F454528

General Info

Members Datasets Scaffolds Average Seq Length
494 244 988 84

Family's Representative Sequence

Representative Sequence 3300005355|Ga0070671_101343657|Ga0070671_1013436571
Length 91
Sequence MPAHIGVFMLMIRLARFGAKKKPFYRVVVIEKERARNGRNLEVVGTYNPLTTPPAVLLKHDRVEQWIKNGAQLSDTVKRLVEKNPPVQPVA

Samples

Sample ID Description Type Environment
1 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
98 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
102 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
106 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
153 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
154 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
155 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
156 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
157 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
158 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
159 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
160 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
161 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
162 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
163 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
164 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
165 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
166 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
167 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
168 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
169 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
170 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
171 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
172 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
173 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
174 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
175 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
176 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
177 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
178 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
179 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
180 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
181 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
183 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
184 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
185 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
186 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
187 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
188 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
189 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
190 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
191 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
192 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
193 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
194 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
195 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
196 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
197 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
198 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
199 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
200 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
201 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
202 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
203 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
204 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
205 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
206 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
207 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
208 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
209 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
210 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
211 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
212 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
213 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
214 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
215 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
216 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
217 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
218 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
219 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
220 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
221 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
222 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
223 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
224 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
225 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
226 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
227 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
228 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
229 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
230 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
231 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
232 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
233 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
234 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
235 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
239 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
240 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
241 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
242 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
243 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
244 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.14
Metatranscriptomes 4.86
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.81
Rhizosphere 96.96
Stem 0
Stem Tuber 0
Unclassified 34.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070671_101343657 3300005355 Unclassified 631
2 Ga0058863_11703200 3300004799 Unclassified 939
3 Ga0058863_11957095 3300004799 Unclassified 656
4 Ga0058863_11971687 3300004799 Unclassified 1116
5 Ga0058861_11619464 3300004800 Unclassified 607
6 Ga0058861_11942856 3300004800 Bacteria 1432
7 Ga0058862_12622143 3300004803 Unclassified 590
8 Ga0058862_12636191 3300004803 Bacteria 1189
9 Ga0070658_10013769 3300005327 Bacteria 6491
10 Ga0070658_10323732 3300005327 Bacteria 1317
11 Ga0070658_10828217 3300005327 Bacteria 804
12 Ga0070683_100000003 3300005329 Bacteria 375084
13 Ga0070683_100811876 3300005329 Unclassified 897
14 Ga0070683_101593353 3300005329 Unclassified 628
15 Ga0070690_100424404 3300005330 Bacteria 981
16 Ga0070670_100554075 3300005331 Unclassified 1026
17 Ga0070670_100739723 3300005331 Bacteria 886
18 Ga0070670_100746521 3300005331 Bacteria 882
19 Ga0068869_101135261 3300005334 Bacteria 685
20 Ga0070666_10291570 3300005335 Bacteria 1161
21 Ga0070666_10812055 3300005335 Unclassified 689
22 Ga0070680_100006149 3300005336 Bacteria 9106
23 Ga0070680_100253204 3300005336 Bacteria 1489
24 Ga0070680_100267508 3300005336 Bacteria 1447
25 Ga0070682_100095790 3300005337 Bacteria 1950
26 Ga0068868_100559693 3300005338 Bacteria 1009
27 Ga0068868_100770106 3300005338 Unclassified 866
28 Ga0068868_101760455 3300005338 Unclassified 585
29 Ga0070660_100278035 3300005339 Bacteria 1369
30 Ga0070660_100303998 3300005339 Bacteria 1308
31 Ga0070689_100912677 3300005340 Unclassified 778
32 Ga0070675_100730090 3300005354 Bacteria 903
33 Ga0070671_100513622 3300005355 Bacteria 1031
34 Ga0070671_101102885 3300005355 Bacteria 697
35 Ga0070673_102270130 3300005364 Unclassified 516
36 Ga0070659_101722929 3300005366 Unclassified 561
37 Ga0070667_100200243 3300005367 Bacteria 1772
38 Ga0070667_100776575 3300005367 Unclassified 889
39 Ga0070667_100852576 3300005367 Unclassified 847
40 Ga0070667_102049808 3300005367 Unclassified 539
41 Ga0070709_10547533 3300005434 Bacteria 885
42 Ga0070714_100725430 3300005435 Archaea 960
43 Ga0070713_100424848 3300005436 Bacteria 1245
44 Ga0070713_100695007 3300005436 Bacteria 971
45 Ga0070713_101373968 3300005436 Bacteria 685
46 Ga0070713_101809116 3300005436 Unclassified 593
47 Ga0070701_10830250 3300005438 Bacteria 633
48 Ga0070711_100703687 3300005439 Bacteria 851
49 Ga0070705_100934098 3300005440 Unclassified 700
50 Ga0070694_100552959 3300005444 Bacteria 922
51 Ga0070708_100300710 3300005445 Unclassified 1511
52 Ga0070663_102087931 3300005455 Archaea 511
53 Ga0070678_102121252 3300005456 Unclassified 533
54 Ga0070681_10011060 3300005458 Bacteria 8924
55 Ga0070681_10706764 3300005458 Unclassified 924
56 Ga0068867_102111124 3300005459 Unclassified 534
57 Ga0070685_10159081 3300005466 Bacteria 1438
58 Ga0070685_10715249 3300005466 Unclassified 731
59 Ga0070706_100037853 3300005467 Bacteria 4454
60 Ga0070706_100045962 3300005467 Bacteria 4031
61 Ga0070699_100614942 3300005518 Bacteria 991
62 Ga0070679_100019244 3300005530 Bacteria 6635
63 Ga0070679_100598137 3300005530 Unclassified 1046
64 Ga0070679_100773569 3300005530 Unclassified 903
65 Ga0070679_101086522 3300005530 Bacteria 745
66 Ga0070679_101828703 3300005530 Unclassified 556
67 Ga0070684_100000391 3300005535 Bacteria 30358
68 Ga0070684_100058211 3300005535 Bacteria 3376
69 Ga0070684_100302813 3300005535 Bacteria 1467
70 Ga0070684_100529986 3300005535 Unclassified 1092
71 Ga0070684_101332255 3300005535 Unclassified 676
72 Ga0070697_100236845 3300005536 Bacteria 1558
73 Ga0070697_100312005 3300005536 Bacteria 1353
74 Ga0070697_100492617 3300005536 Unclassified 1071
75 Ga0068853_100861982 3300005539 Unclassified 869
76 Ga0068853_101198835 3300005539 Bacteria 733
77 Ga0070686_100257431 3300005544 Bacteria 1278
78 Ga0070695_100307770 3300005545 Bacteria 1173
79 Ga0070695_100324191 3300005545 Unclassified 1146
80 Ga0070696_101665728 3300005546 Unclassified 549
81 Ga0070693_101332939 3300005547 Bacteria 556
82 Ga0070665_100131583 3300005548 Bacteria 2504
83 Ga0070665_100146071 3300005548 Bacteria 2368
84 Ga0070704_101174704 3300005549 Bacteria 699
85 Ga0068855_100040321 3300005563 Bacteria 5543
86 Ga0068855_100106551 3300005563 Bacteria 3221
87 Ga0068855_100265482 3300005563 Bacteria 1911
88 Ga0070664_100771468 3300005564 Bacteria 898
89 Ga0068857_100640277 3300005577 Bacteria 1007
90 Ga0068854_100318738 3300005578 Unclassified 1263
91 Ga0068856_100382255 3300005614 Unclassified 1427
92 Ga0068856_101015405 3300005614 Bacteria 848
93 Ga0068856_101418744 3300005614 Unclassified 709
94 Ga0070702_100582256 3300005615 Bacteria 836
95 Ga0068852_100104026 3300005616 Bacteria 2569
96 Ga0068852_100497799 3300005616 Bacteria 1213
97 Ga0068859_100144318 3300005617 Bacteria 2455
98 Ga0068859_100244023 3300005617 Bacteria 1886
99 Ga0068859_100558001 3300005617 Bacteria 1240
100 Ga0068864_100281038 3300005618 Bacteria 1553
101 Ga0068864_100305830 3300005618 Bacteria 1490
102 Ga0068861_101257518 3300005719 Unclassified 718
103 Ga0068863_100284901 3300005841 Bacteria 1601
104 Ga0068863_100729884 3300005841 Bacteria 986
105 Ga0068863_100915605 3300005841 Bacteria 877
106 Ga0068858_100137729 3300005842 Bacteria 2291
107 Ga0068858_100220800 3300005842 Bacteria 1795
108 Ga0068858_100927649 3300005842 Bacteria 852
109 Ga0068860_100934182 3300005843 Unclassified 884
110 Ga0068862_102256789 3300005844 Bacteria 556
111 Ga0070717_10016754 3300006028 Bacteria 5688
112 Ga0070717_10053296 3300006028 Bacteria 3334
113 Ga0070717_10173683 3300006028 Bacteria 1875
114 Ga0070715_10337379 3300006163 Bacteria 819
115 Ga0070715_10447884 3300006163 Unclassified 728
116 Ga0070716_100118164 3300006173 Bacteria 1655
117 Ga0070716_100841120 3300006173 Bacteria 714
118 Ga0070712_100794034 3300006175 Bacteria 812
119 Ga0070712_101982412 3300006175 Unclassified 510
120 Ga0097621_100219951 3300006237 Bacteria 1654
121 Ga0097621_100265127 3300006237 Bacteria 1508
122 Ga0097621_100840432 3300006237 Unclassified 852
123 Ga0097621_102182270 3300006237 Unclassified 530
124 Ga0068871_100421027 3300006358 Bacteria 1192
125 Ga0075431_101410803 3300006847 Unclassified 656
126 Ga0075433_10749550 3300006852 Unclassified 854
127 Ga0068865_100304276 3300006881 Bacteria 1277
128 Ga0068865_100959350 3300006881 Unclassified 747
129 Ga0075436_100060053 3300006914 Bacteria 2626
130 Ga0097620_100144323 3300006931 Bacteria 2455
131 Ga0097620_100244017 3300006931 Bacteria 1886
132 Ga0097620_100557963 3300006931 Bacteria 1240
133 Ga0105240_10012485 3300009093 Bacteria 11722
134 Ga0105240_10310643 3300009093 Bacteria 1800
135 Ga0105240_12235284 3300009093 Unclassified 567
136 Ga0111539_11039695 3300009094 Bacteria 952
137 Ga0105245_10496161 3300009098 Unclassified 1236
138 Ga0105245_11739409 3300009098 Unclassified 676
139 Ga0105245_11940523 3300009098 Unclassified 642
140 Ga0105245_12785159 3300009098 Unclassified 542
141 Ga0105247_10521132 3300009101 Bacteria 869
142 Ga0105247_10831505 3300009101 Bacteria 707
143 Ga0105243_11082432 3300009148 Bacteria 809
144 Ga0105243_11301861 3300009148 Bacteria 744
145 Ga0105241_10342457 3300009174 Bacteria 1296
146 Ga0105241_10877254 3300009174 Bacteria 832
147 Ga0105241_11413463 3300009174 Bacteria 667
148 Ga0105241_11914745 3300009174 Bacteria 581
149 Ga0105242_10087726 3300009176 Bacteria 2612
150 Ga0105242_10223944 3300009176 Bacteria 1682
151 Ga0105242_10243681 3300009176 Bacteria 1617
152 Ga0105242_11104363 3300009176 Unclassified 807
153 Ga0105242_11398424 3300009176 Unclassified 727
154 Ga0105242_11767461 3300009176 Unclassified 656
155 Ga0105248_10109406 3300009177 Bacteria 3116
156 Ga0105248_10149129 3300009177 Bacteria 2639
157 Ga0105248_10176745 3300009177 Bacteria 2405
158 Ga0105248_10466601 3300009177 Bacteria 1423
159 Ga0105248_10799213 3300009177 Bacteria 1065
160 Ga0105248_11000665 3300009177 Bacteria 944
161 Ga0105248_11072994 3300009177 Unclassified 910
162 Ga0105237_10006340 3300009545 Bacteria 13149
163 Ga0105237_10046332 3300009545 Bacteria 4373
164 Ga0105237_10243017 3300009545 Bacteria 1801
165 Ga0105237_10559937 3300009545 Bacteria 1150
166 Ga0105237_11687599 3300009545 Bacteria 641
167 Ga0105238_10327950 3300009551 Bacteria 1517
168 Ga0105238_11956681 3300009551 Bacteria 619
169 Ga0105249_10967200 3300009553 Unclassified 919
170 Ga0105249_11866930 3300009553 Bacteria 673
171 Ga0099796_10232068 3300010159 Bacteria 760
172 Ga0105239_10157762 3300010375 Bacteria 2535
173 Ga0105239_10284686 3300010375 Bacteria 1861
174 Ga0105239_10512981 3300010375 Unclassified 1364
175 Ga0105239_11254717 3300010375 Bacteria 854
176 Ga0105239_11343261 3300010375 Unclassified 825
177 Ga0105239_11943479 3300010375 Unclassified 683
178 Ga0105239_12222501 3300010375 Unclassified 638
179 Ga0105246_10305645 3300011119 Bacteria 1286
180 Ga0105246_12064277 3300011119 Unclassified 551
181 Ga0157373_10225579 3300013100 Bacteria 1322
182 Ga0157370_10002091 3300013104 Bacteria 24415
183 Ga0157370_11744043 3300013104 Bacteria 559
184 Ga0157369_10002983 3300013105 Bacteria 20254
185 Ga0157369_10019208 3300013105 Bacteria 7647
186 Ga0157369_10089054 3300013105 Bacteria 3295
187 Ga0157369_10240214 3300013105 Bacteria 1892
188 Ga0157369_10449179 3300013105 Bacteria 1335
189 Ga0157369_11396641 3300013105 Unclassified 713
190 Ga0157374_10125391 3300013296 Bacteria 2482
191 Ga0157374_10542211 3300013296 Unclassified 1170
192 Ga0157374_10646048 3300013296 Unclassified 1070
193 Ga0157374_11108998 3300013296 Unclassified 812
194 Ga0157378_10202303 3300013297 Bacteria 1879
195 Ga0157378_10936154 3300013297 Bacteria 898
196 Ga0157378_11045763 3300013297 Unclassified 852
197 Ga0157378_11304609 3300013297 Unclassified 767
198 Ga0157378_12839135 3300013297 Unclassified 537
199 Ga0163162_10877865 3300013306 Bacteria 1011
200 Ga0163162_11125206 3300013306 Bacteria 890
201 Ga0163162_11560988 3300013306 Bacteria 753
202 Ga0157372_10959978 3300013307 Bacteria 991
203 Ga0157372_11189252 3300013307 Bacteria 881
204 Ga0157372_11680444 3300013307 Unclassified 731
205 Ga0157375_10082398 3300013308 Bacteria 3259
206 Ga0157375_10821755 3300013308 Bacteria 1077
207 Ga0157375_10854432 3300013308 Unclassified 1056
208 Ga0157375_11215141 3300013308 Bacteria 884
209 Ga0157375_12191212 3300013308 Bacteria 658
210 Ga0157375_12580324 3300013308 Unclassified 607
211 Ga0163163_10041947 3300014325 Bacteria 4478
212 Ga0163163_10365363 3300014325 Unclassified 1500
213 Ga0163163_10819994 3300014325 Bacteria 994
214 Ga0163163_12887692 3300014325 Unclassified 536
215 Ga0157380_11000122 3300014326 Bacteria 869
216 Ga0157377_10211636 3300014745 Unclassified 1237
217 Ga0157377_10770931 3300014745 Unclassified 706
218 Ga0157379_10645966 3300014968 Bacteria 990
219 Ga0157379_11771237 3300014968 Bacteria 606
220 Ga0157376_10192756 3300014969 Bacteria 1870
221 Ga0157376_10234321 3300014969 Bacteria 1707
222 Ga0157376_10911753 3300014969 Bacteria 897
223 Ga0157376_11110640 3300014969 Bacteria 817
224 Ga0157376_11234344 3300014969 Unclassified 776
225 Ga0157376_11372504 3300014969 Unclassified 738
226 Ga0157376_11838375 3300014969 Bacteria 642
227 Ga0182006_1100936 3300015261 Unclassified 1024
228 Ga0197907_10106037 3300020069 Unclassified 1628
229 Ga0197907_11295087 3300020069 Unclassified 770
230 Ga0197907_11460140 3300020069 Archaea 1000
231 Ga0206356_10015770 3300020070 Unclassified 767
232 Ga0206356_11786172 3300020070 Archaea 850
233 Ga0206349_1474445 3300020075 Archaea 657
234 Ga0206355_1549451 3300020076 Unclassified 1055
235 Ga0206355_1662720 3300020076 Bacteria 1189
236 Ga0206352_10060014 3300020078 Bacteria 3404
237 Ga0206352_10875135 3300020078 Archaea 810
238 Ga0206354_10309871 3300020081 Unclassified 550
239 Ga0206354_10661755 3300020081 Unclassified 517
240 Ga0206353_10098022 3300020082 Unclassified 620
241 Ga0206353_10953412 3300020082 Archaea 840
242 Ga0213875_10075531 3300021388 Unclassified 1572
243 Ga0224712_10330080 3300022467 Unclassified 718
244 Ga0207680_10328974 3300025903 Unclassified 1070
245 Ga0207685_10608900 3300025905 Bacteria 587
246 Ga0207699_10053421 3300025906 Bacteria 2395
247 Ga0207699_10102743 3300025906 Bacteria 1817
248 Ga0207643_11113288 3300025908 Unclassified 509
249 Ga0207705_10005069 3300025909 Bacteria 9874
250 Ga0207705_10303418 3300025909 Bacteria 1225
251 Ga0207705_10390504 3300025909 Bacteria 1076
252 Ga0207705_10452883 3300025909 Bacteria 995
253 Ga0207705_11143604 3300025909 Bacteria 599
254 Ga0207684_10124112 3300025910 Bacteria 2215
255 Ga0207684_10363283 3300025910 Bacteria 1246
256 Ga0207707_10060274 3300025912 Bacteria 3302
257 Ga0207707_10140858 3300025912 Bacteria 2109
258 Ga0207707_10144754 3300025912 Bacteria 2077
259 Ga0207707_10176950 3300025912 Bacteria 1864
260 Ga0207695_10052509 3300025913 Bacteria 4270
261 Ga0207695_10097994 3300025913 Bacteria 2932
262 Ga0207671_10030708 3300025914 Bacteria 4005
263 Ga0207671_10035281 3300025914 Bacteria 3713
264 Ga0207671_11387400 3300025914 Unclassified 545
265 Ga0207693_10662562 3300025915 Unclassified 810
266 Ga0207663_10219677 3300025916 Bacteria 1382
267 Ga0207663_10901238 3300025916 Unclassified 707
268 Ga0207663_11184493 3300025916 Unclassified 615
269 Ga0207660_10044460 3300025917 Bacteria 3125
270 Ga0207660_10045977 3300025917 Bacteria 3078
271 Ga0207660_10062650 3300025917 Bacteria 2680
272 Ga0207660_10887092 3300025917 Bacteria 728
273 Ga0207662_10237248 3300025918 Bacteria 1193
274 Ga0207657_10130492 3300025919 Bacteria 2060
275 Ga0207652_10041142 3300025921 Bacteria 3927
276 Ga0207652_10482476 3300025921 Bacteria 1116
277 Ga0207652_10701747 3300025921 Unclassified 903
278 Ga0207652_10797875 3300025921 Unclassified 838
279 Ga0207650_10258173 3300025925 Bacteria 1413
280 Ga0207650_11163038 3300025925 Unclassified 657
281 Ga0207650_11546428 3300025925 Unclassified 563
282 Ga0207659_10189436 3300025926 Bacteria 1636
283 Ga0207700_10101758 3300025928 Bacteria 2293
284 Ga0207700_10374126 3300025928 Bacteria 1244
285 Ga0207700_10799468 3300025928 Bacteria 844
286 Ga0207700_10810654 3300025928 Bacteria 837
287 Ga0207700_11731768 3300025928 Bacteria 551
288 Ga0207664_10508618 3300025929 Archaea 1079
289 Ga0207664_11570369 3300025929 Unclassified 580
290 Ga0207644_11560125 3300025931 Unclassified 554
291 Ga0207690_10954797 3300025932 Bacteria 712
292 Ga0207686_10050094 3300025934 Bacteria 2596
293 Ga0207686_10834914 3300025934 Bacteria 740
294 Ga0207709_11308836 3300025935 Bacteria 599
295 Ga0207704_10389956 3300025938 Unclassified 1096
296 Ga0207704_10414286 3300025938 Bacteria 1067
297 Ga0207665_10987640 3300025939 Bacteria 669
298 Ga0207665_11229750 3300025939 Unclassified 597
299 Ga0207691_10932489 3300025940 Bacteria 726
300 Ga0207691_11756184 3300025940 Unclassified 501
301 Ga0207711_10096376 3300025941 Bacteria 2611
302 Ga0207711_10293169 3300025941 Bacteria 1500
303 Ga0207711_10575651 3300025941 Bacteria 1050
304 Ga0207689_10405002 3300025942 Bacteria 1137
305 Ga0207661_10000014 3300025944 Bacteria 322246
306 Ga0207661_10230259 3300025944 Unclassified 1641
307 Ga0207661_11379772 3300025944 Unclassified 647
308 Ga0207661_12123457 3300025944 Unclassified 508
309 Ga0207679_10538384 3300025945 Bacteria 1046
310 Ga0207667_10069844 3300025949 Bacteria 3656
311 Ga0207667_10263960 3300025949 Bacteria 1761
312 Ga0207667_10590704 3300025949 Bacteria 1120
313 Ga0207640_10413310 3300025981 Unclassified 1102
314 Ga0207658_11113964 3300025986 Bacteria 721
315 Ga0207658_11527538 3300025986 Unclassified 611
316 Ga0207677_10418626 3300026023 Bacteria 1140
317 Ga0207677_11257826 3300026023 Bacteria 679
318 Ga0207677_11363225 3300026023 Bacteria 652
319 Ga0207703_10084960 3300026035 Bacteria 2647
320 Ga0207703_10346237 3300026035 Bacteria 1367
321 Ga0207703_10854500 3300026035 Bacteria 870
322 Ga0207639_10281834 3300026041 Bacteria 1462
323 Ga0207639_11632570 3300026041 Bacteria 604
324 Ga0207702_10535659 3300026078 Unclassified 1144
325 Ga0207702_11196550 3300026078 Unclassified 754
326 Ga0207702_11500959 3300026078 Bacteria 667
327 Ga0207641_10054166 3300026088 Bacteria 3403
328 Ga0207641_10065785 3300026088 Bacteria 3102
329 Ga0207641_11401894 3300026088 Bacteria 700
330 Ga0207648_10683160 3300026089 Unclassified 950
331 Ga0207648_11018080 3300026089 Bacteria 776
332 Ga0207674_10300877 3300026116 Unclassified 1553
333 Ga0207674_10924374 3300026116 Bacteria 841
334 Ga0207674_11214012 3300026116 Bacteria 724
335 Ga0207674_11596095 3300026116 Unclassified 621
336 Ga0207675_100735665 3300026118 Bacteria 997
337 Ga0207683_10247151 3300026121 Bacteria 1628
338 Ga0207683_11164077 3300026121 Unclassified 715
339 Ga0207698_10010816 3300026142 Bacteria 5888
340 Ga0207698_11977805 3300026142 Unclassified 597
341 Ga0207698_12187839 3300026142 Unclassified 566
342 Ga0268266_10362139 3300028379 Bacteria 1365
343 Ga0268266_11070258 3300028379 Bacteria 780
344 Ga0268264_10168169 3300028381 Bacteria 1981
345 Ga0265323_10002765 3300028653 Bacteria 7907
346 Ga0265338_10952018 3300028800 Unclassified 583
347 Ga0265762_1027149 3300030760 Bacteria 1073
348 Ga0265330_10240889 3300031235 Bacteria 763
349 Ga0265332_10046593 3300031238 Bacteria 1867
350 Ga0265325_10095514 3300031241 Unclassified 1461
351 Ga0265325_10153711 3300031241 Bacteria 1087
352 Ga0265329_10200852 3300031242 Bacteria 656
353 Ga0265340_10093376 3300031247 Unclassified 1404
354 Ga0265339_10032198 3300031249 Bacteria 2958
355 Ga0265331_10295965 3300031250 Bacteria 725
356 Ga0265331_10579138 3300031250 Unclassified 507
357 Ga0265316_10026269 3300031344 Bacteria 4847
358 Ga0265316_10072259 3300031344 Bacteria 2658
359 Ga0265316_10277823 3300031344 Bacteria 1224
360 Ga0265314_10045781 3300031711 Bacteria 3090
361 Ga0265342_10120976 3300031712 Unclassified 1474
362 Ga0265342_10213651 3300031712 Bacteria 1042
363 Ga0316212_1022931 3300033547 Bacteria 874
364 Ga0373934_0189625 3300035086 Unclassified 846
365 Ga0373923_0598947 3300035111 Unclassified 543
366 Ga0373953_0223609 3300035117 Unclassified 816
367 Ga0373954_0154622 3300035118 Bacteria 1121
368 Ga0373954_0400630 3300035118 Unclassified 679
369 Ga0373954_0471896 3300035118 Unclassified 621
370 Ga0373943_0458733 3300035170 Unclassified 741
371 Ga0373946_0174369 3300035171 Bacteria 1017
372 Ga0373946_0275976 3300035171 Unclassified 826
373 Ga0373955_0706605 3300035172 Bacteria 619
374 Ga0373924_0369692 3300035410 Bacteria 640
375 Ga0373931_0967768 3300035691 Bacteria 575
376 Ga0373935_1011300 3300035692 Unclassified 618
377 Ga0373927_0049922 3300035695 Bacteria 2705
378 Ga0373933_0126702 3300035724 Bacteria 1603
379 Ga0373947_0517039 3300035725 Unclassified 812
380 Ga0373947_0675902 3300035725 Unclassified 704
381 Ga0373937_0070176 3300036401 Bacteria 3232
382 Ga0373937_0657103 3300036401 Bacteria 994
383 Ga0373937_0925203 3300036401 Unclassified 821
384 Ga0316582_0031434 3300036647 Bacteria 3245
385 Ga0373925_0017454 3300037068 Bacteria 5203
386 Ga0373925_0370813 3300037068 Unclassified 1165
387 Ga0373925_0482400 3300037068 Bacteria 1017
388 Ga0373925_1050816 3300037068 Unclassified 670
389 Ga0395899_0432437 3300037312 Archaea 865
390 Ga0436364_0446179 3300037853 Unclassified 878
391 Ga0436364_0627175 3300037853 Bacteria 2283
392 Ga0436364_1294552 3300037853 Bacteria 2039
393 Ga0436364_1372401 3300037853 Unclassified 4325
394 Ga0395901_0661130 3300038443 Archaea 1047
395 Ga0436365_0257520 3300039437 Unclassified 610
396 Ga0436365_0409903 3300039437 Bacteria 730
397 Ga0436365_0873358 3300039437 Bacteria 923
398 Ga0436361_0370097 3300039447 Unclassified 545
399 Ga0436363_0870271 3300039450 Bacteria 641
400 Ga0451839_0598184 3300041496 Bacteria 605
401 Ga0453683_0617229 3300044673 Unclassified 708
402 Ga0466966_0253156 3300044684 Bacteria 1061
403 Ga0466963_0359869 3300044694 Bacteria 1025
404 Ga0453684_2563302 3300044712 Unclassified 502
405 Ga0466971_0317903 3300044719 Bacteria 750
406 Ga0451576_0072459 3300045051 Bacteria 3585
407 Ga0451576_0117053 3300045051 Bacteria 2774
408 Ga0451576_0686063 3300045051 Unclassified 1076
409 Ga0451576_0755116 3300045051 Bacteria 1022
410 Ga0466967_0326009 3300045976 Bacteria 1482
411 Ga0495592_0159434 3300046454 Unclassified 1554
412 Ga0495592_0859842 3300046454 Unclassified 535
413 Ga0495603_0907435 3300046455 Bacteria 500
414 Ga0495651_0235441 3300046462 Bacteria 1259
415 Ga0495651_0387343 3300046462 Bacteria 915
416 Ga0495651_0449538 3300046462 Bacteria 833
417 Ga0495580_0001984 3300046472 Bacteria 17998
418 Ga0495580_0005012 3300046472 Bacteria 11040
419 Ga0495580_0616771 3300046472 Unclassified 716
420 Ga0495580_0653346 3300046472 Unclassified 691
421 Ga0495582_0081693 3300046473 Bacteria 1795
422 Ga0495664_0072060 3300046477 Bacteria 2064
423 Ga0495664_0829909 3300046477 Unclassified 543
424 Ga0495608_0413385 3300046511 Unclassified 824
425 Ga0495618_0188474 3300046514 Bacteria 1309
426 Ga0495628_0373082 3300046516 Bacteria 1046
427 Ga0495628_0671575 3300046516 Bacteria 734
428 Ga0495630_0520913 3300046517 Bacteria 912
429 Ga0495663_0158833 3300046525 Bacteria 775
430 Ga0495666_0065712 3300046526 Unclassified 1730
431 Ga0495642_0123494 3300046528 Bacteria 1112
432 Ga0495652_0232143 3300046529 Bacteria 1379
433 Ga0495652_0605168 3300046529 Unclassified 747
434 Ga0495640_0440586 3300046533 Unclassified 797
435 Ga0495586_0332320 3300046535 Bacteria 872
436 Ga0495587_0264705 3300046536 Bacteria 965
437 Ga0495587_0494428 3300046536 Unclassified 676
438 Ga0495587_0518826 3300046536 Bacteria 658
439 Ga0495645_0082177 3300046543 Bacteria 2311
440 Ga0495645_0423141 3300046543 Unclassified 845
441 Ga0495645_0541157 3300046543 Bacteria 723
442 Ga0495645_0699553 3300046543 Bacteria 615
443 Ga0495667_0104642 3300046559 Bacteria 1830
444 Ga0495667_0395524 3300046559 Unclassified 871
445 Ga0495667_0800884 3300046559 Bacteria 581
446 Ga0495635_0308586 3300046663 Unclassified 1060
447 Ga0495635_0860191 3300046663 Unclassified 582
448 Ga0495599_0114550 3300046678 Bacteria 1678
449 Ga0495623_0073645 3300046679 Bacteria 2123
450 Ga0495623_0236674 3300046679 Unclassified 1033
451 Ga0495658_0344145 3300046683 Bacteria 947
452 Ga0495669_0354152 3300046684 Unclassified 710
453 Ga0495613_0350663 3300046689 Bacteria 1014
454 Ga0495613_0855230 3300046689 Bacteria 591
455 Ga0495589_0568686 3300046794 Unclassified 517
456 Ga0495604_0121416 3300047317 Bacteria 1891
457 Ga0495604_0213793 3300047317 Bacteria 1331
458 Ga0495604_0285963 3300047317 Unclassified 1112
459 Ga0495636_0526416 3300047318 Bacteria 573
460 Ga0495674_0036930 3300047319 Bacteria 4392
461 Ga0495674_0107824 3300047319 Bacteria 2364
462 Ga0495674_0156177 3300047319 Bacteria 1911
463 Ga0495674_0210458 3300047319 Bacteria 1611
464 Ga0495674_0453098 3300047319 Bacteria 1031
465 Ga0495674_0678981 3300047319 Unclassified 810
466 Ga0495674_1072392 3300047319 Bacteria 614
467 Ga0495676_0804509 3300047321 Bacteria 605
468 Ga0495680_0376130 3300047322 Unclassified 985
469 Ga0495680_0521820 3300047322 Unclassified 804
470 Ga0495675_0085689 3300047444 Bacteria 1981
471 Ga0495675_0144284 3300047444 Bacteria 1474
472 Ga0495675_0305530 3300047444 Bacteria 944
473 Ga0495675_0473154 3300047444 Bacteria 722
474 Ga0495681_0271522 3300047470 Unclassified 664
475 Ga0495684_0023685 3300047471 Bacteria 4721
476 Ga0495684_0030021 3300047471 Bacteria 4174
477 Ga0495684_0667250 3300047471 Unclassified 693
478 Ga0495602_0031265 3300048088 Bacteria 5036
479 Ga0495602_0295734 3300048088 Bacteria 1187
480 Ga0495602_0956928 3300048088 Unclassified 567
481 Ga0496109_1333058 3300048912 Unclassified 654
482 Ga0496112_1408806 3300048915 Bacteria 612
483 Ga0496114_1552590 3300048917 Unclassified 550
484 Ga0496115_0434425 3300048918 Unclassified 1062
485 Ga0501305_021569 3300049161 Bacteria 953
486 Ga0501032_0927662 3300049569 Unclassified 548
487 Ga0501047_0568809 3300049581 Unclassified 957
488 Ga0501075_0616455 3300049591 Unclassified 828
489 Ga0501044_0474583 3300049823 Bacteria 1155
490 nmdc:mga08y16_1384284_c1 3300050511 Unclassified 667
491 nmdc:mga0n895_1095157_c1 3300050512 Bacteria 774
492 Ga0495612_0443406 3300053078 Unclassified 593
493 Ga0495619_0449175 3300053085 Bacteria 889
494 Ga0501082_0003238 3300060353 Bacteria 14202
495 Ga0070671_101343657
496 Ga0058863_11703200
497 Ga0058863_11957095
498 Ga0058863_11971687
499 Ga0058861_11619464
500 Ga0058861_11942856
501 Ga0058862_12622143
502 Ga0058862_12636191
503 Ga0070658_10013769
504 Ga0070658_10323732
505 Ga0070658_10828217
506 Ga0070683_100000003
507 Ga0070683_100811876
508 Ga0070683_101593353
509 Ga0070690_100424404
510 Ga0070670_100554075
511 Ga0070670_100739723
512 Ga0070670_100746521
513 Ga0068869_101135261
514 Ga0070666_10291570
515 Ga0070666_10812055
516 Ga0070680_100006149
517 Ga0070680_100253204
518 Ga0070680_100267508
519 Ga0070682_100095790
520 Ga0068868_100559693
521 Ga0068868_100770106
522 Ga0068868_101760455
523 Ga0070660_100278035
524 Ga0070660_100303998
525 Ga0070689_100912677
526 Ga0070675_100730090
527 Ga0070671_100513622
528 Ga0070671_101102885
529 Ga0070673_102270130
530 Ga0070659_101722929
531 Ga0070667_100200243
532 Ga0070667_100776575
533 Ga0070667_100852576
534 Ga0070667_102049808
535 Ga0070709_10547533
536 Ga0070714_100725430
537 Ga0070713_100424848
538 Ga0070713_100695007
539 Ga0070713_101373968
540 Ga0070713_101809116
541 Ga0070701_10830250
542 Ga0070711_100703687
543 Ga0070705_100934098
544 Ga0070694_100552959
545 Ga0070708_100300710
546 Ga0070663_102087931
547 Ga0070678_102121252
548 Ga0070681_10011060
549 Ga0070681_10706764
550 Ga0068867_102111124
551 Ga0070685_10159081
552 Ga0070685_10715249
553 Ga0070706_100037853
554 Ga0070706_100045962
555 Ga0070699_100614942
556 Ga0070679_100019244
557 Ga0070679_100598137
558 Ga0070679_100773569
559 Ga0070679_101086522
560 Ga0070679_101828703
561 Ga0070684_100000391
562 Ga0070684_100058211
563 Ga0070684_100302813
564 Ga0070684_100529986
565 Ga0070684_101332255
566 Ga0070697_100236845
567 Ga0070697_100312005
568 Ga0070697_100492617
569 Ga0068853_100861982
570 Ga0068853_101198835
571 Ga0070686_100257431
572 Ga0070695_100307770
573 Ga0070695_100324191
574 Ga0070696_101665728
575 Ga0070693_101332939
576 Ga0070665_100131583
577 Ga0070665_100146071
578 Ga0070704_101174704
579 Ga0068855_100040321
580 Ga0068855_100106551
581 Ga0068855_100265482
582 Ga0070664_100771468
583 Ga0068857_100640277
584 Ga0068854_100318738
585 Ga0068856_100382255
586 Ga0068856_101015405
587 Ga0068856_101418744
588 Ga0070702_100582256
589 Ga0068852_100104026
590 Ga0068852_100497799
591 Ga0068859_100144318
592 Ga0068859_100244023
593 Ga0068859_100558001
594 Ga0068864_100281038
595 Ga0068864_100305830
596 Ga0068861_101257518
597 Ga0068863_100284901
598 Ga0068863_100729884
599 Ga0068863_100915605
600 Ga0068858_100137729
601 Ga0068858_100220800
602 Ga0068858_100927649
603 Ga0068860_100934182
604 Ga0068862_102256789
605 Ga0070717_10016754
606 Ga0070717_10053296
607 Ga0070717_10173683
608 Ga0070715_10337379
609 Ga0070715_10447884
610 Ga0070716_100118164
611 Ga0070716_100841120
612 Ga0070712_100794034
613 Ga0070712_101982412
614 Ga0097621_100219951
615 Ga0097621_100265127
616 Ga0097621_100840432
617 Ga0097621_102182270
618 Ga0068871_100421027
619 Ga0075431_101410803
620 Ga0075433_10749550
621 Ga0068865_100304276
622 Ga0068865_100959350
623 Ga0075436_100060053
624 Ga0097620_100144323
625 Ga0097620_100244017
626 Ga0097620_100557963
627 Ga0105240_10012485
628 Ga0105240_10310643
629 Ga0105240_12235284
630 Ga0111539_11039695
631 Ga0105245_10496161
632 Ga0105245_11739409
633 Ga0105245_11940523
634 Ga0105245_12785159
635 Ga0105247_10521132
636 Ga0105247_10831505
637 Ga0105243_11082432
638 Ga0105243_11301861
639 Ga0105241_10342457
640 Ga0105241_10877254
641 Ga0105241_11413463
642 Ga0105241_11914745
643 Ga0105242_10087726
644 Ga0105242_10223944
645 Ga0105242_10243681
646 Ga0105242_11104363
647 Ga0105242_11398424
648 Ga0105242_11767461
649 Ga0105248_10109406
650 Ga0105248_10149129
651 Ga0105248_10176745
652 Ga0105248_10466601
653 Ga0105248_10799213
654 Ga0105248_11000665
655 Ga0105248_11072994
656 Ga0105237_10006340
657 Ga0105237_10046332
658 Ga0105237_10243017
659 Ga0105237_10559937
660 Ga0105237_11687599
661 Ga0105238_10327950
662 Ga0105238_11956681
663 Ga0105249_10967200
664 Ga0105249_11866930
665 Ga0099796_10232068
666 Ga0105239_10157762
667 Ga0105239_10284686
668 Ga0105239_10512981
669 Ga0105239_11254717
670 Ga0105239_11343261
671 Ga0105239_11943479
672 Ga0105239_12222501
673 Ga0105246_10305645
674 Ga0105246_12064277
675 Ga0157373_10225579
676 Ga0157370_10002091
677 Ga0157370_11744043
678 Ga0157369_10002983
679 Ga0157369_10019208
680 Ga0157369_10089054
681 Ga0157369_10240214
682 Ga0157369_10449179
683 Ga0157369_11396641
684 Ga0157374_10125391
685 Ga0157374_10542211
686 Ga0157374_10646048
687 Ga0157374_11108998
688 Ga0157378_10202303
689 Ga0157378_10936154
690 Ga0157378_11045763
691 Ga0157378_11304609
692 Ga0157378_12839135
693 Ga0163162_10877865
694 Ga0163162_11125206
695 Ga0163162_11560988
696 Ga0157372_10959978
697 Ga0157372_11189252
698 Ga0157372_11680444
699 Ga0157375_10082398
700 Ga0157375_10821755
701 Ga0157375_10854432
702 Ga0157375_11215141
703 Ga0157375_12191212
704 Ga0157375_12580324
705 Ga0163163_10041947
706 Ga0163163_10365363
707 Ga0163163_10819994
708 Ga0163163_12887692
709 Ga0157380_11000122
710 Ga0157377_10211636
711 Ga0157377_10770931
712 Ga0157379_10645966
713 Ga0157379_11771237
714 Ga0157376_10192756
715 Ga0157376_10234321
716 Ga0157376_10911753
717 Ga0157376_11110640
718 Ga0157376_11234344
719 Ga0157376_11372504
720 Ga0157376_11838375
721 Ga0182006_1100936
722 Ga0197907_10106037
723 Ga0197907_11295087
724 Ga0197907_11460140
725 Ga0206356_10015770
726 Ga0206356_11786172
727 Ga0206349_1474445
728 Ga0206355_1549451
729 Ga0206355_1662720
730 Ga0206352_10060014
731 Ga0206352_10875135
732 Ga0206354_10309871
733 Ga0206354_10661755
734 Ga0206353_10098022
735 Ga0206353_10953412
736 Ga0213875_10075531
737 Ga0224712_10330080
738 Ga0207680_10328974
739 Ga0207685_10608900
740 Ga0207699_10053421
741 Ga0207699_10102743
742 Ga0207643_11113288
743 Ga0207705_10005069
744 Ga0207705_10303418
745 Ga0207705_10390504
746 Ga0207705_10452883
747 Ga0207705_11143604
748 Ga0207684_10124112
749 Ga0207684_10363283
750 Ga0207707_10060274
751 Ga0207707_10140858
752 Ga0207707_10144754
753 Ga0207707_10176950
754 Ga0207695_10052509
755 Ga0207695_10097994
756 Ga0207671_10030708
757 Ga0207671_10035281
758 Ga0207671_11387400
759 Ga0207693_10662562
760 Ga0207663_10219677
761 Ga0207663_10901238
762 Ga0207663_11184493
763 Ga0207660_10044460
764 Ga0207660_10045977
765 Ga0207660_10062650
766 Ga0207660_10887092
767 Ga0207662_10237248
768 Ga0207657_10130492
769 Ga0207652_10041142
770 Ga0207652_10482476
771 Ga0207652_10701747
772 Ga0207652_10797875
773 Ga0207650_10258173
774 Ga0207650_11163038
775 Ga0207650_11546428
776 Ga0207659_10189436
777 Ga0207700_10101758
778 Ga0207700_10374126
779 Ga0207700_10799468
780 Ga0207700_10810654
781 Ga0207700_11731768
782 Ga0207664_10508618
783 Ga0207664_11570369
784 Ga0207644_11560125
785 Ga0207690_10954797
786 Ga0207686_10050094
787 Ga0207686_10834914
788 Ga0207709_11308836
789 Ga0207704_10389956
790 Ga0207704_10414286
791 Ga0207665_10987640
792 Ga0207665_11229750
793 Ga0207691_10932489
794 Ga0207691_11756184
795 Ga0207711_10096376
796 Ga0207711_10293169
797 Ga0207711_10575651
798 Ga0207689_10405002
799 Ga0207661_10000014
800 Ga0207661_10230259
801 Ga0207661_11379772
802 Ga0207661_12123457
803 Ga0207679_10538384
804 Ga0207667_10069844
805 Ga0207667_10263960
806 Ga0207667_10590704
807 Ga0207640_10413310
808 Ga0207658_11113964
809 Ga0207658_11527538
810 Ga0207677_10418626
811 Ga0207677_11257826
812 Ga0207677_11363225
813 Ga0207703_10084960
814 Ga0207703_10346237
815 Ga0207703_10854500
816 Ga0207639_10281834
817 Ga0207639_11632570
818 Ga0207702_10535659
819 Ga0207702_11196550
820 Ga0207702_11500959
821 Ga0207641_10054166
822 Ga0207641_10065785
823 Ga0207641_11401894
824 Ga0207648_10683160
825 Ga0207648_11018080
826 Ga0207674_10300877
827 Ga0207674_10924374
828 Ga0207674_11214012
829 Ga0207674_11596095
830 Ga0207675_100735665
831 Ga0207683_10247151
832 Ga0207683_11164077
833 Ga0207698_10010816
834 Ga0207698_11977805
835 Ga0207698_12187839
836 Ga0268266_10362139
837 Ga0268266_11070258
838 Ga0268264_10168169
839 Ga0265323_10002765
840 Ga0265338_10952018
841 Ga0265762_1027149
842 Ga0265330_10240889
843 Ga0265332_10046593
844 Ga0265325_10095514
845 Ga0265325_10153711
846 Ga0265329_10200852
847 Ga0265340_10093376
848 Ga0265339_10032198
849 Ga0265331_10295965
850 Ga0265331_10579138
851 Ga0265316_10026269
852 Ga0265316_10072259
853 Ga0265316_10277823
854 Ga0265314_10045781
855 Ga0265342_10120976
856 Ga0265342_10213651
857 Ga0316212_1022931
858 Ga0373934_0189625
859 Ga0373923_0598947
860 Ga0373953_0223609
861 Ga0373954_0154622
862 Ga0373954_0400630
863 Ga0373954_0471896
864 Ga0373943_0458733
865 Ga0373946_0174369
866 Ga0373946_0275976
867 Ga0373955_0706605
868 Ga0373924_0369692
869 Ga0373931_0967768
870 Ga0373935_1011300
871 Ga0373927_0049922
872 Ga0373933_0126702
873 Ga0373947_0517039
874 Ga0373947_0675902
875 Ga0373937_0070176
876 Ga0373937_0657103
877 Ga0373937_0925203
878 Ga0316582_0031434
879 Ga0373925_0017454
880 Ga0373925_0370813
881 Ga0373925_0482400
882 Ga0373925_1050816
883 Ga0395899_0432437
884 Ga0436364_0446179
885 Ga0436364_0627175
886 Ga0436364_1294552
887 Ga0436364_1372401
888 Ga0395901_0661130
889 Ga0436365_0257520
890 Ga0436365_0409903
891 Ga0436365_0873358
892 Ga0436361_0370097
893 Ga0436363_0870271
894 Ga0451839_0598184
895 Ga0453683_0617229
896 Ga0466966_0253156
897 Ga0466963_0359869
898 Ga0453684_2563302
899 Ga0466971_0317903
900 Ga0451576_0072459
901 Ga0451576_0117053
902 Ga0451576_0686063
903 Ga0451576_0755116
904 Ga0466967_0326009
905 Ga0495592_0159434
906 Ga0495592_0859842
907 Ga0495603_0907435
908 Ga0495651_0235441
909 Ga0495651_0387343
910 Ga0495651_0449538
911 Ga0495580_0001984
912 Ga0495580_0005012
913 Ga0495580_0616771
914 Ga0495580_0653346
915 Ga0495582_0081693
916 Ga0495664_0072060
917 Ga0495664_0829909
918 Ga0495608_0413385
919 Ga0495618_0188474
920 Ga0495628_0373082
921 Ga0495628_0671575
922 Ga0495630_0520913
923 Ga0495663_0158833
924 Ga0495666_0065712
925 Ga0495642_0123494
926 Ga0495652_0232143
927 Ga0495652_0605168
928 Ga0495640_0440586
929 Ga0495586_0332320
930 Ga0495587_0264705
931 Ga0495587_0494428
932 Ga0495587_0518826
933 Ga0495645_0082177
934 Ga0495645_0423141
935 Ga0495645_0541157
936 Ga0495645_0699553
937 Ga0495667_0104642
938 Ga0495667_0395524
939 Ga0495667_0800884
940 Ga0495635_0308586
941 Ga0495635_0860191
942 Ga0495599_0114550
943 Ga0495623_0073645
944 Ga0495623_0236674
945 Ga0495658_0344145
946 Ga0495669_0354152
947 Ga0495613_0350663
948 Ga0495613_0855230
949 Ga0495589_0568686
950 Ga0495604_0121416
951 Ga0495604_0213793
952 Ga0495604_0285963
953 Ga0495636_0526416
954 Ga0495674_0036930
955 Ga0495674_0107824
956 Ga0495674_0156177
957 Ga0495674_0210458
958 Ga0495674_0453098
959 Ga0495674_0678981
960 Ga0495674_1072392
961 Ga0495676_0804509
962 Ga0495680_0376130
963 Ga0495680_0521820
964 Ga0495675_0085689
965 Ga0495675_0144284
966 Ga0495675_0305530
967 Ga0495675_0473154
968 Ga0495681_0271522
969 Ga0495684_0023685
970 Ga0495684_0030021
971 Ga0495684_0667250
972 Ga0495602_0031265
973 Ga0495602_0295734
974 Ga0495602_0956928
975 Ga0496109_1333058
976 Ga0496112_1408806
977 Ga0496114_1552590
978 Ga0496115_0434425
979 Ga0501305_021569
980 Ga0501032_0927662
981 Ga0501047_0568809
982 Ga0501075_0616455
983 Ga0501044_0474583
984 nmdc:mga08y16_1384284_c1
985 nmdc:mga0n895_1095157_c1
986 Ga0495612_0443406
987 Ga0495619_0449175
988 Ga0501082_0003238

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00886

Ribosomal_S16

Ribosomal protein S16

16

74

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3j9m-assembly1.cif.gz_AM structure of the human mitochondrial ribosome (class 1) 0.9024 2 73
5zeb-assembly1.cif.gz_p m. smegmatis p/p state 70s ribosome structure 0.8969 1 74
8fmw-assembly1.cif.gz_P the structure of a hibernating ribosome in the lyme disease pathogen 0.8966 2 76
8phj-assembly1.cif.gz_P ca4-bound cami1 in complex with 70s ribosome 0.8928 1 75
5mmm-assembly1.cif.gz_p structure of the 70s chloroplast ribosome 0.8901 1 75
ID Description Score Start End Superfamily
af_P56806_1_79_3.30.1320.10 Alpha Beta;2-Layer Sandwich;S16 Ribosomal Protein; Chain: A;;Ribosomal protein S16 0.9111 1 75 3.30.1320.10
af_Q9LTS6_1_135_3.30.1320.10 Alpha Beta;2-Layer Sandwich;S16 Ribosomal Protein; Chain: A;;Ribosomal protein S16 0.8999 1 75 3.30.1320.10
af_Q2FZ45_1_91_3.30.1320.10 Alpha Beta;2-Layer Sandwich;S16 Ribosomal Protein; Chain: A;;Ribosomal protein S16 0.8952 2 75 3.30.1320.10
af_Q9Y3D3_1_135_3.30.1320.10 Alpha Beta;2-Layer Sandwich;S16 Ribosomal Protein; Chain: A;;Ribosomal protein S16 0.8922 2 73 3.30.1320.10
1vs5P00 Alpha Beta;2-Layer Sandwich;S16 Ribosomal Protein; Chain: A;;Ribosomal protein S16 0.8704 1 75 3.30.1320.10
ID Description Score Start End GO Terms
AF-A0A1G1LDL3-F1-model_v4 Small ribosomal subunit protein bS16 0.943 2 75 GO:0003735
GO:0005737
GO:0006412
GO:0015935
AF-A0A497EFW4-F1-model_v4 Small ribosomal subunit protein bS16 0.9404 1 75 GO:0003735
GO:0005737
GO:0006412
GO:0015935
AF-A0A0G0DYQ6-F1-model_v4 Small ribosomal subunit protein bS16 0.9404 2 76 GO:0003735
GO:0005737
GO:0006412
GO:0015935
AF-A0A1G1PAB9-F1-model_v4 Small ribosomal subunit protein bS16 0.9395 2 75 GO:0003735
GO:0005737
GO:0006412
GO:0015935
AF-A0A3M1VTQ6-F1-model_v4 Small ribosomal subunit protein bS16 0.9332 1 75 GO:0003735
GO:0005737
GO:0006412
GO:0015935

Map