavobacterium anhuiense RCM74 | Isolate | Rhizosphere |
| 46 | 2958512119 | Flavobacterium sp. Sd200 | Isolate | Rhizosphere |
| 47 | 2977243572 | Chryseobacterium sp. SORGH_AS 447 | Isolate | Unclassified |
| 48 | 2977268062 | Flavobacterium sp. SORGH_AS 622 | Isolate | Unclassified |
| 49 | 2984572630 | Chryseobacterium sp. SORGH_AS909 | Isolate | Aerial Root |
| 50 | 2984606641 | Chryseobacterium sp. SORGH_AS1175 | Isolate | Aerial Root |
| 51 | 2993372514 | Chryseobacterium sp. SLBN-27 | Isolate | Rhizosphere |
| 52 | 2993480792 | Chryseobacterium nepalense SLBN-92 | Isolate | Rhizosphere |
| 53 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 54 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 55 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 56 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 57 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 58 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 59 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 60 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 61 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 62 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 63 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 64 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 69 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 71 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 72 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 73 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 75 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 86 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 87 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 88 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 89 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 90 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 93 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 94 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 95 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 96 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 97 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 98 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 99 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 100 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 101 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 102 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 103 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 104 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 106 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 107 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 109 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 110 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 111 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 133 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 137 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 139 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 142 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 144 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 191 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 192 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 195 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 198 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 199 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 200 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 201 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 202 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 203 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 204 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 205 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 206 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 207 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 208 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 209 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 210 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 211 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 212 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 213 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 214 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 215 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 243 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 244 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 245 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 246 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 247 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 248 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 249 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 250 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 251 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 252 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 253 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 254 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 255 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 256 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 267 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 268 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 270 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 271 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 272 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 273 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 274 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 275 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 277 | 8055419101 | Flavobacterium tyrosinilyticum KCTC 42726 | Isolate | Rhizosphere |
| 278 | 8055592153 | Flavobacterium panacis DCY106 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.07 |
| Metatranscriptomes | 0 |
| Isolates | 10.93 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.4 |
| Bulb | 0 |
| Endosphere | 3.44 |
| Nodule | 1.42 |
| Rhizoplane | 0.81 |
| Rhizosphere | 82.59 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.34 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1002032 | 3300001915 | Bacteria | 5436 |
| 2 | JGI24737J22298_10004123 | 3300001990 | Bacteria | 5078 |
| 3 | JGI25162J39368_1001018 | 3300002737 | Bacteria | 17457 |
| 4 | JGI25165J46597_1000957 | 3300003214 | Bacteria | 19672 |
| 5 | rootH2_10040511 | 3300003320 | Bacteria | 7333 |
| 6 | rootL2_10280896 | 3300003322 | Bacteria | 4993 |
| 7 | rootH1_10000566 | 3300003316 | Bacteria | 33162 |
| 8 | rootH1_10000566 | 3300003323 | Bacteria | 205679 |
| 9 | rootH1_10030244 | 3300003323 | Bacteria | 7579 |
| 10 | Ga0055534_1009364 | 3300003784 | Bacteria | 2134 |
| 11 | Ga0065714_10014223 | 3300005288 | Bacteria | 2445 |
| 12 | Ga0065714_10064456 | 3300005288 | Bacteria | 70947 |
| 13 | Ga0065714_10097502 | 3300005288 | Bacteria | 1734 |
| 14 | Ga0065704_10072550 | 3300005289 | Bacteria | 8335 |
| 15 | Ga0065715_10007513 | 3300005293 | Bacteria | 2651 |
| 16 | Ga0070658_10066481 | 3300005327 | Bacteria | 2945 |
| 17 | Ga0070658_10141623 | 3300005327 | Bacteria | 2009 |
| 18 | Ga0070676_10000262 | 3300005328 | Bacteria | 22949 |
| 19 | Ga0070676_10058847 | 3300005328 | Unclassified | 2278 |
| 20 | Ga0070676_10164203 | 3300005328 | Bacteria | 1432 |
| 21 | Ga0070683_100002098 | 3300005329 | Bacteria | 15741 |
| 22 | Ga0070670_100033641 | 3300005331 | Bacteria | 4415 |
| 23 | Ga0070670_100120234 | 3300005331 | Bacteria | 2266 |
| 24 | Ga0070670_100256190 | 3300005331 | Bacteria | 1525 |
| 25 | Ga0070670_100291781 | 3300005331 | Bacteria | 1425 |
| 26 | Ga0070670_100344651 | 3300005331 | Bacteria | 1308 |
| 27 | Ga0068869_100093235 | 3300005334 | Bacteria | 2268 |
| 28 | Ga0070666_10000039 | 3300005335 | Bacteria | 115360 |
| 29 | Ga0070666_10013535 | 3300005335 | Bacteria | 5178 |
| 30 | Ga0070680_100004495 | 3300005336 | Bacteria | 10508 |
| 31 | Ga0070682_100000106 | 3300005337 | Bacteria | 74029 |
| 32 | Ga0070682_100000133 | 3300005337 | Bacteria | 61302 |
| 33 | Ga0070682_100010447 | 3300005337 | Bacteria | 5269 |
| 34 | Ga0068868_100001486 | 3300005338 | Bacteria | 16186 |
| 35 | Ga0068868_100011655 | 3300005338 | Bacteria | 6406 |
| 36 | Ga0068868_100015137 | 3300005338 | Bacteria | 5699 |
| 37 | Ga0070660_100008755 | 3300005339 | Bacteria | 7088 |
| 38 | Ga0070660_100056862 | 3300005339 | Bacteria | 3028 |
| 39 | Ga0070689_100192275 | 3300005340 | Bacteria | 1662 |
| 40 | Ga0070691_10024066 | 3300005341 | Bacteria | 2829 |
| 41 | Ga0070661_100156522 | 3300005344 | Bacteria | 1724 |
| 42 | Ga0070668_100000036 | 3300005347 | Bacteria | 81256 |
| 43 | Ga0070668_100085521 | 3300005347 | Bacteria | 2478 |
| 44 | Ga0070675_100086939 | 3300005354 | Bacteria | 2614 |
| 45 | Ga0070671_100118400 | 3300005355 | Bacteria | 2228 |
| 46 | Ga0070671_100162442 | 3300005355 | Bacteria | 1888 |
| 47 | Ga0070671_100379302 | 3300005355 | Bacteria | 1208 |
| 48 | Ga0070673_100000580 | 3300005364 | Bacteria | 19823 |
| 49 | Ga0070673_100201891 | 3300005364 | Bacteria | 1712 |
| 50 | Ga0070659_100001045 | 3300005366 | Bacteria | 20218 |
| 51 | Ga0070667_100000151 | 3300005367 | Bacteria | 86629 |
| 52 | Ga0070667_100008389 | 3300005367 | Bacteria | 8567 |
| 53 | Ga0070667_100015079 | 3300005367 | Bacteria | 6384 |
| 54 | Ga0070663_100013428 | 3300005455 | Bacteria | 5223 |
| 55 | Ga0070662_100001317 | 3300005457 | Bacteria | 15266 |
| 56 | Ga0070681_10035380 | 3300005458 | Bacteria | 5017 |
| 57 | Ga0070681_10078206 | 3300005458 | Bacteria | 3265 |
| 58 | Ga0068867_100001155 | 3300005459 | Bacteria | 18059 |
| 59 | Ga0068867_100017794 | 3300005459 | Bacteria | 5047 |
| 60 | Ga0068867_100021893 | 3300005459 | Bacteria | 4565 |
| 61 | Ga0070679_100002055 | 3300005530 | Bacteria | 18077 |
| 62 | Ga0070679_100097257 | 3300005530 | Bacteria | 2931 |
| 63 | Ga0070679_100267738 | 3300005530 | Unclassified | 1663 |
| 64 | Ga0070684_100023412 | 3300005535 | Bacteria | 5166 |
| 65 | Ga0068853_100010474 | 3300005539 | Bacteria | 7502 |
| 66 | Ga0068853_100026708 | 3300005539 | Bacteria | 4850 |
| 67 | Ga0068853_100096833 | 3300005539 | Bacteria | 2604 |
| 68 | Ga0070672_100000225 | 3300005543 | Bacteria | 31458 |
| 69 | Ga0070693_100024304 | 3300005547 | Bacteria | 3248 |
| 70 | Ga0068855_100387850 | 3300005563 | Bacteria | 1533 |
| 71 | Ga0068857_100013369 | 3300005577 | Bacteria | 7149 |
| 72 | Ga0068856_100000044 | 3300005614 | Bacteria | 111437 |
| 73 | Ga0068856_100020596 | 3300005614 | Bacteria | 6408 |
| 74 | Ga0068856_100240828 | 3300005614 | Bacteria | 1824 |
| 75 | Ga0068852_100091369 | 3300005616 | Bacteria | 2724 |
| 76 | Ga0068852_100117656 | 3300005616 | Bacteria | 2427 |
| 77 | Ga0068859_100000006 | 3300005617 | Bacteria | 421509 |
| 78 | Ga0068859_100028907 | 3300005617 | Bacteria | 5560 |
| 79 | Ga0068859_100288601 | 3300005617 | Unclassified | 1733 |
| 80 | Ga0068864_100001963 | 3300005618 | Bacteria | 16908 |
| 81 | Ga0068864_100008085 | 3300005618 | Bacteria | 8676 |
| 82 | Ga0068864_100247214 | 3300005618 | Bacteria | 1655 |
| 83 | Ga0068851_10000910 | 3300005834 | Bacteria | 12739 |
| 84 | Ga0068851_10006636 | 3300005834 | Bacteria | 5296 |
| 85 | Ga0068870_10081869 | 3300005840 | Bacteria | 1786 |
| 86 | Ga0068863_100000510 | 3300005841 | Bacteria | 39514 |
| 87 | Ga0068863_100000808 | 3300005841 | Bacteria | 31389 |
| 88 | Ga0068863_100009631 | 3300005841 | Bacteria | 9424 |
| 89 | Ga0068858_100004985 | 3300005842 | Bacteria | 13009 |
| 90 | Ga0068858_100079999 | 3300005842 | Bacteria | 3036 |
| 91 | Ga0068858_100249069 | 3300005842 | Bacteria | 1687 |
| 92 | Ga0068858_100336273 | 3300005842 | Bacteria | 1445 |
| 93 | Ga0068860_100004849 | 3300005843 | Bacteria | 13713 |
| 94 | Ga0068860_100008104 | 3300005843 | Bacteria | 10464 |
| 95 | Ga0068860_100008374 | 3300005843 | Bacteria | 10298 |
| 96 | Ga0068860_100048712 | 3300005843 | Bacteria | 4038 |
| 97 | Ga0068860_100076353 | 3300005843 | Bacteria | 3187 |
| 98 | Ga0075366_10000091 | 3300006195 | Bacteria | 36066 |
| 99 | Ga0097621_100001898 | 3300006237 | Bacteria | 14275 |
| 100 | Ga0097621_100010967 | 3300006237 | Bacteria | 6655 |
| 101 | Ga0097621_100017257 | 3300006237 | Bacteria | 5477 |
| 102 | Ga0097621_100027628 | 3300006237 | Bacteria | 4464 |
| 103 | Ga0097621_100057664 | 3300006237 | Bacteria | 3177 |
| 104 | Ga0097621_100251812 | 3300006237 | Bacteria | 1547 |
| 105 | Ga0068871_100120227 | 3300006358 | Bacteria | 2218 |
| 106 | Ga0068871_100160150 | 3300006358 | Unclassified | 1924 |
| 107 | Ga0068865_100005575 | 3300006881 | Bacteria | 7637 |
| 108 | Ga0068865_100046368 | 3300006881 | Bacteria | 2982 |
| 109 | Ga0097620_100000006 | 3300006931 | Bacteria | 421509 |
| 110 | Ga0097620_100028907 | 3300006931 | Bacteria | 5560 |
| 111 | Ga0097620_100288623 | 3300006931 | Unclassified | 1733 |
| 112 | Ga0099824_1014579 | 3300006942 | Bacteria | 7751 |
| 113 | Ga0079104_1000079 | 3300006946 | Bacteria | 141480 |
| 114 | Ga0099826_10001967 | 3300006948 | Bacteria | 12887 |
| 115 | Ga0105244_10000013 | 3300009036 | Bacteria | 258350 |
| 116 | Ga0105250_10003528 | 3300009092 | Bacteria | 7376 |
| 117 | Ga0105250_10017310 | 3300009092 | Bacteria | 2931 |
| 118 | Ga0105240_10012464 | 3300009093 | Bacteria | 11730 |
| 119 | Ga0105240_10014907 | 3300009093 | Bacteria | 10589 |
| 120 | Ga0105240_10054067 | 3300009093 | Bacteria | 5034 |
| 121 | Ga0105240_10188674 | 3300009093 | Bacteria | 2426 |
| 122 | Ga0105247_10003395 | 3300009101 | Bacteria | 10415 |
| 123 | Ga0105243_10000416 | 3300009148 | Bacteria | 44803 |
| 124 | Ga0105243_10254848 | 3300009148 | Bacteria | 1568 |
| 125 | Ga0105241_10002398 | 3300009174 | Bacteria | 14076 |
| 126 | Ga0105241_10004171 | 3300009174 | Bacteria | 10671 |
| 127 | Ga0105241_10141537 | 3300009174 | Bacteria | 1959 |
| 128 | Ga0105242_10046774 | 3300009176 | Unclassified | 3511 |
| 129 | Ga0105242_10087583 | 3300009176 | Bacteria | 2614 |
| 130 | Ga0105242_10198095 | 3300009176 | Bacteria | 1782 |
| 131 | Ga0105242_10260118 | 3300009176 | Bacteria | 1567 |
| 132 | Ga0105242_10278139 | 3300009176 | Bacteria | 1519 |
| 133 | Ga0105237_10010099 | 3300009545 | Bacteria | 10068 |
| 134 | Ga0105237_10016270 | 3300009545 | Bacteria | 7731 |
| 135 | Ga0105237_10134018 | 3300009545 | Bacteria | 2472 |
| 136 | Ga0105237_10663877 | 3300009545 | Bacteria | 1049 |
| 137 | Ga0105249_10000514 | 3300009553 | Bacteria | 35783 |
| 138 | Ga0105249_10003735 | 3300009553 | Bacteria | 13135 |
| 139 | Ga0105249_10045567 | 3300009553 | Bacteria | 3989 |
| 140 | Ga0105249_10518733 | 3300009553 | Unclassified | 1239 |
| 141 | Ga0105239_10000002 | 3300010375 | Bacteria | 610298 |
| 142 | Ga0105239_10000006 | 3300010375 | Bacteria | 442319 |
| 143 | Ga0105239_10144574 | 3300010375 | Bacteria | 2652 |
| 144 | Ga0105246_10078917 | 3300011119 | Bacteria | 2339 |
| 145 | Ga0105246_10139401 | 3300011119 | Bacteria | 1822 |
| 146 | Ga0157373_10000017 | 3300013100 | Bacteria | 173186 |
| 147 | Ga0157373_10000035 | 3300013100 | Bacteria | 123284 |
| 148 | Ga0157373_10024983 | 3300013100 | Bacteria | 4325 |
| 149 | Ga0157371_10000269 | 3300013102 | Bacteria | 70787 |
| 150 | Ga0157371_10001621 | 3300013102 | Bacteria | 23010 |
| 151 | Ga0157371_10049232 | 3300013102 | Bacteria | 2994 |
| 152 | Ga0157370_10000334 | 3300013104 | Bacteria | 59226 |
| 153 | Ga0157370_10000844 | 3300013104 | Bacteria | 38898 |
| 154 | Ga0157370_10001492 | 3300013104 | Bacteria | 28987 |
| 155 | Ga0157370_10002126 | 3300013104 | Bacteria | 24195 |
| 156 | Ga0157370_10003337 | 3300013104 | Bacteria | 18911 |
| 157 | Ga0157370_10011599 | 3300013104 | Bacteria | 9200 |
| 158 | Ga0157370_10021334 | 3300013104 | Bacteria | 6454 |
| 159 | Ga0157370_10041718 | 3300013104 | Bacteria | 4424 |
| 160 | Ga0157370_10213840 | 3300013104 | Bacteria | 1786 |
| 161 | Ga0157370_10386939 | 3300013104 | Unclassified | 1288 |
| 162 | Ga0157369_10000136 | 3300013105 | Bacteria | 104612 |
| 163 | Ga0157369_10000235 | 3300013105 | Bacteria | 76779 |
| 164 | Ga0157369_10012411 | 3300013105 | Bacteria | 9671 |
| 165 | Ga0157369_10107756 | 3300013105 | Bacteria | 2964 |
| 166 | Ga0157369_10191244 | 3300013105 | Bacteria | 2150 |
| 167 | Ga0157374_10000498 | 3300013296 | Bacteria | 35652 |
| 168 | Ga0157374_10017006 | 3300013296 | Bacteria | 6403 |
| 169 | Ga0157374_10122394 | 3300013296 | Bacteria | 2512 |
| 170 | Ga0157374_10350657 | 3300013296 | Bacteria | 1466 |
| 171 | Ga0157378_10005867 | 3300013297 | Bacteria | 10757 |
| 172 | Ga0157378_10020619 | 3300013297 | Bacteria | 5797 |
| 173 | Ga0157378_10026055 | 3300013297 | Bacteria | 5154 |
| 174 | Ga0157378_10465108 | 3300013297 | Unclassified | 1257 |
| 175 | Ga0163162_10000504 | 3300013306 | Bacteria | 36390 |
| 176 | Ga0163162_10000905 | 3300013306 | Bacteria | 27617 |
| 177 | Ga0163162_10018680 | 3300013306 | Bacteria | 6792 |
| 178 | Ga0163162_10033233 | 3300013306 | Bacteria | 5124 |
| 179 | Ga0163162_10111313 | 3300013306 | Bacteria | 2835 |
| 180 | Ga0163162_10567600 | 3300013306 | Bacteria | 1262 |
| 181 | Ga0163162_10646184 | 3300013306 | Bacteria | 1182 |
| 182 | Ga0157372_10000009 | 3300013307 | Bacteria | 302051 |
| 183 | Ga0157372_10001087 | 3300013307 | Bacteria | 29605 |
| 184 | Ga0157372_10291391 | 3300013307 | Bacteria | 1898 |
| 185 | Ga0157372_10349014 | 3300013307 | Bacteria | 1724 |
| 186 | Ga0157375_10000334 | 3300013308 | Bacteria | 42495 |
| 187 | Ga0157375_10000476 | 3300013308 | Bacteria | 36510 |
| 188 | Ga0157375_10072718 | 3300013308 | Bacteria | 3456 |
| 189 | Ga0157375_10164053 | 3300013308 | Bacteria | 2365 |
| 190 | Ga0157375_10183021 | 3300013308 | Bacteria | 2248 |
| 191 | Ga0163163_10004719 | 3300014325 | Bacteria | 11678 |
| 192 | Ga0163163_10105809 | 3300014325 | Bacteria | 2839 |
| 193 | Ga0182008_10000036 | 3300014497 | Bacteria | 130349 |
| 194 | Ga0157377_10071938 | 3300014745 | Bacteria | 2001 |
| 195 | Ga0157379_10000114 | 3300014968 | Bacteria | 55633 |
| 196 | Ga0157379_10095897 | 3300014968 | Bacteria | 2662 |
| 197 | Ga0157379_10284757 | 3300014968 | Unclassified | 1504 |
| 198 | Ga0157376_10000571 | 3300014969 | Bacteria | 23715 |
| 199 | Ga0157376_10000596 | 3300014969 | Bacteria | 23325 |
| 200 | Ga0157376_10030268 | 3300014969 | Bacteria | 4321 |
| 201 | Ga0157376_10415363 | 3300014969 | Bacteria | 1304 |
| 202 | Ga0182006_1000001 | 3300015261 | Bacteria | 1091090 |
| 203 | Ga0182006_1002746 | 3300015261 | Bacteria | 9431 |
| 204 | Ga0182006_1016041 | 3300015261 | Bacteria | 3201 |
| 205 | Ga0163161_10005361 | 3300017792 | Bacteria | 8914 |
| 206 | Ga0163161_10026385 | 3300017792 | Bacteria | 4115 |
| 207 | Ga0163161_10027825 | 3300017792 | Unclassified | 4011 |
| 208 | Ga0163161_10032934 | 3300017792 | Bacteria | 3702 |
| 209 | Ga0163161_10052451 | 3300017792 | Bacteria | 2956 |
| 210 | Ga0163161_10152920 | 3300017792 | Bacteria | 1754 |
| 211 | Ga0163161_10206963 | 3300017792 | Bacteria | 1514 |
| 212 | Ga0213876_10016894 | 3300021384 | Bacteria | 3856 |
| 213 | Ga0207427_100093 | 3300025231 | Bacteria | 125910 |
| 214 | Ga0209437_100008 | 3300025233 | Bacteria | 921142 |
| 215 | Ga0209026_1002432 | 3300025250 | Bacteria | 7004 |
| 216 | Ga0209233_1000024 | 3300025261 | Bacteria | 695418 |
| 217 | Ga0209233_1001440 | 3300025261 | Bacteria | 9392 |
| 218 | Ga0209675_1000034 | 3300025291 | Bacteria | 267827 |
| 219 | Ga0207656_10003101 | 3300025321 | Bacteria | 5689 |
| 220 | Ga0207656_10126162 | 3300025321 | Bacteria | 1196 |
| 221 | Ga0207696_1011515 | 3300025711 | Bacteria | 3178 |
| 222 | Ga0207655_1000031 | 3300025728 | Bacteria | 392265 |
| 223 | Ga0207642_10065770 | 3300025899 | Bacteria | 1705 |
| 224 | Ga0207688_10021799 | 3300025901 | Bacteria | 3503 |
| 225 | Ga0207680_10000477 | 3300025903 | Bacteria | 18937 |
| 226 | Ga0207680_10098854 | 3300025903 | Bacteria | 1871 |
| 227 | Ga0207647_10000463 | 3300025904 | Bacteria | 32923 |
| 228 | Ga0207647_10089267 | 3300025904 | Bacteria | 1840 |
| 229 | Ga0207645_10000631 | 3300025907 | Bacteria | 29230 |
| 230 | Ga0207645_10006683 | 3300025907 | Bacteria | 8237 |
| 231 | Ga0207645_10064024 | 3300025907 | Bacteria | 2350 |
| 232 | Ga0207643_10010665 | 3300025908 | Bacteria | 4952 |
| 233 | Ga0207705_10092508 | 3300025909 | Bacteria | 2216 |
| 234 | Ga0207705_10115262 | 3300025909 | Bacteria | 1988 |
| 235 | Ga0207705_10243116 | 3300025909 | Bacteria | 1371 |
| 236 | Ga0207654_10003746 | 3300025911 | Bacteria | 7669 |
| 237 | Ga0207654_10075746 | 3300025911 | Bacteria | 2012 |
| 238 | Ga0207707_10000611 | 3300025912 | Bacteria | 35815 |
| 239 | Ga0207695_10043574 | 3300025913 | Bacteria | 4782 |
| 240 | Ga0207695_10044680 | 3300025913 | Bacteria | 4709 |
| 241 | Ga0207671_10000901 | 3300025914 | Bacteria | 37526 |
| 242 | Ga0207671_10004440 | 3300025914 | Bacteria | 13411 |
| 243 | Ga0207660_10012546 | 3300025917 | Bacteria | 5548 |
| 244 | Ga0207657_10102049 | 3300025919 | Bacteria | 2380 |
| 245 | Ga0207649_10156745 | 3300025920 | Bacteria | 1574 |
| 246 | Ga0207652_10037362 | 3300025921 | Bacteria | 4110 |
| 247 | Ga0207652_10075892 | 3300025921 | Bacteria | 2930 |
| 248 | Ga0207681_10105412 | 3300025923 | Bacteria | 2041 |
| 249 | Ga0207650_10196671 | 3300025925 | Bacteria | 1613 |
| 250 | Ga0207650_10202701 | 3300025925 | Bacteria | 1590 |
| 251 | Ga0207650_10219815 | 3300025925 | Bacteria | 1528 |
| 252 | Ga0207650_10221907 | 3300025925 | Bacteria | 1521 |
| 253 | Ga0207650_10262289 | 3300025925 | Bacteria | 1402 |
| 254 | Ga0207659_10047244 | 3300025926 | Bacteria | 3044 |
| 255 | Ga0207690_10000770 | 3300025932 | Bacteria | 20723 |
| 256 | Ga0207706_10267843 | 3300025933 | Bacteria | 1491 |
| 257 | Ga0207686_10139000 | 3300025934 | Bacteria | 1676 |
| 258 | Ga0207709_10000216 | 3300025935 | Bacteria | 73193 |
| 259 | Ga0207709_10160222 | 3300025935 | Bacteria | 1568 |
| 260 | Ga0207704_10000928 | 3300025938 | Bacteria | 12957 |
| 261 | Ga0207691_10000067 | 3300025940 | Bacteria | 84512 |
| 262 | Ga0207691_10094598 | 3300025940 | Bacteria | 2673 |
| 263 | Ga0207689_10000466 | 3300025942 | Bacteria | 37961 |
| 264 | Ga0207689_10000822 | 3300025942 | Bacteria | 29903 |
| 265 | Ga0207689_10004188 | 3300025942 | Bacteria | 13113 |
| 266 | Ga0207679_10066637 | 3300025945 | Bacteria | 2699 |
| 267 | Ga0207667_10073635 | 3300025949 | Bacteria | 3549 |
| 268 | Ga0207667_10219840 | 3300025949 | Bacteria | 1946 |
| 269 | Ga0207651_10013729 | 3300025960 | Bacteria | 4648 |
| 270 | Ga0207651_10093510 | 3300025960 | Bacteria | 2208 |
| 271 | Ga0207712_10002681 | 3300025961 | Bacteria | 11372 |
| 272 | Ga0207712_10066122 | 3300025961 | Bacteria | 2583 |
| 273 | Ga0207668_10004205 | 3300025972 | Bacteria | 8443 |
| 274 | Ga0207658_10002592 | 3300025986 | Bacteria | 13130 |
| 275 | Ga0207658_10004922 | 3300025986 | Bacteria | 9212 |
| 276 | Ga0207658_10027154 | 3300025986 | Bacteria | 4020 |
| 277 | Ga0207677_10000704 | 3300026023 | Bacteria | 19842 |
| 278 | Ga0207677_10029370 | 3300026023 | Bacteria | 3493 |
| 279 | Ga0207677_10033614 | 3300026023 | Bacteria | 3311 |
| 280 | Ga0207677_10124907 | 3300026023 | Bacteria | 1943 |
| 281 | Ga0207703_10006122 | 3300026035 | Bacteria | 9629 |
| 282 | Ga0207639_10022439 | 3300026041 | Bacteria | 4547 |
| 283 | Ga0207639_10193811 | 3300026041 | Bacteria | 1738 |
| 284 | Ga0207678_10024761 | 3300026067 | Bacteria | 5240 |
| 285 | Ga0207702_10000140 | 3300026078 | Bacteria | 87544 |
| 286 | Ga0207641_10000186 | 3300026088 | Bacteria | 86601 |
| 287 | Ga0207641_10001302 | 3300026088 | Bacteria | 24754 |
| 288 | Ga0207641_10014663 | 3300026088 | Bacteria | 6427 |
| 289 | Ga0207641_10333027 | 3300026088 | Unclassified | 1443 |
| 290 | Ga0207648_10003938 | 3300026089 | Bacteria | 15449 |
| 291 | Ga0207648_10004023 | 3300026089 | Bacteria | 15260 |
| 292 | Ga0207648_10274131 | 3300026089 | Unclassified | 1508 |
| 293 | Ga0207648_10323286 | 3300026089 | Bacteria | 1387 |
| 294 | Ga0207676_10000785 | 3300026095 | Bacteria | 24783 |
| 295 | Ga0207676_10006443 | 3300026095 | Bacteria | 8292 |
| 296 | Ga0207676_10131584 | 3300026095 | Bacteria | 2128 |
| 297 | Ga0207674_10054578 | 3300026116 | Bacteria | 4067 |
| 298 | Ga0207675_100016499 | 3300026118 | Bacteria | 6896 |
| 299 | Ga0207675_100018172 | 3300026118 | Bacteria | 6556 |
| 300 | Ga0207675_100087005 | 3300026118 | Bacteria | 2934 |
| 301 | Ga0207683_10005934 | 3300026121 | Bacteria | 10469 |
| 302 | Ga0207683_10099198 | 3300026121 | Bacteria | 2599 |
| 303 | Ga0207683_10302174 | 3300026121 | Bacteria | 1464 |
| 304 | Ga0207698_10002015 | 3300026142 | Bacteria | 11981 |
| 305 | Ga0209281_1000367 | 3300027111 | Bacteria | 73152 |
| 306 | Ga0209489_112459 | 3300027361 | Bacteria | 7706 |
| 307 | Ga0209995_1014177 | 3300027471 | Bacteria | 1307 |
| 308 | Ga0209968_1003348 | 3300027526 | Bacteria | 2407 |
| 309 | Ga0209282_1004798 | 3300027666 | Bacteria | 8199 |
| 310 | Ga0268266_10065272 | 3300028379 | Bacteria | 3147 |
| 311 | Ga0268264_10006912 | 3300028381 | Bacteria | 9522 |
| 312 | Ga0268264_10026202 | 3300028381 | Bacteria | 4762 |
| 313 | Ga0307515_10000001 | 3300028794 | Bacteria | 4259510 |
| 314 | Ga0307515_10000021 | 3300028794 | Bacteria | 406008 |
| 315 | Ga0307515_10000790 | 3300028794 | Bacteria | 72891 |
| 316 | Ga0307515_10001523 | 3300028794 | Bacteria | 51822 |
| 317 | Ga0307511_10000104 | 3300030521 | Bacteria | 75069 |
| 318 | Ga0265327_10000410 | 3300031251 | Bacteria | 78900 |
| 319 | Ga0265327_10013057 | 3300031251 | Bacteria | 5547 |
| 320 | Ga0265327_10059149 | 3300031251 | Bacteria | 1964 |
| 321 | Ga0265327_10099455 | 3300031251 | Unclassified | 1406 |
| 322 | Ga0307509_10002733 | 3300031507 | Bacteria | 28113 |
| 323 | Ga0307412_10000006 | 3300031911 | Bacteria | 506878 |
| 324 | Ga0307412_10000215 | 3300031911 | Bacteria | 39239 |
| 325 | Ga0307412_10004489 | 3300031911 | Bacteria | 7777 |
| 326 | Ga0307416_100000016 | 3300032002 | Bacteria | 205465 |
| 327 | Ga0307416_100000066 | 3300032002 | Bacteria | 94549 |
| 328 | Ga0307414_10000224 | 3300032004 | Bacteria | 37374 |
| 329 | Ga0307414_10031072 | 3300032004 | Bacteria | 3498 |
| 330 | Ga0307414_10070071 | 3300032004 | Bacteria | 2523 |
| 331 | Ga0307507_10000078 | 3300033179 | Bacteria | 151026 |
| 332 | Ga0373927_0107847 | 3300035695 | Bacteria | 1814 |
| 333 | Ga0373937_0398207 | 3300036401 | Bacteria | 1306 |
| 334 | Ga0395899_0000001 | 3300037312 | Bacteria | 1750322 |
| 335 | Ga0395899_0002957 | 3300037312 | Bacteria | 13598 |
| 336 | Ga0395901_0276149 | 3300038443 | Bacteria | 1747 |
| 337 | Ga0436365_0130893 | 3300039437 | Bacteria | 2491 |
| 338 | Ga0436365_0905676 | 3300039437 | Bacteria | 4050 |
| 339 | Ga0439465_0000003 | 3300041413 | Bacteria | 72076 |
| 340 | Ga0439445_0000784 | 3300042004 | Bacteria | 6678 |
| 341 | Ga0466966_0014474 | 3300044684 | Bacteria | 5221 |
| 342 | Ga0466961_0185365 | 3300044693 | Bacteria | 1291 |
| 343 | Ga0466959_0051529 | 3300045049 | Bacteria | 3018 |
| 344 | Ga0495627_000030 | 3300046453 | Bacteria | 228883 |
| 345 | Ga0495627_003089 | 3300046453 | Bacteria | 7559 |
| 346 | Ga0495650_0025026 | 3300046471 | Bacteria | 2808 |
| 347 | Ga0495650_0027320 | 3300046471 | Bacteria | 2639 |
| 348 | Ga0495580_0103587 | 3300046472 | Bacteria | 1978 |
| 349 | Ga0495580_0136953 | 3300046472 | Bacteria | 1698 |
| 350 | Ga0495662_0151620 | 3300046476 | Bacteria | 1142 |
| 351 | Ga0495585_0001288 | 3300046492 | Bacteria | 19979 |
| 352 | Ga0495596_0003279 | 3300046500 | Bacteria | 8266 |
| 353 | Ga0495606_0004317 | 3300046507 | Bacteria | 14307 |
| 354 | Ga0495606_0005407 | 3300046507 | Bacteria | 12239 |
| 355 | Ga0495606_0011271 | 3300046507 | Bacteria | 7313 |
| 356 | Ga0495610_0000036 | 3300046512 | Bacteria | 186904 |
| 357 | Ga0495628_0092528 | 3300046516 | Bacteria | 2339 |
| 358 | Ga0495632_0009960 | 3300046519 | Bacteria | 5674 |
| 359 | Ga0495644_0001493 | 3300046523 | Bacteria | 9535 |
| 360 | Ga0495648_0005741 | 3300046524 | Bacteria | 10240 |
| 361 | Ga0495663_0000014 | 3300046525 | Bacteria | 149657 |
| 362 | Ga0495642_0073386 | 3300046528 | Bacteria | 1434 |
| 363 | Ga0495654_0000142 | 3300046530 | Bacteria | 74610 |
| 364 | Ga0495654_0051002 | 3300046530 | Bacteria | 2020 |
| 365 | Ga0495609_0000137 | 3300046538 | Bacteria | 77538 |
| 366 | Ga0495609_0024823 | 3300046538 | Bacteria | 2748 |
| 367 | Ga0495622_0096016 | 3300046557 | Bacteria | 1360 |
| 368 | Ga0495633_0000001 | 3300046558 | Bacteria | 801972 |
| 369 | Ga0495633_0000074 | 3300046558 | Bacteria | 130197 |
| 370 | Ga0495633_0001351 | 3300046558 | Bacteria | 19221 |
| 371 | Ga0495668_0000017 | 3300046616 | Bacteria | 434025 |
| 372 | Ga0495625_0000435 | 3300046660 | Bacteria | 62758 |
| 373 | Ga0495625_0000818 | 3300046660 | Bacteria | 42880 |
| 374 | Ga0495625_0001213 | 3300046660 | Bacteria | 32692 |
| 375 | Ga0495625_0034761 | 3300046660 | Bacteria | 3718 |
| 376 | Ga0495625_0248550 | 3300046660 | Bacteria | 1155 |
| 377 | Ga0495661_0008787 | 3300046665 | Bacteria | 6969 |
| 378 | Ga0495661_0021254 | 3300046665 | Bacteria | 4233 |
| 379 | Ga0495658_0005676 | 3300046683 | Bacteria | 6131 |
| 380 | Ga0495658_0046684 | 3300046683 | Bacteria | 2436 |
| 381 | Ga0495624_0117151 | 3300046690 | Bacteria | 1637 |
| 382 | Ga0495660_0095783 | 3300046810 | Bacteria | 1535 |
| 383 | Ga0495672_0035325 | 3300047320 | Bacteria | 3079 |
| 384 | Ga0495672_0071253 | 3300047320 | Bacteria | 1967 |
| 385 | Ga0495686_0000327 | 3300047472 | Bacteria | 78430 |
| 386 | Ga0495686_0001184 | 3300047472 | Bacteria | 30421 |
| 387 | Ga0495614_0038317 | 3300048089 | Bacteria | 2057 |
| 388 | Ga0496106_0525533 | 3300048909 | Bacteria | 950 |
| 389 | Ga0496108_0101319 | 3300048911 | Bacteria | 2457 |
| 390 | Ga0496113_0328962 | 3300048916 | Bacteria | 1225 |
| 391 | Ga0496115_0133411 | 3300048918 | Unclassified | 2047 |
| 392 | Ga0496116_0000002 | 3300048919 | Bacteria | 920291 |
| 393 | Ga0496116_0000068 | 3300048919 | Bacteria | 259724 |
| 394 | Ga0496117_0000062 | 3300048920 | Bacteria | 257535 |
| 395 | Ga0496117_0055618 | 3300048920 | Bacteria | 2764 |
| 396 | Ga0496118_0000113 | 3300048921 | Bacteria | 150726 |
| 397 | Ga0496118_0034877 | 3300048921 | Bacteria | 4097 |
| 398 | Ga0496119_0000024 | 3300048922 | Bacteria | 257750 |
| 399 | Ga0496121_0071173 | 3300048924 | Bacteria | 2798 |
| 400 | Ga0496122_0000245 | 3300048925 | Bacteria | 121737 |
| 401 | Ga0496122_0000530 | 3300048925 | Bacteria | 79156 |
| 402 | Ga0496122_0001937 | 3300048925 | Bacteria | 31087 |
| 403 | Ga0496122_0002619 | 3300048925 | Bacteria | 25205 |
| 404 | Ga0496122_0007266 | 3300048925 | Bacteria | 12387 |
| 405 | Ga0496123_0000474 | 3300048926 | Bacteria | 69869 |
| 406 | Ga0496123_0005619 | 3300048926 | Bacteria | 12529 |
| 407 | Ga0496123_0044027 | 3300048926 | Bacteria | 3057 |
| 408 | Ga0496124_0001349 | 3300048927 | Bacteria | 36791 |
| 409 | Ga0496124_0014480 | 3300048927 | Bacteria | 7625 |
| 410 | Ga0496125_0000024 | 3300048928 | Bacteria | 442149 |
| 411 | Ga0496125_0000108 | 3300048928 | Bacteria | 196060 |
| 412 | Ga0496125_0000454 | 3300048928 | Bacteria | 73947 |
| 413 | Ga0496125_0021680 | 3300048928 | Bacteria | 5981 |
| 414 | Ga0496125_0120072 | 3300048928 | Bacteria | 1877 |
| 415 | Ga0496126_0000957 | 3300048929 | Bacteria | 49532 |
| 416 | Ga0496126_0017909 | 3300048929 | Bacteria | 7048 |
| 417 | Ga0495682_0005922 | 3300049460 | Bacteria | 5014 |
| 418 | Ga0501034_0000002 | 3300049571 | Bacteria | 565510 |
| 419 | Ga0501034_0061672 | 3300049571 | Bacteria | 3765 |
| 420 | Ga0501034_0322880 | 3300049571 | Bacteria | 1476 |
| 421 | Ga0501036_0174381 | 3300049572 | Bacteria | 1811 |
| 422 | Ga0501043_0076249 | 3300049579 | Bacteria | 2634 |
| 423 | Ga0501047_0055092 | 3300049581 | Bacteria | 3846 |
| 424 | Ga0501069_0148885 | 3300049585 | Bacteria | 1344 |
| 425 | Ga0501070_0062857 | 3300049586 | Bacteria | 3076 |
| 426 | Ga0501074_0243011 | 3300049590 | Bacteria | 1280 |
| 427 | Ga0501080_0156135 | 3300049742 | Bacteria | 2108 |
| 428 | Ga0501083_0137613 | 3300049744 | Bacteria | 1599 |
| 429 | Ga0501241_000004 | 3300049758 | Bacteria | 177326 |
| 430 | Ga0501269_000218 | 3300049766 | Bacteria | 16758 |
| 431 | Ga0501044_0039123 | 3300049823 | Bacteria | 4949 |
| 432 | nmdc:mga0k408_323_c1 | 3300050493 | Bacteria | 26051 |
| 433 | nmdc:mga0k408_424_c1 | 3300050493 | Bacteria | 23079 |
| 434 | nmdc:mga0k408_8795_c1 | 3300050493 | Bacteria | 5433 |
| 435 | Ga0500635_0003493 | 3300053080 | Bacteria | 3963 |
| 436 | Ga0500583_0000075 | 3300053092 | Bacteria | 59561 |
| 437 | Ga0500618_000020 | 3300053125 | Bacteria | 161356 |
| 438 | Ga0500658_0055825 | 3300053134 | Bacteria | 1627 |
| 439 | Ga0500622_0000719 | 3300053156 | Bacteria | 28939 |
| 440 | Ga0501084_0113903 | 3300054114 | Bacteria | 2273 |
| 441 | Ga0501082_0014134 | 3300060353 | Bacteria | 6869 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044693 | Ga0466961_0185365 | Ga0466961_0185365_130_948 | 259 |
| 2 | 3300046557 | Ga0495622_0096016 | Ga0495622_0096016_506_1330 | 262 |
| 3 | 3300046660 | Ga0495625_0034761 | Ga0495625_0034761_2828_3658 | 262 |
| 4 | 3300046472 | Ga0495580_0136953 | Ga0495580_0136953_60_929 | 275 |
| 5 | 3300046476 | Ga0495662_0151620 | Ga0495662_0151620_198_1067 | 275 |
| 6 | 3300048909 | Ga0496106_0525533 | Ga0496106_0525533_27_896 | 275 |
| 7 | 3300049585 | Ga0501069_0148885 | Ga0501069_0148885_461_1330 | 275 |
| 8 | 3300041413 | Ga0439465_0000003 | Ga0439465_0000003_38618_39517 | 286 |
| 9 | 3300046660 | Ga0495625_0248550 | Ga0495625_0248550_165_1067 | 293 |
| 10 | 3300047320 | Ga0495672_0071253 | Ga0495672_0071253_994_1923 | 295 |
| 11 | 3300031911 | Ga0307412_10000215 | Ga0307412_100002153 | 300 |
| 12 | 3300026121 | Ga0207683_10302174 | Ga0207683_103021742 | 301 |
| 13 | 3300005289 | Ga0065704_10072550 | Ga0065704_100725505 | 304 |
| 14 | 3300017792 | Ga0163161_10005361 | Ga0163161_100053612 | 305 |
| 15 | 3300005344 | Ga0070661_100156522 | Ga0070661_1001565222 | 306 |
| 16 | 3300025920 | Ga0207649_10156745 | Ga0207649_101567451 | 307 |
| 17 | 3300049571 | Ga0501034_0000002 | Ga0501034_0000002_191338_192351 | 308 |
| 18 | 3300013296 | Ga0157374_10017006 | Ga0157374_100170064 | 309 |
| 19 | 3300025940 | Ga0207691_10094598 | Ga0207691_100945983 | 312 |
| 20 | 3300046471 | Ga0495650_0025026 | Ga0495650_0025026_1358_2374 | 314 |
| 21 | 3300013100 | Ga0157373_10000017 | Ga0157373_10000017134 | 318 |
| 22 | 3300014497 | Ga0182008_10000036 | Ga0182008_1000003634 | 318 |
| 23 | 3300032004 | Ga0307414_10000224 | Ga0307414_1000022426 | 318 |
| 24 | 3300046525 | Ga0495663_0000014 | Ga0495663_0000014_134469_135464 | 318 |
| 25 | 3300049758 | Ga0501241_000004 | Ga0501241_000004_137683_138678 | 318 |
| 26 | 3300049766 | Ga0501269_000218 | Ga0501269_000218_8617_9612 | 318 |
| 27 | 3300009148 | Ga0105243_10000416 | Ga0105243_1000041620 | 320 |
| 28 | 3300025935 | Ga0207709_10000216 | Ga0207709_1000021649 | 320 |
| 29 | 3300048925 | Ga0496122_0000245 | Ga0496122_0000245_86163_87158 | 320 |
| 30 | 3300048926 | Ga0496123_0005619 | Ga0496123_0005619_7429_8424 | 320 |
| 31 | 3300013102 | Ga0157371_10049232 | Ga0157371_100492323 | 321 |
| 32 | iso_pu_bacteria | 2511231000 | 2511233461 | 321 |
| 33 | iso_pu_bacteria | 2519899754 | 2520880502 | 321 |
| 34 | iso_pu_bacteria | 2582581278 | 2585141914 | 321 |
| 35 | iso_pu_bacteria | 2582581281 | 2585157746 | 321 |
| 36 | iso_pu_bacteria | 2582581282 | 2585162121 | 321 |
| 37 | iso_pu_bacteria | 2582581873 | 2585426389 | 321 |
| 38 | iso_pu_bacteria | 2585428045 | 2587680351 | 321 |
| 39 | iso_pu_bacteria | 2585428060 | 2587747395 | 321 |
| 40 | iso_pu_bacteria | 2585428061 | 2587752816 | 321 |
| 41 | iso_pu_bacteria | 2585428095 | 2587866461 | 321 |
| 42 | iso_pu_bacteria | 2585428115 | 2587944729 | 321 |
| 43 | iso_pu_bacteria | 2585428183 | 2588216284 | 321 |
| 44 | iso_pu_bacteria | 2585428184 | 2588221146 | 321 |
| 45 | iso_pu_bacteria | 2585428187 | 2588231936 | 321 |
| 46 | iso_pu_bacteria | 2588253712 | 2588448065 | 321 |
| 47 | iso_pu_bacteria | 2588254255 | 2590604033 | 321 |
| 48 | iso_pu_bacteria | 2588254257 | 2590609344 | 321 |
| 49 | iso_pu_bacteria | 2643221600 | 2644012097 | 321 |
| 50 | iso_pu_bacteria | 2643221667 | 2644371323 | 321 |
| 51 | iso_pu_bacteria | 2643221716 | 2644641372 | 321 |
| 52 | iso_pu_bacteria | 2643221725 | 2644682508 | 321 |
| 53 | iso_pu_bacteria | 2728369107 | 2729203070 | 321 |
| 54 | iso_pu_bacteria | 2739367874 | 2740059626 | 321 |
| 55 | iso_pu_bacteria | 2751185877 | 2753674786 | 321 |
| 56 | iso_pu_bacteria | 2772190705 | 2772606156 | 321 |
| 57 | iso_pu_bacteria | 2775506739 | 2775675052 | 321 |
| 58 | iso_pu_bacteria | 2802428842 | 2802651281 | 321 |
| 59 | iso_pu_bacteria | 2816332280 | 2817414167 | 321 |
| 60 | iso_pu_bacteria | 2842083920 | 2842087106 | 321 |
| 61 | iso_pu_bacteria | 2871720351 | 2871721589 | 321 |
| 62 | iso_pu_bacteria | 2889290771 | 2889294641 | 321 |
| 63 | iso_pu_bacteria | 2903895155 | 2903895244 | 321 |
| 64 | iso_pu_bacteria | 2905999023 | 2906002754 | 321 |
| 65 | iso_pu_bacteria | 2919097161 | 2919100272 | 321 |
| 66 | iso_pu_bacteria | 2919191525 | 2919192437 | 321 |
| 67 | iso_pu_bacteria | 2919399522 | 2919402102 | 321 |
| 68 | iso_pu_bacteria | 2919683626 | 2919684156 | 321 |
| 69 | iso_pu_bacteria | 2929150217 | 2929151319 | 321 |
| 70 | iso_pu_bacteria | 2945924605 | 2945925526 | 321 |
| 71 | iso_pu_bacteria | 2946019816 | 2946023258 | 321 |
| 72 | iso_pu_bacteria | 2958458903 | 2958459591 | 321 |
| 73 | iso_pu_bacteria | 2958512119 | 2958512550 | 321 |
| 74 | iso_pu_bacteria | 2977243572 | 2977244362 | 321 |
| 75 | iso_pu_bacteria | 2977268062 | 2977272695 | 321 |
| 76 | iso_pu_bacteria | 2984572630 | 2984573750 | 321 |
| 77 | iso_pu_bacteria | 2984606641 | 2984607190 | 321 |
| 78 | iso_pu_bacteria | 2993372514 | 2993375832 | 321 |
| 79 | iso_pu_bacteria | 2993480792 | 2993482696 | 321 |
| 80 | iso_pu_bacteria | 8055419101 | 8055420086 | 321 |
| 81 | iso_pu_bacteria | 8055592153 | 8055596977 | 321 |
| 82 | 3300005614 | Ga0068856_100020596 | Ga0068856_1000205967 | 322 |
| 83 | 3300031251 | Ga0265327_10013057 | Ga0265327_100130575 | 322 |
| 84 | 3300001990 | JGI24737J22298_10004123 | JGI24737J22298_100041237 | 323 |
| 85 | 3300002737 | JGI25162J39368_1001018 | JGI25162J39368_10010189 | 323 |
| 86 | 3300003214 | JGI25165J46597_1000957 | JGI25165J46597_100095721 | 323 |
| 87 | 3300003323 | rootH1_10000566 | rootH1_10000566153 | 323 |
| 88 | 3300003323 | rootH1_10030244 | rootH1_100302442 | 323 |
| 89 | 3300005288 | Ga0065714_10014223 | Ga0065714_100142233 | 323 |
| 90 | 3300005288 | Ga0065714_10097502 | Ga0065714_100975022 | 323 |
| 91 | 3300005327 | Ga0070658_10066481 | Ga0070658_100664813 | 323 |
| 92 | 3300005327 | Ga0070658_10141623 | Ga0070658_101416232 | 323 |
| 93 | 3300005328 | Ga0070676_10000262 | Ga0070676_100002628 | 323 |
| 94 | 3300005328 | Ga0070676_10058847 | Ga0070676_100588472 | 323 |
| 95 | 3300005328 | Ga0070676_10164203 | Ga0070676_101642032 | 323 |
| 96 | 3300005331 | Ga0070670_100033641 | Ga0070670_1000336411 | 323 |
| 97 | 3300005331 | Ga0070670_100120234 | Ga0070670_1001202342 | 323 |
| 98 | 3300005331 | Ga0070670_100256190 | Ga0070670_1002561902 | 323 |
| 99 | 3300005331 | Ga0070670_100291781 | Ga0070670_1002917812 | 323 |
| 100 | 3300005331 | Ga0070670_100344651 | Ga0070670_1003446512 | 323 |
| 101 | 3300005334 | Ga0068869_100093235 | Ga0068869_1000932352 | 323 |
| 102 | 3300005335 | Ga0070666_10000039 | Ga0070666_1000003930 | 323 |
| 103 | 3300005335 | Ga0070666_10013535 | Ga0070666_100135352 | 323 |
| 104 | 3300005336 | Ga0070680_100004495 | Ga0070680_1000044954 | 323 |
| 105 | 3300005337 | Ga0070682_100000106 | Ga0070682_10000010611 | 323 |
| 106 | 3300005337 | Ga0070682_100010447 | Ga0070682_1000104474 | 323 |
| 107 | 3300005338 | Ga0068868_100001486 | Ga0068868_10000148614 | 323 |
| 108 | 3300005338 | Ga0068868_100011655 | Ga0068868_1000116556 | 323 |
| 109 | 3300005338 | Ga0068868_100015137 | Ga0068868_1000151375 | 323 |
| 110 | 3300005339 | Ga0070660_100008755 | Ga0070660_1000087557 | 323 |
| 111 | 3300005340 | Ga0070689_100192275 | Ga0070689_1001922752 | 323 |
| 112 | 3300005341 | Ga0070691_10024066 | Ga0070691_100240663 | 323 |
| 113 | 3300005347 | Ga0070668_100000036 | Ga0070668_10000003682 | 323 |
| 114 | 3300005347 | Ga0070668_100085521 | Ga0070668_1000855212 | 323 |
| 115 | 3300005354 | Ga0070675_100086939 | Ga0070675_1000869393 | 323 |
| 116 | 3300005355 | Ga0070671_100118400 | Ga0070671_1001184002 | 323 |
| 117 | 3300005355 | Ga0070671_100162442 | Ga0070671_1001624421 | 323 |
| 118 | 3300005355 | Ga0070671_100379302 | Ga0070671_1003793022 | 323 |
| 119 | 3300005364 | Ga0070673_100000580 | Ga0070673_1000005807 | 323 |
| 120 | 3300005364 | Ga0070673_100201891 | Ga0070673_1002018912 | 323 |
| 121 | 3300005366 | Ga0070659_100001045 | Ga0070659_10000104515 | 323 |
| 122 | 3300005367 | Ga0070667_100000151 | Ga0070667_10000015167 | 323 |
| 123 | 3300005367 | Ga0070667_100008389 | Ga0070667_1000083896 | 323 |
| 124 | 3300005367 | Ga0070667_100015079 | Ga0070667_1000150793 | 323 |
| 125 | 3300005455 | Ga0070663_100013428 | Ga0070663_1000134283 | 323 |
| 126 | 3300005457 | Ga0070662_100001317 | Ga0070662_1000013172 | 323 |
| 127 | 3300005458 | Ga0070681_10035380 | Ga0070681_100353801 | 323 |
| 128 | 3300005458 | Ga0070681_10078206 | Ga0070681_100782063 | 323 |
| 129 | 3300005459 | Ga0068867_100001155 | Ga0068867_10000115519 | 323 |
| 130 | 3300005459 | Ga0068867_100017794 | Ga0068867_1000177946 | 323 |
| 131 | 3300005459 | Ga0068867_100021893 | Ga0068867_1000218933 | 323 |
| 132 | 3300005530 | Ga0070679_100002055 | Ga0070679_10000205514 | 323 |
| 133 | 3300005530 | Ga0070679_100097257 | Ga0070679_1000972573 | 323 |
| 134 | 3300005530 | Ga0070679_100267738 | Ga0070679_1002677381 | 323 |
| 135 | 3300005539 | Ga0068853_100010474 | Ga0068853_1000104743 | 323 |
| 136 | 3300005539 | Ga0068853_100026708 | Ga0068853_1000267083 | 323 |
| 137 | 3300005539 | Ga0068853_100096833 | Ga0068853_1000968332 | 323 |
| 138 | 3300005543 | Ga0070672_100000225 | Ga0070672_1000002259 | 323 |
| 139 | 3300005563 | Ga0068855_100387850 | Ga0068855_1003878502 | 323 |
| 140 | 3300005577 | Ga0068857_100013369 | Ga0068857_1000133694 | 323 |
| 141 | 3300005614 | Ga0068856_100000044 | Ga0068856_10000004493 | 323 |
| 142 | 3300005614 | Ga0068856_100240828 | Ga0068856_1002408282 | 323 |
| 143 | 3300005616 | Ga0068852_100091369 | Ga0068852_1000913692 | 323 |
| 144 | 3300005616 | Ga0068852_100117656 | Ga0068852_1001176563 | 323 |
| 145 | 3300005617 | Ga0068859_100000006 | Ga0068859_100000006149 | 323 |
| 146 | 3300005617 | Ga0068859_100028907 | Ga0068859_1000289072 | 323 |
| 147 | 3300005617 | Ga0068859_100288601 | Ga0068859_1002886012 | 323 |
| 148 | 3300005618 | Ga0068864_100001963 | Ga0068864_10000196310 | 323 |
| 149 | 3300005618 | Ga0068864_100008085 | Ga0068864_1000080856 | 323 |
| 150 | 3300005618 | Ga0068864_100247214 | Ga0068864_1002472142 | 323 |
| 151 | 3300005834 | Ga0068851_10000910 | Ga0068851_1000091010 | 323 |
| 152 | 3300005834 | Ga0068851_10006636 | Ga0068851_100066362 | 323 |
| 153 | 3300005840 | Ga0068870_10081869 | Ga0068870_100818692 | 323 |
| 154 | 3300005841 | Ga0068863_100000510 | Ga0068863_10000051028 | 323 |
| 155 | 3300005841 | Ga0068863_100000808 | Ga0068863_1000008085 | 323 |
| 156 | 3300005841 | Ga0068863_100009631 | Ga0068863_1000096318 | 323 |
| 157 | 3300005842 | Ga0068858_100004985 | Ga0068858_1000049856 | 323 |
| 158 | 3300005842 | Ga0068858_100079999 | Ga0068858_1000799992 | 323 |
| 159 | 3300005842 | Ga0068858_100249069 | Ga0068858_1002490692 | 323 |
| 160 | 3300005842 | Ga0068858_100336273 | Ga0068858_1003362732 | 323 |
| 161 | 3300005843 | Ga0068860_100004849 | Ga0068860_1000048498 | 323 |
| 162 | 3300005843 | Ga0068860_100008104 | Ga0068860_1000081049 | 323 |
| 163 | 3300005843 | Ga0068860_100008374 | Ga0068860_1000083749 | 323 |
| 164 | 3300005843 | Ga0068860_100048712 | Ga0068860_1000487126 | 323 |
| 165 | 3300005843 | Ga0068860_100076353 | Ga0068860_1000763532 | 323 |
| 166 | 3300006195 | Ga0075366_10000091 | Ga0075366_100000913 | 323 |
| 167 | 3300006237 | Ga0097621_100001898 | Ga0097621_1000018987 | 323 |
| 168 | 3300006237 | Ga0097621_100010967 | Ga0097621_1000109672 | 323 |
| 169 | 3300006237 | Ga0097621_100017257 | Ga0097621_1000172575 | 323 |
| 170 | 3300006237 | Ga0097621_100027628 | Ga0097621_1000276285 | 323 |
| 171 | 3300006237 | Ga0097621_100057664 | Ga0097621_1000576643 | 323 |
| 172 | 3300006237 | Ga0097621_100251812 | Ga0097621_1002518122 | 323 |
| 173 | 3300006358 | Ga0068871_100120227 | Ga0068871_1001202271 | 323 |
| 174 | 3300006358 | Ga0068871_100160150 | Ga0068871_1001601503 | 323 |
| 175 | 3300006881 | Ga0068865_100005575 | Ga0068865_1000055755 | 323 |
| 176 | 3300006881 | Ga0068865_100046368 | Ga0068865_1000463683 | 323 |
| 177 | 3300006931 | Ga0097620_100000006 | Ga0097620_100000006149 | 323 |
| 178 | 3300006931 | Ga0097620_100028907 | Ga0097620_1000289072 | 323 |
| 179 | 3300006931 | Ga0097620_100288623 | Ga0097620_1002886232 | 323 |
| 180 | 3300009093 | Ga0105240_10012464 | Ga0105240_100124648 | 323 |
| 181 | 3300009093 | Ga0105240_10014907 | Ga0105240_100149072 | 323 |
| 182 | 3300009093 | Ga0105240_10054067 | Ga0105240_100540676 | 323 |
| 183 | 3300009093 | Ga0105240_10188674 | Ga0105240_101886741 | 323 |
| 184 | 3300009101 | Ga0105247_10003395 | Ga0105247_100033954 | 323 |
| 185 | 3300009174 | Ga0105241_10002398 | Ga0105241_1000239810 | 323 |
| 186 | 3300009174 | Ga0105241_10004171 | Ga0105241_1000417111 | 323 |
| 187 | 3300009174 | Ga0105241_10141537 | Ga0105241_101415373 | 323 |
| 188 | 3300009176 | Ga0105242_10046774 | Ga0105242_100467744 | 323 |
| 189 | 3300009176 | Ga0105242_10087583 | Ga0105242_100875833 | 323 |
| 190 | 3300009176 | Ga0105242_10198095 | Ga0105242_101980953 | 323 |
| 191 | 3300009176 | Ga0105242_10260118 | Ga0105242_102601182 | 323 |
| 192 | 3300009176 | Ga0105242_10278139 | Ga0105242_102781392 | 323 |
| 193 | 3300009545 | Ga0105237_10010099 | Ga0105237_1001009911 | 323 |
| 194 | 3300009545 | Ga0105237_10016270 | Ga0105237_100162707 | 323 |
| 195 | 3300009545 | Ga0105237_10134018 | Ga0105237_101340183 | 323 |
| 196 | 3300009545 | Ga0105237_10663877 | Ga0105237_106638771 | 323 |
| 197 | 3300009553 | Ga0105249_10000514 | Ga0105249_100005143 | 323 |
| 198 | 3300009553 | Ga0105249_10003735 | Ga0105249_100037356 | 323 |
| 199 | 3300009553 | Ga0105249_10045567 | Ga0105249_100455673 | 323 |
| 200 | 3300009553 | Ga0105249_10518733 | Ga0105249_105187332 | 323 |
| 201 | 3300010375 | Ga0105239_10000002 | Ga0105239_10000002290 | 323 |
| 202 | 3300010375 | Ga0105239_10000006 | Ga0105239_10000006194 | 323 |
| 203 | 3300010375 | Ga0105239_10144574 | Ga0105239_101445743 | 323 |
| 204 | 3300011119 | Ga0105246_10078917 | Ga0105246_100789173 | 323 |
| 205 | 3300011119 | Ga0105246_10139401 | Ga0105246_101394012 | 323 |
| 206 | 3300013100 | Ga0157373_10024983 | Ga0157373_100249833 | 323 |
| 207 | 3300013102 | Ga0157371_10000269 | Ga0157371_1000026922 | 323 |
| 208 | 3300013102 | Ga0157371_10001621 | Ga0157371_100016217 | 323 |
| 209 | 3300013104 | Ga0157370_10002126 | Ga0157370_100021263 | 323 |
| 210 | 3300013104 | Ga0157370_10041718 | Ga0157370_100417183 | 323 |
| 211 | 3300013104 | Ga0157370_10213840 | Ga0157370_102138402 | 323 |
| 212 | 3300013104 | Ga0157370_10386939 | Ga0157370_103869392 | 323 |
| 213 | 3300013105 | Ga0157369_10012411 | Ga0157369_100124118 | 323 |
| 214 | 3300013105 | Ga0157369_10107756 | Ga0157369_101077563 | 323 |
| 215 | 3300013105 | Ga0157369_10191244 | Ga0157369_101912443 | 323 |
| 216 | 3300013296 | Ga0157374_10000498 | Ga0157374_1000049828 | 323 |
| 217 | 3300013296 | Ga0157374_10122394 | Ga0157374_101223943 | 323 |
| 218 | 3300013296 | Ga0157374_10350657 | Ga0157374_103506572 | 323 |
| 219 | 3300013297 | Ga0157378_10005867 | Ga0157378_100058673 | 323 |
| 220 | 3300013297 | Ga0157378_10020619 | Ga0157378_100206197 | 323 |
| 221 | 3300013297 | Ga0157378_10026055 | Ga0157378_100260553 | 323 |
| 222 | 3300013297 | Ga0157378_10465108 | Ga0157378_104651082 | 323 |
| 223 | 3300013306 | Ga0163162_10000504 | Ga0163162_1000050430 | 323 |
| 224 | 3300013306 | Ga0163162_10000905 | Ga0163162_100009058 | 323 |
| 225 | 3300013306 | Ga0163162_10018680 | Ga0163162_100186803 | 323 |
| 226 | 3300013306 | Ga0163162_10111313 | Ga0163162_101113132 | 323 |
| 227 | 3300013306 | Ga0163162_10567600 | Ga0163162_105676002 | 323 |
| 228 | 3300013306 | Ga0163162_10646184 | Ga0163162_106461842 | 323 |
| 229 | 3300013307 | Ga0157372_10000009 | Ga0157372_10000009111 | 323 |
| 230 | 3300013307 | Ga0157372_10001087 | Ga0157372_100010875 | 323 |
| 231 | 3300013307 | Ga0157372_10291391 | Ga0157372_102913912 | 323 |
| 232 | 3300013307 | Ga0157372_10349014 | Ga0157372_103490142 | 323 |
| 233 | 3300013308 | Ga0157375_10000476 | Ga0157375_100004767 | 323 |
| 234 | 3300013308 | Ga0157375_10072718 | Ga0157375_100727182 | 323 |
| 235 | 3300013308 | Ga0157375_10164053 | Ga0157375_101640533 | 323 |
| 236 | 3300013308 | Ga0157375_10183021 | Ga0157375_101830213 | 323 |
| 237 | 3300014325 | Ga0163163_10004719 | Ga0163163_100047198 | 323 |
| 238 | 3300014325 | Ga0163163_10105809 | Ga0163163_101058093 | 323 |
| 239 | 3300014745 | Ga0157377_10071938 | Ga0157377_100719382 | 323 |
| 240 | 3300014968 | Ga0157379_10000114 | Ga0157379_1000011426 | 323 |
| 241 | 3300014968 | Ga0157379_10095897 | Ga0157379_100958972 | 323 |
| 242 | 3300014968 | Ga0157379_10284757 | Ga0157379_102847572 | 323 |
| 243 | 3300014969 | Ga0157376_10000571 | Ga0157376_1000057113 | 323 |
| 244 | 3300014969 | Ga0157376_10000596 | Ga0157376_1000059616 | 323 |
| 245 | 3300014969 | Ga0157376_10030268 | Ga0157376_100302683 | 323 |
| 246 | 3300014969 | Ga0157376_10415363 | Ga0157376_104153631 | 323 |
| 247 | 3300017792 | Ga0163161_10026385 | Ga0163161_100263853 | 323 |
| 248 | 3300017792 | Ga0163161_10152920 | Ga0163161_101529202 | 323 |
| 249 | 3300021384 | Ga0213876_10016894 | Ga0213876_100168945 | 323 |
| 250 | 3300025231 | Ga0207427_100093 | Ga0207427_10009366 | 323 |
| 251 | 3300025233 | Ga0209437_100008 | Ga0209437_100008484 | 323 |
| 252 | 3300025250 | Ga0209026_1002432 | Ga0209026_10024322 | 323 |
| 253 | 3300025261 | Ga0209233_1000024 | Ga0209233_1000024173 | 323 |
| 254 | 3300025261 | Ga0209233_1001440 | Ga0209233_10014403 | 323 |
| 255 | 3300025321 | Ga0207656_10003101 | Ga0207656_100031013 | 323 |
| 256 | 3300025321 | Ga0207656_10126162 | Ga0207656_101261622 | 323 |
| 257 | 3300025899 | Ga0207642_10065770 | Ga0207642_100657702 | 323 |
| 258 | 3300025901 | Ga0207688_10021799 | Ga0207688_100217993 | 323 |
| 259 | 3300025903 | Ga0207680_10000477 | Ga0207680_100004773 | 323 |
| 260 | 3300025903 | Ga0207680_10098854 | Ga0207680_100988542 | 323 |
| 261 | 3300025904 | Ga0207647_10000463 | Ga0207647_1000046334 | 323 |
| 262 | 3300025904 | Ga0207647_10089267 | Ga0207647_100892672 | 323 |
| 263 | 3300025907 | Ga0207645_10000631 | Ga0207645_1000063114 | 323 |
| 264 | 3300025907 | Ga0207645_10006683 | Ga0207645_100066832 | 323 |
| 265 | 3300025907 | Ga0207645_10064024 | Ga0207645_100640242 | 323 |
| 266 | 3300025908 | Ga0207643_10010665 | Ga0207643_100106654 | 323 |
| 267 | 3300025909 | Ga0207705_10092508 | Ga0207705_100925081 | 323 |
| 268 | 3300025909 | Ga0207705_10115262 | Ga0207705_101152622 | 323 |
| 269 | 3300025909 | Ga0207705_10243116 | Ga0207705_102431162 | 323 |
| 270 | 3300025911 | Ga0207654_10003746 | Ga0207654_100037462 | 323 |
| 271 | 3300025911 | Ga0207654_10075746 | Ga0207654_100757462 | 323 |
| 272 | 3300025912 | Ga0207707_10000611 | Ga0207707_1000061124 | 323 |
| 273 | 3300025913 | Ga0207695_10043574 | Ga0207695_100435745 | 323 |
| 274 | 3300025913 | Ga0207695_10044680 | Ga0207695_100446803 | 323 |
| 275 | 3300025914 | Ga0207671_10000901 | Ga0207671_1000090114 | 323 |
| 276 | 3300025914 | Ga0207671_10004440 | Ga0207671_100044406 | 323 |
| 277 | 3300025917 | Ga0207660_10012546 | Ga0207660_100125463 | 323 |
| 278 | 3300025919 | Ga0207657_10102049 | Ga0207657_101020493 | 323 |
| 279 | 3300025921 | Ga0207652_10037362 | Ga0207652_100373621 | 323 |
| 280 | 3300025921 | Ga0207652_10075892 | Ga0207652_100758923 | 323 |
| 281 | 3300025923 | Ga0207681_10105412 | Ga0207681_101054121 | 323 |
| 282 | 3300025925 | Ga0207650_10196671 | Ga0207650_101966712 | 323 |
| 283 | 3300025925 | Ga0207650_10202701 | Ga0207650_102027013 | 323 |
| 284 | 3300025925 | Ga0207650_10219815 | Ga0207650_102198152 | 323 |
| 285 | 3300025925 | Ga0207650_10221907 | Ga0207650_102219072 | 323 |
| 286 | 3300025925 | Ga0207650_10262289 | Ga0207650_102622892 | 323 |
| 287 | 3300025926 | Ga0207659_10047244 | Ga0207659_100472442 | 323 |
| 288 | 3300025932 | Ga0207690_10000770 | Ga0207690_1000077011 | 323 |
| 289 | 3300025933 | Ga0207706_10267843 | Ga0207706_102678432 | 323 |
| 290 | 3300025934 | Ga0207686_10139000 | Ga0207686_101390002 | 323 |
| 291 | 3300025938 | Ga0207704_10000928 | Ga0207704_1000092810 | 323 |
| 292 | 3300025940 | Ga0207691_10000067 | Ga0207691_1000006734 | 323 |
| 293 | 3300025942 | Ga0207689_10000466 | Ga0207689_1000046632 | 323 |
| 294 | 3300025942 | Ga0207689_10000822 | Ga0207689_1000082215 | 323 |
| 295 | 3300025942 | Ga0207689_10004188 | Ga0207689_100041887 | 323 |
| 296 | 3300025945 | Ga0207679_10066637 | Ga0207679_100666373 | 323 |
| 297 | 3300025949 | Ga0207667_10073635 | Ga0207667_100736353 | 323 |
| 298 | 3300025949 | Ga0207667_10219840 | Ga0207667_102198403 | 323 |
| 299 | 3300025960 | Ga0207651_10013729 | Ga0207651_100137293 | 323 |
| 300 | 3300025960 | Ga0207651_10093510 | Ga0207651_100935102 | 323 |
| 301 | 3300025961 | Ga0207712_10002681 | Ga0207712_100026814 | 323 |
| 302 | 3300025961 | Ga0207712_10066122 | Ga0207712_100661223 | 323 |
| 303 | 3300025972 | Ga0207668_10004205 | Ga0207668_100042054 | 323 |
| 304 | 3300025986 | Ga0207658_10002592 | Ga0207658_1000259210 | 323 |
| 305 | 3300025986 | Ga0207658_10004922 | Ga0207658_100049224 | 323 |
| 306 | 3300025986 | Ga0207658_10027154 | Ga0207658_100271543 | 323 |
| 307 | 3300026023 | Ga0207677_10000704 | Ga0207677_1000070410 | 323 |
| 308 | 3300026023 | Ga0207677_10029370 | Ga0207677_100293704 | 323 |
| 309 | 3300026023 | Ga0207677_10033614 | Ga0207677_100336143 | 323 |
| 310 | 3300026023 | Ga0207677_10124907 | Ga0207677_101249073 | 323 |
| 311 | 3300026035 | Ga0207703_10006122 | Ga0207703_100061225 | 323 |
| 312 | 3300026041 | Ga0207639_10022439 | Ga0207639_100224395 | 323 |
| 313 | 3300026041 | Ga0207639_10193811 | Ga0207639_101938112 | 323 |
| 314 | 3300026067 | Ga0207678_10024761 | Ga0207678_100247614 | 323 |
| 315 | 3300026078 | Ga0207702_10000140 | Ga0207702_1000014074 | 323 |
| 316 | 3300026088 | Ga0207641_10000186 | Ga0207641_1000018665 | 323 |
| 317 | 3300026088 | Ga0207641_10001302 | Ga0207641_100013029 | 323 |
| 318 | 3300026088 | Ga0207641_10014663 | Ga0207641_100146635 | 323 |
| 319 | 3300026088 | Ga0207641_10333027 | Ga0207641_103330272 | 323 |
| 320 | 3300026089 | Ga0207648_10003938 | Ga0207648_1000393813 | 323 |
| 321 | 3300026089 | Ga0207648_10004023 | Ga0207648_100040239 | 323 |
| 322 | 3300026089 | Ga0207648_10274131 | Ga0207648_102741312 | 323 |
| 323 | 3300026089 | Ga0207648_10323286 | Ga0207648_103232862 | 323 |
| 324 | 3300026095 | Ga0207676_10000785 | Ga0207676_1000078515 | 323 |
| 325 | 3300026095 | Ga0207676_10006443 | Ga0207676_100064436 | 323 |
| 326 | 3300026095 | Ga0207676_10131584 | Ga0207676_101315842 | 323 |
| 327 | 3300026116 | Ga0207674_10054578 | Ga0207674_100545783 | 323 |
| 328 | 3300026118 | Ga0207675_100016499 | Ga0207675_1000164997 | 323 |
| 329 | 3300026118 | Ga0207675_100018172 | Ga0207675_1000181723 | 323 |
| 330 | 3300026118 | Ga0207675_100087005 | Ga0207675_1000870053 | 323 |
| 331 | 3300026121 | Ga0207683_10005934 | Ga0207683_100059347 | 323 |
| 332 | 3300026121 | Ga0207683_10099198 | Ga0207683_100991983 | 323 |
| 333 | 3300026142 | Ga0207698_10002015 | Ga0207698_100020159 | 323 |
| 334 | 3300028379 | Ga0268266_10065272 | Ga0268266_100652722 | 323 |
| 335 | 3300028381 | Ga0268264_10006912 | Ga0268264_100069128 | 323 |
| 336 | 3300028381 | Ga0268264_10026202 | Ga0268264_100262024 | 323 |
| 337 | 3300028794 | Ga0307515_10000001 | Ga0307515_100000012394 | 323 |
| 338 | 3300028794 | Ga0307515_10000021 | Ga0307515_1000002164 | 323 |
| 339 | 3300028794 | Ga0307515_10000790 | Ga0307515_1000079027 | 323 |
| 340 | 3300028794 | Ga0307515_10001523 | Ga0307515_1000152312 | 323 |
| 341 | 3300030521 | Ga0307511_10000104 | Ga0307511_100001045 | 323 |
| 342 | 3300031251 | Ga0265327_10000410 | Ga0265327_1000041054 | 323 |
| 343 | 3300031251 | Ga0265327_10059149 | Ga0265327_100591493 | 323 |
| 344 | 3300031251 | Ga0265327_10099455 | Ga0265327_100994551 | 323 |
| 345 | 3300031507 | Ga0307509_10002733 | Ga0307509_1000273310 | 323 |
| 346 | 3300033179 | Ga0307507_10000078 | Ga0307507_10000078102 | 323 |
| 347 | 3300035695 | Ga0373927_0107847 | Ga0373927_0107847_489_1502 | 323 |
| 348 | 3300036401 | Ga0373937_0398207 | Ga0373937_0398207_115_1131 | 323 |
| 349 | 3300037312 | Ga0395899_0000001 | Ga0395899_0000001_1227969_1228982 | 323 |
| 350 | 3300037312 | Ga0395899_0002957 | Ga0395899_0002957_9068_10081 | 323 |
| 351 | 3300038443 | Ga0395901_0276149 | Ga0395901_0276149_569_1585 | 323 |
| 352 | 3300039437 | Ga0436365_0130893 | Ga0436365_0130893_1074_2087 | 323 |
| 353 | 3300039437 | Ga0436365_0905676 | Ga0436365_0905676_1315_2328 | 323 |
| 354 | 3300044684 | Ga0466966_0014474 | Ga0466966_0014474_219_1232 | 323 |
| 355 | 3300045049 | Ga0466959_0051529 | Ga0466959_0051529_439_1452 | 323 |
| 356 | 3300046471 | Ga0495650_0027320 | Ga0495650_0027320_184_1203 | 323 |
| 357 | 3300046472 | Ga0495580_0103587 | Ga0495580_0103587_722_1738 | 323 |
| 358 | 3300046492 | Ga0495585_0001288 | Ga0495585_0001288_9058_10068 | 323 |
| 359 | 3300046507 | Ga0495606_0011271 | Ga0495606_0011271_1529_2539 | 323 |
| 360 | 3300046516 | Ga0495628_0092528 | Ga0495628_0092528_898_1908 | 323 |
| 361 | 3300046523 | Ga0495644_0001493 | Ga0495644_0001493_2301_3311 | 323 |
| 362 | 3300046524 | Ga0495648_0005741 | Ga0495648_0005741_6832_7842 | 323 |
| 363 | 3300046528 | Ga0495642_0073386 | Ga0495642_0073386_232_1248 | 323 |
| 364 | 3300046530 | Ga0495654_0051002 | Ga0495654_0051002_827_1837 | 323 |
| 365 | 3300046538 | Ga0495609_0024823 | Ga0495609_0024823_1257_2267 | 323 |
| 366 | 3300046558 | Ga0495633_0000074 | Ga0495633_0000074_124451_125461 | 323 |
| 367 | 3300046616 | Ga0495668_0000017 | Ga0495668_0000017_269164_270174 | 323 |
| 368 | 3300046660 | Ga0495625_0000435 | Ga0495625_0000435_16928_17938 | 323 |
| 369 | 3300046660 | Ga0495625_0001213 | Ga0495625_0001213_30063_31073 | 323 |
| 370 | 3300046665 | Ga0495661_0008787 | Ga0495661_0008787_2088_3098 | 323 |
| 371 | 3300046665 | Ga0495661_0021254 | Ga0495661_0021254_304_1314 | 323 |
| 372 | 3300046683 | Ga0495658_0005676 | Ga0495658_0005676_4275_5285 | 323 |
| 373 | 3300046683 | Ga0495658_0046684 | Ga0495658_0046684_856_1872 | 323 |
| 374 | 3300046690 | Ga0495624_0117151 | Ga0495624_0117151_267_1283 | 323 |
| 375 | 3300046810 | Ga0495660_0095783 | Ga0495660_0095783_420_1430 | 323 |
| 376 | 3300047320 | Ga0495672_0035325 | Ga0495672_0035325_1754_2770 | 323 |
| 377 | 3300047472 | Ga0495686_0001184 | Ga0495686_0001184_17468_18484 | 323 |
| 378 | 3300048089 | Ga0495614_0038317 | Ga0495614_0038317_166_1176 | 323 |
| 379 | 3300048911 | Ga0496108_0101319 | Ga0496108_0101319_514_1530 | 323 |
| 380 | 3300048918 | Ga0496115_0133411 | Ga0496115_0133411_380_1396 | 323 |
| 381 | 3300049460 | Ga0495682_0005922 | Ga0495682_0005922_2469_3479 | 323 |
| 382 | 3300049586 | Ga0501070_0062857 | Ga0501070_0062857_303_1319 | 323 |
| 383 | 3300049590 | Ga0501074_0243011 | Ga0501074_0243011_108_1124 | 323 |
| 384 | 3300049742 | Ga0501080_0156135 | Ga0501080_0156135_157_1173 | 323 |
| 385 | 3300049744 | Ga0501083_0137613 | Ga0501083_0137613_426_1442 | 323 |
| 386 | 3300049823 | Ga0501044_0039123 | Ga0501044_0039123_431_1447 | 323 |
| 387 | 3300050493 | nmdc:mga0k408_323_c1 | nmdc:mga0k408_323_c1_9388_10404 | 323 |
| 388 | 3300050493 | nmdc:mga0k408_424_c1 | nmdc:mga0k408_424_c1_6063_7073 | 323 |
| 389 | 3300050493 | nmdc:mga0k408_8795_c1 | nmdc:mga0k408_8795_c1_4263_5273 | 323 |
| 390 | 3300053080 | Ga0500635_0003493 | Ga0500635_0003493_651_1664 | 323 |
| 391 | 3300053092 | Ga0500583_0000075 | Ga0500583_0000075_23262_24272 | 323 |
| 392 | 3300053125 | Ga0500618_000020 | Ga0500618_000020_150639_151649 | 323 |
| 393 | 3300053134 | Ga0500658_0055825 | Ga0500658_0055825_601_1611 | 323 |
| 394 | 3300053156 | Ga0500622_0000719 | Ga0500622_0000719_10676_11692 | 323 |
| 395 | 3300054114 | Ga0501084_0113903 | Ga0501084_0113903_336_1352 | 323 |
| 396 | 3300060353 | Ga0501082_0014134 | Ga0501082_0014134_3290_4306 | 323 |
| 397 | 3300005293 | Ga0065715_10007513 | Ga0065715_100075133 | 324 |
| 398 | 3300009036 | Ga0105244_10000013 | Ga0105244_1000001327 | 324 |
| 399 | 3300049571 | Ga0501034_0322880 | Ga0501034_0322880_135_1154 | 324 |
| 400 | 3300049572 | Ga0501036_0174381 | Ga0501036_0174381_342_1361 | 324 |
| 401 | 3300049579 | Ga0501043_0076249 | Ga0501043_0076249_697_1716 | 324 |
| 402 | 3300049581 | Ga0501047_0055092 | Ga0501047_0055092_1536_2555 | 324 |
| 403 | 3300001915 | JGI24741J21665_1002032 | JGI24741J21665_10020326 | 325 |
| 404 | 3300003320 | rootH2_10040511 | rootH2_100405118 | 325 |
| 405 | 3300003322 | rootL2_10280896 | rootL2_102808965 | 325 |
| 406 | 3300003784 | Ga0055534_1009364 | Ga0055534_10093642 | 325 |
| 407 | 3300005288 | Ga0065714_10064456 | Ga0065714_1006445634 | 325 |
| 408 | 3300005329 | Ga0070683_100002098 | Ga0070683_1000020983 | 325 |
| 409 | 3300005337 | Ga0070682_100000133 | Ga0070682_10000013327 | 325 |
| 410 | 3300005339 | Ga0070660_100056862 | Ga0070660_1000568624 | 325 |
| 411 | 3300005535 | Ga0070684_100023412 | Ga0070684_1000234125 | 325 |
| 412 | 3300005547 | Ga0070693_100024304 | Ga0070693_1000243041 | 325 |
| 413 | 3300006942 | Ga0099824_1014579 | Ga0099824_101457910 | 325 |
| 414 | 3300006946 | Ga0079104_1000079 | Ga0079104_100007992 | 325 |
| 415 | 3300006948 | Ga0099826_10001967 | Ga0099826_1000196713 | 325 |
| 416 | 3300009092 | Ga0105250_10003528 | Ga0105250_100035287 | 325 |
| 417 | 3300009092 | Ga0105250_10017310 | Ga0105250_100173103 | 325 |
| 418 | 3300009148 | Ga0105243_10254848 | Ga0105243_102548482 | 325 |
| 419 | 3300013100 | Ga0157373_10000035 | Ga0157373_1000003581 | 325 |
| 420 | 3300013104 | Ga0157370_10000334 | Ga0157370_1000033439 | 325 |
| 421 | 3300013104 | Ga0157370_10000844 | Ga0157370_1000084410 | 325 |
| 422 | 3300013104 | Ga0157370_10001492 | Ga0157370_1000149210 | 325 |
| 423 | 3300013104 | Ga0157370_10003337 | Ga0157370_100033378 | 325 |
| 424 | 3300013104 | Ga0157370_10011599 | Ga0157370_100115995 | 325 |
| 425 | 3300013104 | Ga0157370_10021334 | Ga0157370_100213348 | 325 |
| 426 | 3300013105 | Ga0157369_10000136 | Ga0157369_1000013648 | 325 |
| 427 | 3300013105 | Ga0157369_10000235 | Ga0157369_1000023518 | 325 |
| 428 | 3300013306 | Ga0163162_10033233 | Ga0163162_100332335 | 325 |
| 429 | 3300013308 | Ga0157375_10000334 | Ga0157375_1000033435 | 325 |
| 430 | 3300015261 | Ga0182006_1000001 | Ga0182006_100000128 | 325 |
| 431 | 3300015261 | Ga0182006_1002746 | Ga0182006_100274610 | 325 |
| 432 | 3300015261 | Ga0182006_1016041 | Ga0182006_10160412 | 325 |
| 433 | 3300017792 | Ga0163161_10027825 | Ga0163161_100278252 | 325 |
| 434 | 3300017792 | Ga0163161_10032934 | Ga0163161_100329345 | 325 |
| 435 | 3300017792 | Ga0163161_10052451 | Ga0163161_100524512 | 325 |
| 436 | 3300017792 | Ga0163161_10206963 | Ga0163161_102069632 | 325 |
| 437 | 3300025291 | Ga0209675_1000034 | Ga0209675_1000034217 | 325 |
| 438 | 3300025711 | Ga0207696_1011515 | Ga0207696_10115152 | 325 |
| 439 | 3300025728 | Ga0207655_1000031 | Ga0207655_100003127 | 325 |
| 440 | 3300025935 | Ga0207709_10160222 | Ga0207709_101602222 | 325 |
| 441 | 3300027111 | Ga0209281_1000367 | Ga0209281_100036716 | 325 |
| 442 | 3300027361 | Ga0209489_112459 | Ga0209489_1124593 | 325 |
| 443 | 3300027471 | Ga0209995_1014177 | Ga0209995_10141772 | 325 |
| 444 | 3300027526 | Ga0209968_1003348 | Ga0209968_10033483 | 325 |
| 445 | 3300027666 | Ga0209282_1004798 | Ga0209282_10047989 | 325 |
| 446 | 3300031911 | Ga0307412_10000006 | Ga0307412_1000000627 | 325 |
| 447 | 3300031911 | Ga0307412_10004489 | Ga0307412_100044893 | 325 |
| 448 | 3300032002 | Ga0307416_100000016 | Ga0307416_100000016161 | 325 |
| 449 | 3300032002 | Ga0307416_100000066 | Ga0307416_10000006647 | 325 |
| 450 | 3300032004 | Ga0307414_10031072 | Ga0307414_100310724 | 325 |
| 451 | 3300032004 | Ga0307414_10070071 | Ga0307414_100700712 | 325 |
| 452 | 3300042004 | Ga0439445_0000784 | Ga0439445_0000784_4074_5069 | 325 |
| 453 | 3300046453 | Ga0495627_000030 | Ga0495627_000030_33969_34964 | 325 |
| 454 | 3300046453 | Ga0495627_003089 | Ga0495627_003089_4677_5672 | 325 |
| 455 | 3300046500 | Ga0495596_0003279 | Ga0495596_0003279_7232_8227 | 325 |
| 456 | 3300046507 | Ga0495606_0004317 | Ga0495606_0004317_10909_11904 | 325 |
| 457 | 3300046507 | Ga0495606_0005407 | Ga0495606_0005407_5787_6782 | 325 |
| 458 | 3300046512 | Ga0495610_0000036 | Ga0495610_0000036_151408_152403 | 325 |
| 459 | 3300046519 | Ga0495632_0009960 | Ga0495632_0009960_2721_3716 | 325 |
| 460 | 3300046530 | Ga0495654_0000142 | Ga0495654_0000142_34728_35723 | 325 |
| 461 | 3300046538 | Ga0495609_0000137 | Ga0495609_0000137_39666_40661 | 325 |
| 462 | 3300046558 | Ga0495633_0000001 | Ga0495633_0000001_34510_35505 | 325 |
| 463 | 3300046558 | Ga0495633_0001351 | Ga0495633_0001351_6255_7250 | 325 |
| 464 | 3300046660 | Ga0495625_0000818 | Ga0495625_0000818_34295_35290 | 325 |
| 465 | 3300047472 | Ga0495686_0000327 | Ga0495686_0000327_40339_41334 | 325 |
| 466 | 3300048916 | Ga0496113_0328962 | Ga0496113_0328962_131_1147 | 325 |
| 467 | 3300048919 | Ga0496116_0000002 | Ga0496116_0000002_832010_833008 | 325 |
| 468 | 3300048919 | Ga0496116_0000068 | Ga0496116_0000068_226382_227398 | 325 |
| 469 | 3300048920 | Ga0496117_0000062 | Ga0496117_0000062_224317_225333 | 325 |
| 470 | 3300048920 | Ga0496117_0055618 | Ga0496117_0055618_1682_2680 | 325 |
| 471 | 3300048921 | Ga0496118_0000113 | Ga0496118_0000113_135443_136459 | 325 |
| 472 | 3300048921 | Ga0496118_0034877 | Ga0496118_0034877_1424_2422 | 325 |
| 473 | 3300048922 | Ga0496119_0000024 | Ga0496119_0000024_224328_225344 | 325 |
| 474 | 3300048924 | Ga0496121_0071173 | Ga0496121_0071173_946_1944 | 325 |
| 475 | 3300048925 | Ga0496122_0000530 | Ga0496122_0000530_27991_28986 | 325 |
| 476 | 3300048925 | Ga0496122_0001937 | Ga0496122_0001937_22373_23368 | 325 |
| 477 | 3300048925 | Ga0496122_0002619 | Ga0496122_0002619_3084_4100 | 325 |
| 478 | 3300048925 | Ga0496122_0007266 | Ga0496122_0007266_6177_7193 | 325 |
| 479 | 3300048926 | Ga0496123_0000474 | Ga0496123_0000474_36643_37659 | 325 |
| 480 | 3300048926 | Ga0496123_0044027 | Ga0496123_0044027_575_1591 | 325 |
| 481 | 3300048927 | Ga0496124_0001349 | Ga0496124_0001349_3473_4489 | 325 |
| 482 | 3300048927 | Ga0496124_0014480 | Ga0496124_0014480_3849_4847 | 325 |
| 483 | 3300048928 | Ga0496125_0000024 | Ga0496125_0000024_305154_306149 | 325 |
| 484 | 3300048928 | Ga0496125_0000108 | Ga0496125_0000108_84080_85078 | 325 |
| 485 | 3300048928 | Ga0496125_0000454 | Ga0496125_0000454_45859_46875 | 325 |
| 486 | 3300048928 | Ga0496125_0021680 | Ga0496125_0021680_2091_3107 | 325 |
| 487 | 3300048928 | Ga0496125_0120072 | Ga0496125_0120072_801_1796 | 325 |
| 488 | 3300048929 | Ga0496126_0000957 | Ga0496126_0000957_23818_24852 | 325 |
| 489 | 3300048929 | Ga0496126_0017909 | Ga0496126_0017909_4862_5857 | 325 |
| 490 | 3300049571 | Ga0501034_0061672 | Ga0501034_0061672_2176_3171 | 325 |
| 491 | iso_pu_bacteria | 2585428182 | 2588212055 | 325 |
| 492 | iso_pu_bacteria | 2585428185 | 2588225596 | 325 |
| 493 | iso_pu_bacteria | 2765235839 | 2765574806 | 325 |
| 494 | iso_pu_bacteria | 2816332188 | 2816876090 | 325 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7wux-assembly1.cif.gz_D | crystal structure of aziu3/u2 complexed with (5s,6s)-o7-sulfo dadh from streptomyces sahachiroi | 0.6784 | 1 | 324 |
| 7wux-assembly1.cif.gz_D | crystal structure of aziu3/u2 complexed with (5s,6s)-o7-sulfo dadh from streptomyces sahachiroi | 0.6748 | 1 | 324 |
| 7yn2-assembly1.cif.gz_A | crystal structure of ccbd with methylthiolincosamide | 0.6392 | 6 | 325 |
| 7yn2-assembly1.cif.gz_A | crystal structure of ccbd with methylthiolincosamide | 0.6296 | 6 | 325 |
| 5ohq-assembly1.cif.gz_A | crystal structure of the kow6-kow7 domain of human dsif | 0.6234 | 96 | 149 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A5A8R3_1_166_1.20.1270.60 | Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain | 0.6558 | 202 | 322 | 1.20.1270.60 |
| af_I1MTQ0_31_190_1.20.120.520 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);nmb1532 protein domain like | 0.641 | 202 | 323 | 1.20.120.520 |
| af_Q5VSI4_773_839_2.40.50.90 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); | 0.6306 | 100 | 149 | 2.40.50.90 |
| af_Q18826_258_405_1.20.1410.10 | Mainly Alpha;Up-down Bundle;I/LWEQ domain;I/LWEQ domain | 0.6221 | 178 | 320 | 1.20.1410.10 |
| af_Q93484_1_232_1.20.1270.60 | Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain | 0.6138 | 184 | 324 | 1.20.1270.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A136LIF0-F1-model_v4 | deleted | 0.9505 | 4 | 321 |
|
| AF-A0A550JF57-F1-model_v4 | DUF4872 domain-containing protein | 0.9495 | 1 | 324 |
GO:0016020
|
| AF-A0A2N8NCI0-F1-model_v4 | Peptidase | 0.9483 | 1 | 324 |
|
| AF-A0A2R4KJG4-F1-model_v4 | deleted | 0.9473 | 1 | 324 |
|
| AF-A0A1H8ETA9-F1-model_v4 | Butirosin biosynthesis protein H, N-terminal | 0.9438 | 1 | 324 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar