F454544

General Info

Members Datasets Scaffolds Average Seq Length
494 264 988 153

Family's Representative Sequence

Representative Sequence 3300005614|Ga0068856_100367454|Ga0068856_1003674542
Length 165
Sequence MPTHAFILNGEQVTVEAEGNLRLLWVLRDILGVTGPKYGCALNVCKACTCHINGLAFNPCSVQVKDIKPTDEITTIEGLPATVGADLHPMQQAWLDYDVAQCGYCQPGQVMAAVAKVKQVRSEGREITDADLDELRNICRCGTYSRIRQAVKAAAQKMTSLPRVP

Samples

Sample ID Description Type Environment
1 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
71 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
82 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
122 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
123 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
124 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
125 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
126 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
127 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
128 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
129 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
130 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
131 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
132 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
133 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
136 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
137 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
138 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
139 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
140 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
141 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
142 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
143 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
144 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
145 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
146 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
147 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
148 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
149 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
150 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
151 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
152 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
153 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
154 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
155 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
156 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
159 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
160 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
161 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
162 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
163 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
164 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
165 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
166 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
167 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
168 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
169 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
170 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
171 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
172 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
173 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
174 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
175 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
176 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
177 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
178 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
179 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
180 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
181 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
182 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
183 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
184 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
185 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
186 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
187 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
188 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
189 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
190 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
191 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
192 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
193 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
194 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
195 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
196 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
197 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
198 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
199 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
200 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
201 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
202 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
203 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
204 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
205 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
206 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
207 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
208 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
209 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
210 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
211 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
212 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
213 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
214 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
215 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
216 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
217 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
218 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
219 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
220 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
221 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
222 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
223 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
224 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
225 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
226 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
227 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
228 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
229 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
230 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
231 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
232 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
233 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
234 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
235 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
236 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
237 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
238 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
239 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
240 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
241 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
242 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
243 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
244 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
245 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
246 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
247 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
248 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
249 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
250 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
251 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
252 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
253 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
254 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
255 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
256 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
257 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
258 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
259 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
260 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
261 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
262 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
263 2956939328 Lolliginicoccus suaedae LNNU 331112 Isolate Rhizosphere
264 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.99
Metatranscriptomes 0
Isolates 1.01

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.4
Nodule 0
Rhizoplane 3.24
Rhizosphere 93.72
Stem 0
Stem Tuber 0.2
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068856_100367454 3300005614 Bacteria 1457
2 JGI24740J21852_10008617 3300001979 Bacteria 4052
3 JGI24739J22299_10007037 3300001989 Bacteria 4233
4 JGI24737J22298_10006911 3300001990 Bacteria 3850
5 JGI24737J22298_10029037 3300001990 Bacteria 1735
6 JGI24735J21928_10025332 3300002067 Bacteria 1790
7 Ga0070683_100311581 3300005329 Bacteria 1498
8 Ga0070683_100417366 3300005329 Bacteria 1280
9 Ga0068869_100054045 3300005334 Bacteria 2922
10 Ga0068869_100218488 3300005334 Bacteria 1509
11 Ga0070682_100444794 3300005337 Bacteria 991
12 Ga0068868_100485239 3300005338 Bacteria 1080
13 Ga0070691_10065015 3300005341 Bacteria 1761
14 Ga0070661_100189379 3300005344 Bacteria 1569
15 Ga0070668_100020069 3300005347 Bacteria 5039
16 Ga0070668_100438641 3300005347 Bacteria 1121
17 Ga0070668_100881724 3300005347 Bacteria 799
18 Ga0070668_101121111 3300005347 Bacteria 711
19 Ga0070675_100190691 3300005354 Bacteria 1776
20 Ga0070671_100145468 3300005355 Bacteria 2001
21 Ga0070671_102022211 3300005355 Bacteria 513
22 Ga0070674_102122442 3300005356 Bacteria 513
23 Ga0070673_100822017 3300005364 Bacteria 859
24 Ga0070688_100214650 3300005365 Bacteria 1353
25 Ga0070667_100185916 3300005367 Bacteria 1839
26 Ga0070714_100116943 3300005435 Bacteria 2367
27 Ga0070714_100289129 3300005435 Bacteria 1525
28 Ga0070714_100490288 3300005435 Bacteria 1171
29 Ga0070714_100668218 3300005435 Bacteria 1001
30 Ga0070713_100431021 3300005436 Bacteria 1235
31 Ga0070713_100482157 3300005436 Bacteria 1168
32 Ga0070713_100706776 3300005436 Bacteria 962
33 Ga0070710_10099383 3300005437 Bacteria 1730
34 Ga0070710_10106444 3300005437 Bacteria 1678
35 Ga0070710_10268457 3300005437 Bacteria 1102
36 Ga0070711_100251855 3300005439 Bacteria 1386
37 Ga0070700_100053579 3300005441 Bacteria 2518
38 Ga0070694_101191418 3300005444 Bacteria 638
39 Ga0070663_100757368 3300005455 Bacteria 830
40 Ga0070662_100206897 3300005457 Bacteria 1560
41 Ga0070685_10053005 3300005466 Bacteria 2348
42 Ga0070679_100966827 3300005530 Bacteria 795
43 Ga0070684_100289755 3300005535 Bacteria 1501
44 Ga0068853_100377166 3300005539 Bacteria 1324
45 Ga0070695_101647097 3300005545 Bacteria 536
46 Ga0070665_100410314 3300005548 Bacteria 1363
47 Ga0068855_100381412 3300005563 Bacteria 1548
48 Ga0070664_100382029 3300005564 Bacteria 1286
49 Ga0068857_100084004 3300005577 Bacteria 2845
50 Ga0068857_100910139 3300005577 Bacteria 844
51 Ga0068854_100506143 3300005578 Bacteria 1018
52 Ga0068856_100209610 3300005614 Bacteria 1964
53 Ga0068856_100783012 3300005614 Bacteria 974
54 Ga0070702_100429311 3300005615 Bacteria 953
55 Ga0070702_101221456 3300005615 Bacteria 607
56 Ga0068852_100031135 3300005616 Bacteria 4398
57 Ga0068864_100057273 3300005618 Bacteria 3367
58 Ga0068864_100132149 3300005618 Bacteria 2243
59 Ga0068864_100331392 3300005618 Bacteria 1432
60 Ga0068861_102125189 3300005719 Bacteria 562
61 Ga0068863_101599235 3300005841 Bacteria 661
62 Ga0068858_100723361 3300005842 Bacteria 969
63 Ga0068860_100059661 3300005843 Bacteria 3627
64 Ga0068860_101222950 3300005843 Bacteria 771
65 Ga0068862_100127410 3300005844 Bacteria 2249
66 Ga0081455_10003804 3300005937 Bacteria 17223
67 Ga0081455_10015152 3300005937 Bacteria 7504
68 Ga0081455_10030003 3300005937 Bacteria 4948
69 Ga0081455_10125442 3300005937 Bacteria 2016
70 Ga0081455_10151711 3300005937 Bacteria 1786
71 Ga0081455_10295382 3300005937 Bacteria 1165
72 Ga0081455_10588438 3300005937 Bacteria 728
73 Ga0070717_10125154 3300006028 Bacteria 2206
74 Ga0070717_10137784 3300006028 Bacteria 2103
75 Ga0070717_10274249 3300006028 Bacteria 1494
76 Ga0075364_10110136 3300006051 Bacteria 1837
77 Ga0075432_10002988 3300006058 Bacteria 5695
78 Ga0075432_10004500 3300006058 Bacteria 4750
79 Ga0075432_10049344 3300006058 Bacteria 1483
80 Ga0070716_100174516 3300006173 Bacteria 1405
81 Ga0070716_100302927 3300006173 Bacteria 1112
82 Ga0070712_100059906 3300006175 Bacteria 2683
83 Ga0070712_100248762 3300006175 Bacteria 1419
84 Ga0070712_100316413 3300006175 Bacteria 1268
85 Ga0075428_100022812 3300006844 Bacteria 6926
86 Ga0075428_100211963 3300006844 Bacteria 2093
87 Ga0075428_100575021 3300006844 Bacteria 1204
88 Ga0075431_100000685 3300006847 Bacteria 29059
89 Ga0075433_10000059 3300006852 Bacteria 47982
90 Ga0075433_10006746 3300006852 Bacteria 9097
91 Ga0075433_10017681 3300006852 Bacteria 5913
92 Ga0075434_100009049 3300006871 Bacteria 9276
93 Ga0075434_100012145 3300006871 Bacteria 8156
94 Ga0075434_101916316 3300006871 Bacteria 598
95 Ga0075429_100477649 3300006880 Bacteria 1092
96 Ga0075429_101170617 3300006880 Bacteria 671
97 Ga0068865_100007709 3300006881 Bacteria 6633
98 Ga0075436_100000582 3300006914 Bacteria 23905
99 Ga0075436_100574953 3300006914 Bacteria 829
100 Ga0075435_100012106 3300007076 Bacteria 6376
101 Ga0075435_100273300 3300007076 Bacteria 1442
102 Ga0075435_100310436 3300007076 Bacteria 1349
103 Ga0111539_10001332 3300009094 Bacteria 32893
104 Ga0111539_10390855 3300009094 Bacteria 1620
105 Ga0111539_11593424 3300009094 Bacteria 757
106 Ga0105245_10001731 3300009098 Bacteria 19890
107 Ga0105245_10027251 3300009098 Bacteria 5035
108 Ga0105245_10062558 3300009098 Bacteria 3358
109 Ga0105245_11165421 3300009098 Bacteria 818
110 Ga0114129_10007973 3300009147 Bacteria 15078
111 Ga0114129_10269071 3300009147 Bacteria 2281
112 Ga0114129_10813780 3300009147 Bacteria 1191
113 Ga0105243_10118639 3300009148 Bacteria 2226
114 Ga0105243_10521758 3300009148 Bacteria 1130
115 Ga0105243_10585134 3300009148 Bacteria 1072
116 Ga0105242_10067733 3300009176 Bacteria 2952
117 Ga0105248_10100795 3300009177 Bacteria 3254
118 Ga0105248_11945488 3300009177 Bacteria 668
119 Ga0105237_10403525 3300009545 Bacteria 1371
120 Ga0105237_10619780 3300009545 Bacteria 1089
121 Ga0105237_10818993 3300009545 Bacteria 938
122 Ga0105238_10127587 3300009551 Bacteria 2522
123 Ga0105249_10009694 3300009553 Bacteria 8440
124 Ga0105249_10032792 3300009553 Bacteria 4700
125 Ga0105239_10052667 3300010375 Bacteria 4463
126 Ga0105239_10127724 3300010375 Bacteria 2826
127 Ga0105239_10470446 3300010375 Bacteria 1427
128 Ga0105239_10690417 3300010375 Bacteria 1167
129 Ga0105246_10135675 3300011119 Bacteria 1844
130 Ga0105246_10280039 3300011119 Bacteria 1337
131 Ga0105246_11097537 3300011119 Bacteria 726
132 Ga0157342_1003453 3300012507 Bacteria 1354
133 Ga0157326_1023570 3300012513 Bacteria 775
134 Ga0157369_10001080 3300013105 Bacteria 34124
135 Ga0157369_10430983 3300013105 Bacteria 1367
136 Ga0157369_11112099 3300013105 Bacteria 807
137 Ga0157378_11131912 3300013297 Bacteria 820
138 Ga0163162_10042538 3300013306 Bacteria 4548
139 Ga0163162_10358303 3300013306 Bacteria 1592
140 Ga0157372_10010078 3300013307 Bacteria 10046
141 Ga0157372_10021641 3300013307 Bacteria 6951
142 Ga0157372_10113600 3300013307 Bacteria 3104
143 Ga0157372_10116930 3300013307 Bacteria 3058
144 Ga0157372_10754547 3300013307 Bacteria 1131
145 Ga0157375_10378962 3300013308 Bacteria 1581
146 Ga0163163_10223784 3300014325 Bacteria 1930
147 Ga0182008_10077099 3300014497 Bacteria 1640
148 Ga0157377_10000997 3300014745 Bacteria 11935
149 Ga0163161_10476829 3300017792 Bacteria 1012
150 Ga0213875_10070312 3300021388 Bacteria 1634
151 Ga0207692_10005517 3300025898 Bacteria 5075
152 Ga0207642_10089482 3300025899 Bacteria 1517
153 Ga0207642_10247198 3300025899 Bacteria 1010
154 Ga0207688_10011351 3300025901 Bacteria 4850
155 Ga0207688_10047582 3300025901 Bacteria 2394
156 Ga0207688_10435680 3300025901 Bacteria 816
157 Ga0207647_10002870 3300025904 Bacteria 12979
158 Ga0207647_10291476 3300025904 Bacteria 930
159 Ga0207647_10562895 3300025904 Bacteria 631
160 Ga0207699_10037371 3300025906 Bacteria 2775
161 Ga0207699_10544238 3300025906 Bacteria 841
162 Ga0207671_10169035 3300025914 Bacteria 1697
163 Ga0207693_10055427 3300025915 Bacteria 3110
164 Ga0207693_10510336 3300025915 Bacteria 938
165 Ga0207663_10052867 3300025916 Bacteria 2535
166 Ga0207663_10224890 3300025916 Bacteria 1367
167 Ga0207663_10380566 3300025916 Bacteria 1075
168 Ga0207649_10071818 3300025920 Bacteria 2212
169 Ga0207681_10577976 3300025923 Bacteria 927
170 Ga0207659_10185430 3300025926 Bacteria 1652
171 Ga0207687_10012822 3300025927 Bacteria 5478
172 Ga0207700_10393689 3300025928 Bacteria 1213
173 Ga0207664_10010522 3300025929 Bacteria 6533
174 Ga0207664_10101581 3300025929 Bacteria 2377
175 Ga0207664_10287042 3300025929 Bacteria 1445
176 Ga0207664_10635979 3300025929 Bacteria 959
177 Ga0207664_10694049 3300025929 Bacteria 915
178 Ga0207690_10042459 3300025932 Bacteria 2987
179 Ga0207690_10638318 3300025932 Bacteria 872
180 Ga0207706_10005339 3300025933 Bacteria 11976
181 Ga0207706_10252085 3300025933 Bacteria 1542
182 Ga0207686_10138452 3300025934 Bacteria 1679
183 Ga0207709_10279277 3300025935 Bacteria 1233
184 Ga0207709_10343088 3300025935 Bacteria 1125
185 Ga0207704_10052979 3300025938 Bacteria 2463
186 Ga0207704_10461963 3300025938 Bacteria 1015
187 Ga0207704_10568898 3300025938 Bacteria 923
188 Ga0207665_10012389 3300025939 Bacteria 5602
189 Ga0207665_10014810 3300025939 Bacteria 5127
190 Ga0207689_10027782 3300025942 Bacteria 4734
191 Ga0207689_10192602 3300025942 Bacteria 1682
192 Ga0207689_10259095 3300025942 Bacteria 1439
193 Ga0207667_10506326 3300025949 Bacteria 1224
194 Ga0207712_10216779 3300025961 Bacteria 1528
195 Ga0207712_10308859 3300025961 Bacteria 1301
196 Ga0207712_10375015 3300025961 Bacteria 1189
197 Ga0207668_10040324 3300025972 Bacteria 3150
198 Ga0207668_10434453 3300025972 Bacteria 1117
199 Ga0207668_10441370 3300025972 Bacteria 1109
200 Ga0207640_10169726 3300025981 Bacteria 1624
201 Ga0207658_10535970 3300025986 Bacteria 1046
202 Ga0207639_10674283 3300026041 Bacteria 958
203 Ga0207678_10348391 3300026067 Bacteria 1277
204 Ga0207678_10568078 3300026067 Bacteria 993
205 Ga0207708_10000282 3300026075 Bacteria 39901
206 Ga0207702_10204926 3300026078 Bacteria 1831
207 Ga0207702_10700349 3300026078 Bacteria 998
208 Ga0207702_11056401 3300026078 Bacteria 806
209 Ga0207648_10081998 3300026089 Bacteria 2812
210 Ga0207676_10020864 3300026095 Bacteria 4800
211 Ga0207674_10087877 3300026116 Bacteria 3101
212 Ga0207674_10382201 3300026116 Bacteria 1361
213 Ga0207675_100082218 3300026118 Bacteria 3020
214 Ga0207675_100086947 3300026118 Bacteria 2935
215 Ga0207675_100481822 3300026118 Bacteria 1233
216 Ga0207683_10037050 3300026121 Bacteria 4247
217 Ga0207683_11830469 3300026121 Bacteria 556
218 Ga0207698_10240858 3300026142 Bacteria 1648
219 Ga0207698_11478317 3300026142 Bacteria 695
220 Ga0207428_10000422 3300027907 Bacteria 52603
221 Ga0207428_10001212 3300027907 Bacteria 27686
222 Ga0207428_10808368 3300027907 Bacteria 666
223 Ga0268266_10406628 3300028379 Bacteria 1288
224 Ga0268266_10443496 3300028379 Bacteria 1233
225 Ga0268264_11148532 3300028381 Bacteria 786
226 Ga0307511_10082610 3300030521 Bacteria 2245
227 Ga0307512_10071743 3300030522 Bacteria 2568
228 Ga0307408_100001524 3300031548 Bacteria 17196
229 Ga0307408_100100723 3300031548 Bacteria 2201
230 Ga0307408_101688655 3300031548 Bacteria 603
231 Ga0307508_10057452 3300031616 Bacteria 3443
232 Ga0307514_10094260 3300031649 Bacteria 2171
233 Ga0307514_10469490 3300031649 Bacteria 611
234 Ga0307516_10173073 3300031730 Bacteria 1898
235 Ga0307405_10003712 3300031731 Bacteria 7087
236 Ga0307405_10255630 3300031731 Bacteria 1306
237 Ga0307405_10576598 3300031731 Bacteria 914
238 Ga0307413_10003049 3300031824 Bacteria 6960
239 Ga0307413_10023054 3300031824 Bacteria 3368
240 Ga0307413_10038240 3300031824 Bacteria 2779
241 Ga0307413_10168620 3300031824 Bacteria 1547
242 Ga0307413_10821146 3300031824 Bacteria 783
243 Ga0307410_10000505 3300031852 Bacteria 15836
244 Ga0307410_10009201 3300031852 Bacteria 5526
245 Ga0307410_10014115 3300031852 Bacteria 4686
246 Ga0307410_10097369 3300031852 Bacteria 2102
247 Ga0307410_10099531 3300031852 Bacteria 2081
248 Ga0307410_10384083 3300031852 Bacteria 1130
249 Ga0307406_10000033 3300031901 Bacteria 83943
250 Ga0307406_10053168 3300031901 Bacteria 2579
251 Ga0307406_10054385 3300031901 Bacteria 2554
252 Ga0307406_10240407 3300031901 Bacteria 1358
253 Ga0307407_10000412 3300031903 Bacteria 13021
254 Ga0307407_10016656 3300031903 Bacteria 3664
255 Ga0307407_10101586 3300031903 Bacteria 1786
256 Ga0307407_10159031 3300031903 Bacteria 1476
257 Ga0307412_10130909 3300031911 Bacteria 1822
258 Ga0307412_10804014 3300031911 Bacteria 816
259 Ga0307409_100000067 3300031995 Bacteria 38312
260 Ga0307409_100011021 3300031995 Bacteria 5668
261 Ga0307409_100011758 3300031995 Bacteria 5539
262 Ga0307409_100040100 3300031995 Bacteria 3482
263 Ga0307409_100232405 3300031995 Bacteria 1672
264 Ga0307409_100651767 3300031995 Bacteria 1047
265 Ga0307416_100000089 3300032002 Bacteria 62440
266 Ga0307416_100027224 3300032002 Bacteria 4229
267 Ga0307416_100032013 3300032002 Bacteria 3967
268 Ga0307416_100053155 3300032002 Bacteria 3248
269 Ga0307416_100116509 3300032002 Bacteria 2369
270 Ga0307416_100249538 3300032002 Bacteria 1726
271 Ga0307416_100392711 3300032002 Bacteria 1422
272 Ga0307416_101187583 3300032002 Bacteria 868
273 Ga0307414_10012594 3300032004 Bacteria 5008
274 Ga0307414_10015344 3300032004 Bacteria 4624
275 Ga0307414_10078297 3300032004 Bacteria 2409
276 Ga0307411_10006411 3300032005 Bacteria 5887
277 Ga0307411_10125764 3300032005 Bacteria 1864
278 Ga0307411_10456253 3300032005 Bacteria 1070
279 Ga0307415_100001029 3300032126 Bacteria 12892
280 Ga0307415_100032138 3300032126 Bacteria 3390
281 Ga0307415_100077589 3300032126 Bacteria 2359
282 Ga0307415_100120755 3300032126 Bacteria 1964
283 Ga0307510_10266285 3300033180 Bacteria 1192
284 Ga0373926_0000284 3300035083 Bacteria 12376
285 Ga0373934_0048419 3300035086 Bacteria 1683
286 Ga0373944_0000641 3300035089 Bacteria 8315
287 Ga0373923_0206049 3300035111 Bacteria 910
288 Ga0373932_0081526 3300035112 Bacteria 1023
289 Ga0373936_0000752 3300035113 Bacteria 11362
290 Ga0373943_0010854 3300035170 Bacteria 4089
291 Ga0373943_0498764 3300035170 Bacteria 711
292 Ga0373946_0000493 3300035171 Bacteria 13076
293 Ga0373955_0144935 3300035172 Bacteria 1395
294 Ga0373961_0260538 3300035241 Bacteria 630
295 Ga0373962_0076358 3300035242 Bacteria 1010
296 Ga0373962_0212921 3300035242 Bacteria 658
297 Ga0373924_0019020 3300035410 Bacteria 2656
298 Ga0373931_0001059 3300035691 Bacteria 11637
299 Ga0373935_0012589 3300035692 Bacteria 5089
300 Ga0373927_0002191 3300035695 Bacteria 14353
301 Ga0373927_0172998 3300035695 Bacteria 1416
302 Ga0373927_0199221 3300035695 Bacteria 1314
303 Ga0373933_0412081 3300035724 Bacteria 882
304 Ga0373947_0003073 3300035725 Bacteria 9938
305 Ga0373937_0221957 3300036401 Bacteria 1779
306 Ga0373937_1491860 3300036401 Bacteria 624
307 Ga0373925_0006075 3300037068 Bacteria 8935
308 Ga0373925_0466994 3300037068 Bacteria 1034
309 Ga0436364_0101046 3300037853 Bacteria 867
310 Ga0436364_0326549 3300037853 Bacteria 5794
311 Ga0436364_1479337 3300037853 Bacteria 860
312 Ga0395901_0567148 3300038443 Bacteria 1149
313 Ga0439448_0040684 3300042005 Bacteria 1502
314 Ga0439448_0051496 3300042005 Bacteria 1348
315 Ga0439448_0052003 3300042005 Bacteria 1342
316 Ga0439456_083333 3300042013 Bacteria 715
317 Ga0439463_001923 3300042016 Bacteria 5391
318 Ga0439463_027115 3300042016 Bacteria 1441
319 Ga0439463_033498 3300042016 Bacteria 1300
320 Ga0450888_001279 3300042126 Bacteria 2401
321 Ga0439435_0043444 3300042436 Bacteria 1264
322 Ga0439444_0001423 3300042437 Bacteria 3103
323 Ga0439464_0006976 3300042439 Bacteria 2949
324 Ga0439464_0136041 3300042439 Bacteria 763
325 Ga0439460_0229267 3300042461 Bacteria 638
326 Ga0439440_0000338 3300042993 Bacteria 7727
327 Ga0439440_0041362 3300042993 Bacteria 1124
328 Ga0466969_0049521 3300044656 Bacteria 2073
329 Ga0466972_0075579 3300044658 Bacteria 1605
330 Ga0466965_0006660 3300044683 Bacteria 5263
331 Ga0466966_0027985 3300044684 Bacteria 3673
332 Ga0466966_0095836 3300044684 Bacteria 1838
333 Ga0466961_0011122 3300044693 Bacteria 5752
334 Ga0466961_0042216 3300044693 Bacteria 2923
335 Ga0466961_0566329 3300044693 Bacteria 684
336 Ga0466963_0065833 3300044694 Bacteria 2430
337 Ga0466963_0150126 3300044694 Bacteria 1618
338 Ga0466963_0371811 3300044694 Bacteria 1007
339 Ga0466963_0653928 3300044694 Bacteria 742
340 Ga0466971_0164584 3300044719 Bacteria 1039
341 Ga0466968_0605181 3300044735 Bacteria 554
342 Ga0466970_0062086 3300044765 Bacteria 2003
343 Ga0466970_0076035 3300044765 Bacteria 1809
344 Ga0466970_0525888 3300044765 Bacteria 682
345 Ga0466957_0124931 3300044842 Bacteria 1643
346 Ga0466957_0168583 3300044842 Bacteria 1425
347 Ga0466960_0000321 3300044901 Bacteria 16472
348 Ga0466959_0082115 3300045049 Bacteria 2322
349 Ga0466959_0108302 3300045049 Bacteria 1985
350 Ga0466959_0417950 3300045049 Bacteria 910
351 Ga0466959_0520983 3300045049 Bacteria 803
352 Ga0466958_0065581 3300045836 Bacteria 2216
353 Ga0466958_0205844 3300045836 Bacteria 1253
354 Ga0466958_0516650 3300045836 Bacteria 775
355 Ga0466958_1025534 3300045836 Bacteria 538
356 Ga0466967_0001590 3300045976 Bacteria 13362
357 Ga0466967_0012899 3300045976 Bacteria 6425
358 Ga0466967_0035449 3300045976 Bacteria 4248
359 Ga0466967_0049660 3300045976 Bacteria 3670
360 Ga0466967_0254875 3300045976 Bacteria 1677
361 Ga0466967_0380236 3300045976 Bacteria 1371
362 Ga0466967_0517808 3300045976 Bacteria 1172
363 Ga0466967_0996554 3300045976 Bacteria 834
364 Ga0466967_1404979 3300045976 Bacteria 695
365 Ga0495627_050683 3300046453 Bacteria 1250
366 Ga0495592_0030603 3300046454 Bacteria 4071
367 Ga0495592_0162092 3300046454 Bacteria 1538
368 Ga0495603_0066572 3300046455 Bacteria 2122
369 Ga0495629_0130051 3300046459 Bacteria 1754
370 Ga0495629_0365100 3300046459 Bacteria 984
371 Ga0495651_0001211 3300046462 Bacteria 19916
372 Ga0495651_0154053 3300046462 Bacteria 1653
373 Ga0495653_0007941 3300046463 Bacteria 8687
374 Ga0495639_0082929 3300046475 Bacteria 1495
375 Ga0495662_0024322 3300046476 Bacteria 2923
376 Ga0495662_0087185 3300046476 Bacteria 1520
377 Ga0495664_0021696 3300046477 Bacteria 3710
378 Ga0495664_0117355 3300046477 Bacteria 1609
379 Ga0495664_0136326 3300046477 Bacteria 1487
380 Ga0495664_0350042 3300046477 Bacteria 890
381 Ga0495585_0037395 3300046492 Bacteria 2734
382 Ga0495608_0038257 3300046511 Bacteria 3223
383 Ga0495616_0184872 3300046513 Bacteria 924
384 Ga0495618_0012766 3300046514 Bacteria 5107
385 Ga0495618_0050554 3300046514 Bacteria 2626
386 Ga0495620_0187952 3300046515 Bacteria 797
387 Ga0495620_0311105 3300046515 Bacteria 598
388 Ga0495628_0030919 3300046516 Bacteria 4332
389 Ga0495628_0405935 3300046516 Bacteria 995
390 Ga0495630_0016493 3300046517 Bacteria 5399
391 Ga0495630_0695628 3300046517 Bacteria 778
392 Ga0495663_0039261 3300046525 Bacteria 1434
393 Ga0495652_0000807 3300046529 Bacteria 36157
394 Ga0495652_0001190 3300046529 Bacteria 29290
395 Ga0495652_0049932 3300046529 Bacteria 3579
396 Ga0495640_0088611 3300046533 Bacteria 2045
397 Ga0495640_0162796 3300046533 Bacteria 1428
398 Ga0495587_0724552 3300046536 Bacteria 545
399 Ga0495609_0255550 3300046538 Bacteria 721
400 Ga0495645_0063270 3300046543 Bacteria 2679
401 Ga0495645_0183703 3300046543 Bacteria 1430
402 Ga0495667_0086923 3300046559 Bacteria 2027
403 Ga0495667_0517183 3300046559 Bacteria 747
404 Ga0495656_0102966 3300046615 Bacteria 1323
405 Ga0495656_0149236 3300046615 Bacteria 1128
406 Ga0495656_0163777 3300046615 Bacteria 1083
407 Ga0495634_0018564 3300046642 Bacteria 4949
408 Ga0495634_0127247 3300046642 Bacteria 1627
409 Ga0495634_0136951 3300046642 Bacteria 1557
410 Ga0495635_0000547 3300046663 Bacteria 23894
411 Ga0495635_0110511 3300046663 Bacteria 1877
412 Ga0495635_0198708 3300046663 Bacteria 1360
413 Ga0495659_0222436 3300046664 Bacteria 780
414 Ga0495657_0003479 3300046675 Bacteria 12841
415 Ga0495657_0028317 3300046675 Bacteria 3943
416 Ga0495657_0098657 3300046675 Bacteria 1864
417 Ga0495599_0350683 3300046678 Bacteria 885
418 Ga0495623_0004381 3300046679 Bacteria 9278
419 Ga0495646_0085581 3300046680 Bacteria 1829
420 Ga0495624_0009752 3300046690 Bacteria 6644
421 Ga0495624_0279103 3300046690 Bacteria 1009
422 Ga0495670_0341970 3300046691 Bacteria 805
423 Ga0495671_0235153 3300046692 Bacteria 886
424 Ga0495589_0219833 3300046794 Bacteria 893
425 Ga0495600_0060986 3300046809 Bacteria 2463
426 Ga0495600_0305695 3300046809 Bacteria 1002
427 Ga0495581_0007720 3300047315 Bacteria 6224
428 Ga0495581_0239862 3300047315 Bacteria 1060
429 Ga0495604_0018180 3300047317 Bacteria 5628
430 Ga0495604_0830478 3300047317 Bacteria 581
431 Ga0495636_0436323 3300047318 Bacteria 628
432 Ga0495674_0001379 3300047319 Bacteria 23700
433 Ga0495676_0001921 3300047321 Bacteria 18222
434 Ga0495676_0136083 3300047321 Bacteria 1767
435 Ga0495680_0062659 3300047322 Bacteria 2859
436 Ga0495680_0064409 3300047322 Bacteria 2811
437 Ga0495684_0005427 3300047471 Bacteria 9920
438 Ga0495593_0028889 3300047673 Bacteria 3044
439 Ga0495602_1002944 3300048088 Bacteria 551
440 Ga0496100_0118852 3300048903 Bacteria 1847
441 Ga0496102_0102675 3300048905 Bacteria 2658
442 Ga0496102_0993864 3300048905 Bacteria 760
443 Ga0496103_0153371 3300048906 Bacteria 1476
444 Ga0496105_0066081 3300048908 Bacteria 2985
445 Ga0496107_0037760 3300048910 Bacteria 3467
446 Ga0496108_0153853 3300048911 Bacteria 1985
447 Ga0496108_0228775 3300048911 Bacteria 1617
448 Ga0496109_0024442 3300048912 Bacteria 5371
449 Ga0496109_0557995 3300048912 Bacteria 1080
450 Ga0496110_0142158 3300048913 Bacteria 2169
451 Ga0496111_0076462 3300048914 Bacteria 2440
452 Ga0496112_0025737 3300048915 Bacteria 5651
453 Ga0496113_0043312 3300048916 Bacteria 3330
454 Ga0496115_0072804 3300048918 Bacteria 2788
455 Ga0496115_0378976 3300048918 Bacteria 1151
456 Ga0501067_0521373 3300049583 Bacteria 665
457 Ga0501075_0250915 3300049591 Bacteria 1349
458 Ga0501206_027034 3300049653 Bacteria 840
459 Ga0501080_0949386 3300049742 Bacteria 748
460 Ga0501271_008196 3300049768 Bacteria 1067
461 Ga0501212_012837 3300049851 Bacteria 1224
462 nmdc:mga00v17_137242_c1 3300050491 Bacteria 1566
463 nmdc:mga05p37_10540_c1 3300050507 Bacteria 10961
464 nmdc:mga05p37_446840_c1 3300050507 Bacteria 1497
465 nmdc:mga09592_105309_c1 3300050508 Bacteria 2418
466 nmdc:mga0qj67_552715_c1 3300050509 Bacteria 923
467 nmdc:mga0qj67_597945_c1 3300050509 Bacteria 882
468 nmdc:mga06r32_11724_c1 3300050510 Bacteria 7890
469 nmdc:mga06r32_681814_c1 3300050510 Bacteria 994
470 nmdc:mga08y16_220525_c1 3300050511 Bacteria 1964
471 nmdc:mga08y16_231308_c1 3300050511 Bacteria 1912
472 nmdc:mga08y16_3453_c1 3300050511 Bacteria 16395
473 nmdc:mga0n895_13619_c1 3300050512 Bacteria 7349
474 nmdc:mga0n895_2271_c1 3300050512 Bacteria 14905
475 nmdc:mga0n895_87525_c1 3300050512 Bacteria 3113
476 nmdc:mga0rr50_219640_c1 3300050513 Bacteria 1569
477 nmdc:mga0rr50_22750_c1 3300050513 Bacteria 4308
478 nmdc:mga0rr50_77069_c1 3300050513 Bacteria 2561
479 nmdc:mga08x19_3863_c1 3300050514 Bacteria 8916
480 nmdc:mga0a205_1402470_c1 3300050515 Bacteria 546
481 nmdc:mga0a205_157065_c1 3300050515 Bacteria 2173
482 nmdc:mga0a205_18213_c1 3300050515 Bacteria 6598
483 nmdc:mga0a205_8962_c1 3300050515 Bacteria 9119
484 Ga0495601_0000616 3300053077 Bacteria 18929
485 Ga0495612_0007385 3300053078 Bacteria 4490
486 Ga0495612_0057730 3300053078 Bacteria 1603
487 Ga0495612_0212831 3300053078 Bacteria 854
488 Ga0495595_0353616 3300053084 Bacteria 742
489 Ga0466962_0314360 3300061719 Bacteria 776
490 2819690114 2818991462 Bacteria 4320267
491 2866553801 2866552031 Bacteria 5824618
492 2899370221 2899370129 Bacteria 6781179
493 2956940523 2956939328 Bacteria 3474458
494 3001121169 3001119090 Bacteria 3449530
495 Ga0068856_100367454
496 JGI24740J21852_10008617
497 JGI24739J22299_10007037
498 JGI24737J22298_10006911
499 JGI24737J22298_10029037
500 JGI24735J21928_10025332
501 Ga0070683_100311581
502 Ga0070683_100417366
503 Ga0068869_100054045
504 Ga0068869_100218488
505 Ga0070682_100444794
506 Ga0068868_100485239
507 Ga0070691_10065015
508 Ga0070661_100189379
509 Ga0070668_100020069
510 Ga0070668_100438641
511 Ga0070668_100881724
512 Ga0070668_101121111
513 Ga0070675_100190691
514 Ga0070671_100145468
515 Ga0070671_102022211
516 Ga0070674_102122442
517 Ga0070673_100822017
518 Ga0070688_100214650
519 Ga0070667_100185916
520 Ga0070714_100116943
521 Ga0070714_100289129
522 Ga0070714_100490288
523 Ga0070714_100668218
524 Ga0070713_100431021
525 Ga0070713_100482157
526 Ga0070713_100706776
527 Ga0070710_10099383
528 Ga0070710_10106444
529 Ga0070710_10268457
530 Ga0070711_100251855
531 Ga0070700_100053579
532 Ga0070694_101191418
533 Ga0070663_100757368
534 Ga0070662_100206897
535 Ga0070685_10053005
536 Ga0070679_100966827
537 Ga0070684_100289755
538 Ga0068853_100377166
539 Ga0070695_101647097
540 Ga0070665_100410314
541 Ga0068855_100381412
542 Ga0070664_100382029
543 Ga0068857_100084004
544 Ga0068857_100910139
545 Ga0068854_100506143
546 Ga0068856_100209610
547 Ga0068856_100783012
548 Ga0070702_100429311
549 Ga0070702_101221456
550 Ga0068852_100031135
551 Ga0068864_100057273
552 Ga0068864_100132149
553 Ga0068864_100331392
554 Ga0068861_102125189
555 Ga0068863_101599235
556 Ga0068858_100723361
557 Ga0068860_100059661
558 Ga0068860_101222950
559 Ga0068862_100127410
560 Ga0081455_10003804
561 Ga0081455_10015152
562 Ga0081455_10030003
563 Ga0081455_10125442
564 Ga0081455_10151711
565 Ga0081455_10295382
566 Ga0081455_10588438
567 Ga0070717_10125154
568 Ga0070717_10137784
569 Ga0070717_10274249
570 Ga0075364_10110136
571 Ga0075432_10002988
572 Ga0075432_10004500
573 Ga0075432_10049344
574 Ga0070716_100174516
575 Ga0070716_100302927
576 Ga0070712_100059906
577 Ga0070712_100248762
578 Ga0070712_100316413
579 Ga0075428_100022812
580 Ga0075428_100211963
581 Ga0075428_100575021
582 Ga0075431_100000685
583 Ga0075433_10000059
584 Ga0075433_10006746
585 Ga0075433_10017681
586 Ga0075434_100009049
587 Ga0075434_100012145
588 Ga0075434_101916316
589 Ga0075429_100477649
590 Ga0075429_101170617
591 Ga0068865_100007709
592 Ga0075436_100000582
593 Ga0075436_100574953
594 Ga0075435_100012106
595 Ga0075435_100273300
596 Ga0075435_100310436
597 Ga0111539_10001332
598 Ga0111539_10390855
599 Ga0111539_11593424
600 Ga0105245_10001731
601 Ga0105245_10027251
602 Ga0105245_10062558
603 Ga0105245_11165421
604 Ga0114129_10007973
605 Ga0114129_10269071
606 Ga0114129_10813780
607 Ga0105243_10118639
608 Ga0105243_10521758
609 Ga0105243_10585134
610 Ga0105242_10067733
611 Ga0105248_10100795
612 Ga0105248_11945488
613 Ga0105237_10403525
614 Ga0105237_10619780
615 Ga0105237_10818993
616 Ga0105238_10127587
617 Ga0105249_10009694
618 Ga0105249_10032792
619 Ga0105239_10052667
620 Ga0105239_10127724
621 Ga0105239_10470446
622 Ga0105239_10690417
623 Ga0105246_10135675
624 Ga0105246_10280039
625 Ga0105246_11097537
626 Ga0157342_1003453
627 Ga0157326_1023570
628 Ga0157369_10001080
629 Ga0157369_10430983
630 Ga0157369_11112099
631 Ga0157378_11131912
632 Ga0163162_10042538
633 Ga0163162_10358303
634 Ga0157372_10010078
635 Ga0157372_10021641
636 Ga0157372_10113600
637 Ga0157372_10116930
638 Ga0157372_10754547
639 Ga0157375_10378962
640 Ga0163163_10223784
641 Ga0182008_10077099
642 Ga0157377_10000997
643 Ga0163161_10476829
644 Ga0213875_10070312
645 Ga0207692_10005517
646 Ga0207642_10089482
647 Ga0207642_10247198
648 Ga0207688_10011351
649 Ga0207688_10047582
650 Ga0207688_10435680
651 Ga0207647_10002870
652 Ga0207647_10291476
653 Ga0207647_10562895
654 Ga0207699_10037371
655 Ga0207699_10544238
656 Ga0207671_10169035
657 Ga0207693_10055427
658 Ga0207693_10510336
659 Ga0207663_10052867
660 Ga0207663_10224890
661 Ga0207663_10380566
662 Ga0207649_10071818
663 Ga0207681_10577976
664 Ga0207659_10185430
665 Ga0207687_10012822
666 Ga0207700_10393689
667 Ga0207664_10010522
668 Ga0207664_10101581
669 Ga0207664_10287042
670 Ga0207664_10635979
671 Ga0207664_10694049
672 Ga0207690_10042459
673 Ga0207690_10638318
674 Ga0207706_10005339
675 Ga0207706_10252085
676 Ga0207686_10138452
677 Ga0207709_10279277
678 Ga0207709_10343088
679 Ga0207704_10052979
680 Ga0207704_10461963
681 Ga0207704_10568898
682 Ga0207665_10012389
683 Ga0207665_10014810
684 Ga0207689_10027782
685 Ga0207689_10192602
686 Ga0207689_10259095
687 Ga0207667_10506326
688 Ga0207712_10216779
689 Ga0207712_10308859
690 Ga0207712_10375015
691 Ga0207668_10040324
692 Ga0207668_10434453
693 Ga0207668_10441370
694 Ga0207640_10169726
695 Ga0207658_10535970
696 Ga0207639_10674283
697 Ga0207678_10348391
698 Ga0207678_10568078
699 Ga0207708_10000282
700 Ga0207702_10204926
701 Ga0207702_10700349
702 Ga0207702_11056401
703 Ga0207648_10081998
704 Ga0207676_10020864
705 Ga0207674_10087877
706 Ga0207674_10382201
707 Ga0207675_100082218
708 Ga0207675_100086947
709 Ga0207675_100481822
710 Ga0207683_10037050
711 Ga0207683_11830469
712 Ga0207698_10240858
713 Ga0207698_11478317
714 Ga0207428_10000422
715 Ga0207428_10001212
716 Ga0207428_10808368
717 Ga0268266_10406628
718 Ga0268266_10443496
719 Ga0268264_11148532
720 Ga0307511_10082610
721 Ga0307512_10071743
722 Ga0307408_100001524
723 Ga0307408_100100723
724 Ga0307408_101688655
725 Ga0307508_10057452
726 Ga0307514_10094260
727 Ga0307514_10469490
728 Ga0307516_10173073
729 Ga0307405_10003712
730 Ga0307405_10255630
731 Ga0307405_10576598
732 Ga0307413_10003049
733 Ga0307413_10023054
734 Ga0307413_10038240
735 Ga0307413_10168620
736 Ga0307413_10821146
737 Ga0307410_10000505
738 Ga0307410_10009201
739 Ga0307410_10014115
740 Ga0307410_10097369
741 Ga0307410_10099531
742 Ga0307410_10384083
743 Ga0307406_10000033
744 Ga0307406_10053168
745 Ga0307406_10054385
746 Ga0307406_10240407
747 Ga0307407_10000412
748 Ga0307407_10016656
749 Ga0307407_10101586
750 Ga0307407_10159031
751 Ga0307412_10130909
752 Ga0307412_10804014
753 Ga0307409_100000067
754 Ga0307409_100011021
755 Ga0307409_100011758
756 Ga0307409_100040100
757 Ga0307409_100232405
758 Ga0307409_100651767
759 Ga0307416_100000089
760 Ga0307416_100027224
761 Ga0307416_100032013
762 Ga0307416_100053155
763 Ga0307416_100116509
764 Ga0307416_100249538
765 Ga0307416_100392711
766 Ga0307416_101187583
767 Ga0307414_10012594
768 Ga0307414_10015344
769 Ga0307414_10078297
770 Ga0307411_10006411
771 Ga0307411_10125764
772 Ga0307411_10456253
773 Ga0307415_100001029
774 Ga0307415_100032138
775 Ga0307415_100077589
776 Ga0307415_100120755
777 Ga0307510_10266285
778 Ga0373926_0000284
779 Ga0373934_0048419
780 Ga0373944_0000641
781 Ga0373923_0206049
782 Ga0373932_0081526
783 Ga0373936_0000752
784 Ga0373943_0010854
785 Ga0373943_0498764
786 Ga0373946_0000493
787 Ga0373955_0144935
788 Ga0373961_0260538
789 Ga0373962_0076358
790 Ga0373962_0212921
791 Ga0373924_0019020
792 Ga0373931_0001059
793 Ga0373935_0012589
794 Ga0373927_0002191
795 Ga0373927_0172998
796 Ga0373927_0199221
797 Ga0373933_0412081
798 Ga0373947_0003073
799 Ga0373937_0221957
800 Ga0373937_1491860
801 Ga0373925_0006075
802 Ga0373925_0466994
803 Ga0436364_0101046
804 Ga0436364_0326549
805 Ga0436364_1479337
806 Ga0395901_0567148
807 Ga0439448_0040684
808 Ga0439448_0051496
809 Ga0439448_0052003
810 Ga0439456_083333
811 Ga0439463_001923
812 Ga0439463_027115
813 Ga0439463_033498
814 Ga0450888_001279
815 Ga0439435_0043444
816 Ga0439444_0001423
817 Ga0439464_0006976
818 Ga0439464_0136041
819 Ga0439460_0229267
820 Ga0439440_0000338
821 Ga0439440_0041362
822 Ga0466969_0049521
823 Ga0466972_0075579
824 Ga0466965_0006660
825 Ga0466966_0027985
826 Ga0466966_0095836
827 Ga0466961_0011122
828 Ga0466961_0042216
829 Ga0466961_0566329
830 Ga0466963_0065833
831 Ga0466963_0150126
832 Ga0466963_0371811
833 Ga0466963_0653928
834 Ga0466971_0164584
835 Ga0466968_0605181
836 Ga0466970_0062086
837 Ga0466970_0076035
838 Ga0466970_0525888
839 Ga0466957_0124931
840 Ga0466957_0168583
841 Ga0466960_0000321
842 Ga0466959_0082115
843 Ga0466959_0108302
844 Ga0466959_0417950
845 Ga0466959_0520983
846 Ga0466958_0065581
847 Ga0466958_0205844
848 Ga0466958_0516650
849 Ga0466958_1025534
850 Ga0466967_0001590
851 Ga0466967_0012899
852 Ga0466967_0035449
853 Ga0466967_0049660
854 Ga0466967_0254875
855 Ga0466967_0380236
856 Ga0466967_0517808
857 Ga0466967_0996554
858 Ga0466967_1404979
859 Ga0495627_050683
860 Ga0495592_0030603
861 Ga0495592_0162092
862 Ga0495603_0066572
863 Ga0495629_0130051
864 Ga0495629_0365100
865 Ga0495651_0001211
866 Ga0495651_0154053
867 Ga0495653_0007941
868 Ga0495639_0082929
869 Ga0495662_0024322
870 Ga0495662_0087185
871 Ga0495664_0021696
872 Ga0495664_0117355
873 Ga0495664_0136326
874 Ga0495664_0350042
875 Ga0495585_0037395
876 Ga0495608_0038257
877 Ga0495616_0184872
878 Ga0495618_0012766
879 Ga0495618_0050554
880 Ga0495620_0187952
881 Ga0495620_0311105
882 Ga0495628_0030919
883 Ga0495628_0405935
884 Ga0495630_0016493
885 Ga0495630_0695628
886 Ga0495663_0039261
887 Ga0495652_0000807
888 Ga0495652_0001190
889 Ga0495652_0049932
890 Ga0495640_0088611
891 Ga0495640_0162796
892 Ga0495587_0724552
893 Ga0495609_0255550
894 Ga0495645_0063270
895 Ga0495645_0183703
896 Ga0495667_0086923
897 Ga0495667_0517183
898 Ga0495656_0102966
899 Ga0495656_0149236
900 Ga0495656_0163777
901 Ga0495634_0018564
902 Ga0495634_0127247
903 Ga0495634_0136951
904 Ga0495635_0000547
905 Ga0495635_0110511
906 Ga0495635_0198708
907 Ga0495659_0222436
908 Ga0495657_0003479
909 Ga0495657_0028317
910 Ga0495657_0098657
911 Ga0495599_0350683
912 Ga0495623_0004381
913 Ga0495646_0085581
914 Ga0495624_0009752
915 Ga0495624_0279103
916 Ga0495670_0341970
917 Ga0495671_0235153
918 Ga0495589_0219833
919 Ga0495600_0060986
920 Ga0495600_0305695
921 Ga0495581_0007720
922 Ga0495581_0239862
923 Ga0495604_0018180
924 Ga0495604_0830478
925 Ga0495636_0436323
926 Ga0495674_0001379
927 Ga0495676_0001921
928 Ga0495676_0136083
929 Ga0495680_0062659
930 Ga0495680_0064409
931 Ga0495684_0005427
932 Ga0495593_0028889
933 Ga0495602_1002944
934 Ga0496100_0118852
935 Ga0496102_0102675
936 Ga0496102_0993864
937 Ga0496103_0153371
938 Ga0496105_0066081
939 Ga0496107_0037760
940 Ga0496108_0153853
941 Ga0496108_0228775
942 Ga0496109_0024442
943 Ga0496109_0557995
944 Ga0496110_0142158
945 Ga0496111_0076462
946 Ga0496112_0025737
947 Ga0496113_0043312
948 Ga0496115_0072804
949 Ga0496115_0378976
950 Ga0501067_0521373
951 Ga0501075_0250915
952 Ga0501206_027034
953 Ga0501080_0949386
954 Ga0501271_008196
955 Ga0501212_012837
956 nmdc:mga00v17_137242_c1
957 nmdc:mga05p37_10540_c1
958 nmdc:mga05p37_446840_c1
959 nmdc:mga09592_105309_c1
960 nmdc:mga0qj67_552715_c1
961 nmdc:mga0qj67_597945_c1
962 nmdc:mga06r32_11724_c1
963 nmdc:mga06r32_681814_c1
964 nmdc:mga08y16_220525_c1
965 nmdc:mga08y16_231308_c1
966 nmdc:mga08y16_3453_c1
967 nmdc:mga0n895_13619_c1
968 nmdc:mga0n895_2271_c1
969 nmdc:mga0n895_87525_c1
970 nmdc:mga0rr50_219640_c1
971 nmdc:mga0rr50_22750_c1
972 nmdc:mga0rr50_77069_c1
973 nmdc:mga08x19_3863_c1
974 nmdc:mga0a205_1402470_c1
975 nmdc:mga0a205_157065_c1
976 nmdc:mga0a205_18213_c1
977 nmdc:mga0a205_8962_c1
978 Ga0495601_0000616
979 Ga0495612_0007385
980 Ga0495612_0057730
981 Ga0495612_0212831
982 Ga0495595_0353616
983 Ga0466962_0314360
984 2819690114
985 2866553801
986 2899370221
987 2956940523
988 3001121169

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

6

73

0.89

PF01799

Fer2_2

[2Fe-2S] binding domain

75

152

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hk0-assembly1.cif.gz_B crystal structure of the ra and ph domains of grb10 0.6541 2 31
2wlb-assembly2.cif.gz_B adrenodoxin-like ferredoxin etp1fd(516-618) of schizosaccharomyces pombe mitochondria 0.6531 4 74
8e9i-assembly1.cif.gz_G mycobacterial respiratory complex i, semi-inserted quinone 0.6383 1 75
7v2d-assembly1.cif.gz_M deactive state complex i from q10 dataset 0.632 3 76
6zkf-assembly1.cif.gz_3 complex i during turnover, open3 0.6298 1 76
ID Description Score Start End Superfamily
1sb3F01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8956 2 77 3.10.20.30
af_Q46801_1_79_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8915 2 76 3.10.20.30
1n5wA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8913 1 77 3.10.20.30
5y6qA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8819 2 77 3.10.20.30
3hrdH01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8772 3 77 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A1Q7AH13-F1-model_v4 2Fe-2S ferredoxin-type domain-containing protein 0.9168 1 80 GO:0051537
AF-A0A800BKA9-F1-model_v4 2Fe-2S iron-sulfur cluster binding domain-containing protein 0.9064 1 79 GO:0051537
AF-A0A7V1SLR5-F1-model_v4 2Fe-2S iron-sulfur cluster binding domain-containing protein 0.9054 2 77 GO:0051537
AF-A0A535YVI1-F1-model_v4 2Fe-2S iron-sulfur cluster binding domain-containing protein 0.8993 2 79 GO:0051537
AF-A0A3B9UYU1-F1-model_v4 (2Fe-2S)-binding protein 0.8984 4 77 GO:0051537

Map