F454491

General Info

Members Datasets Scaffolds Average Seq Length
493 265 986 130

Family's Representative Sequence

Representative Sequence 3300049581|Ga0501047_0000066|Ga0501047_0000066_36608_37033
Length 141
Sequence MTEISGVGLFSTFGIAASGVTVQRKWLDAIADNIANINTARPMSGPAYQAEYVVARPVTRGGDTGGVEVAGIARGSAAGRVVNDPTNPLADANGNVRLPDVDLSQQMTQMIMAQRGYQAGLAVVDRARDAYAAAIQIGRNS

Samples

Sample ID Description Type Environment
1 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
5 3300003285 Grassland soil microbial communities from Hopland, California, USA - Sample H3_Rhizo_39 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003559 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
10 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
48 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
83 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
84 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
86 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
88 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
128 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
129 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
130 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
131 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
132 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
133 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
136 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
137 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
138 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
139 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
140 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
141 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
142 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
143 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
144 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
145 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
146 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
147 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
148 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
149 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
150 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
151 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
152 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
153 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
154 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
155 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
156 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
157 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
158 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
159 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
160 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
161 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
162 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
163 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
164 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
165 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
166 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
167 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
168 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
169 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
170 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
171 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
172 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
173 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
174 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
175 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
176 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
177 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
178 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
179 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
180 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
181 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
182 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
183 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
184 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
185 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
186 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
187 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
188 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
189 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
190 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
191 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
192 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
193 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
194 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
195 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
196 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
197 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
198 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
212 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
213 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
214 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
215 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
216 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
217 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
218 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
219 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
220 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
223 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
224 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
225 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
226 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
227 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
228 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
229 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
230 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
231 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
232 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
233 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
234 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
235 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
236 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
237 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
238 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
243 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
244 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
246 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
247 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
248 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
249 2643221604 Nocardioides sp. Root190 Isolate Unclassified
250 2643221615 Nocardioides sp. Root224 Isolate Unclassified
251 2643221616 Leifsonia sp. Root227 Isolate Unclassified
252 2643221617 Nocardioides sp. Root79 Isolate Unclassified
253 2643221620 Nocardioides sp. Root240 Isolate Unclassified
254 2643221630 Microbacterium sp. Root322 Isolate Unclassified
255 2643221641 Nocardioides sp. Root122 Isolate Unclassified
256 2643221649 Leifsonia sp. Root4 Isolate Unclassified
257 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
258 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
259 2738541305 Nocardioides sp. CF167 Isolate Unclassified
260 2739367898 Nocardioides sp. CF479 Isolate Unclassified
261 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
262 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
263 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
264 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
265 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.49
Metatranscriptomes 3.85
Isolates 3.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.56
Nodule 0
Rhizoplane 6.09
Rhizosphere 73.63
Stem 0
Stem Tuber 0.2
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501047_0000066 3300049581 Bacteria 132744
2 JGI24739J22299_10171043 3300001989 Bacteria 640
3 JGI25154J39366_1002744 3300002738 Bacteria 4268
4 JGI25165J46597_1000005 3300003214 Bacteria 623702
5 Ga0007423J48922_100510 3300003285 Bacteria 7818
6 Ga0007423J48922_100511 3300003285 Bacteria 3980
7 Ga0006777J48905_1032610 3300003308 Bacteria 840
8 rootL2_10169173 3300003322 Bacteria 1313
9 Ga0007427J51700_138482 3300003559 Bacteria 518
10 Ga0006562J51391_1055036 3300003578 Bacteria 2880
11 Ga0007429J51699_1045415 3300003579 Bacteria 920
12 Ga0070658_10347096 3300005327 Bacteria 1270
13 Ga0070683_101110575 3300005329 Bacteria 760
14 Ga0070670_100078830 3300005331 Bacteria 2830
15 Ga0070680_100202591 3300005336 Bacteria 1674
16 Ga0070680_100876653 3300005336 Bacteria 774
17 Ga0070660_100509238 3300005339 Bacteria 1002
18 Ga0070660_101919299 3300005339 Bacteria 505
19 Ga0070692_10300895 3300005345 Bacteria 979
20 Ga0070668_100342877 3300005347 Bacteria 1263
21 Ga0070668_101515942 3300005347 Bacteria 613
22 Ga0070671_100009213 3300005355 Bacteria 7929
23 Ga0070671_100288340 3300005355 Bacteria 1397
24 Ga0070671_100608356 3300005355 Bacteria 945
25 Ga0070688_100129424 3300005365 Bacteria 1701
26 Ga0070659_100328795 3300005366 Bacteria 1279
27 Ga0070659_100424699 3300005366 Bacteria 1124
28 Ga0070659_101394123 3300005366 Bacteria 623
29 Ga0070667_100051474 3300005367 Bacteria 3473
30 Ga0070667_100077251 3300005367 Bacteria 2843
31 Ga0070667_100626556 3300005367 Bacteria 992
32 Ga0070714_100865693 3300005435 Bacteria 877
33 Ga0070713_102315673 3300005436 Bacteria 520
34 Ga0070710_10063401 3300005437 Bacteria 2111
35 Ga0070663_100012720 3300005455 Bacteria 5334
36 Ga0070681_10606503 3300005458 Bacteria 1009
37 Ga0068867_100219268 3300005459 Bacteria 1532
38 Ga0070679_100115770 3300005530 Bacteria 2666
39 Ga0070679_101257725 3300005530 Bacteria 686
40 Ga0068853_100207885 3300005539 Bacteria 1783
41 Ga0068853_100562519 3300005539 Bacteria 1081
42 Ga0070672_100181739 3300005543 Bacteria 1753
43 Ga0070672_100801895 3300005543 Bacteria 828
44 Ga0070686_100182865 3300005544 Bacteria 1491
45 Ga0070696_100500428 3300005546 Bacteria 967
46 Ga0070665_100187107 3300005548 Bacteria 2072
47 Ga0068855_100331811 3300005563 Bacteria 1679
48 Ga0070664_100011037 3300005564 Bacteria 7325
49 Ga0068857_100769844 3300005577 Bacteria 918
50 Ga0068856_101563210 3300005614 Bacteria 673
51 Ga0068852_101273131 3300005616 Bacteria 757
52 Ga0068859_101521692 3300005617 Bacteria 739
53 Ga0068866_11042519 3300005718 Bacteria 583
54 Ga0068861_100427858 3300005719 Bacteria 1181
55 Ga0068861_101705012 3300005719 Bacteria 623
56 Ga0068863_100161109 3300005841 Bacteria 2149
57 Ga0068858_100001610 3300005842 Bacteria 23027
58 Ga0068858_100009311 3300005842 Bacteria 9375
59 Ga0068860_100028511 3300005843 Bacteria 5374
60 Ga0068860_100032725 3300005843 Bacteria 4995
61 Ga0068862_100159016 3300005844 Bacteria 2016
62 Ga0075365_10005946 3300006038 Bacteria 6651
63 Ga0075365_10105174 3300006038 Bacteria 1936
64 Ga0075365_10141363 3300006038 Bacteria 1671
65 Ga0075365_10235032 3300006038 Bacteria 1287
66 Ga0075365_10307144 3300006038 Bacteria 1117
67 Ga0075365_10710626 3300006038 Bacteria 710
68 Ga0075365_10953092 3300006038 Bacteria 605
69 Ga0075365_11176643 3300006038 Bacteria 539
70 Ga0075363_100009431 3300006048 Bacteria 4589
71 Ga0075363_100131237 3300006048 Bacteria 1405
72 Ga0075363_100426023 3300006048 Bacteria 782
73 Ga0075364_10002437 3300006051 Bacteria 10415
74 Ga0075364_10006366 3300006051 Bacteria 6936
75 Ga0075364_10008493 3300006051 Bacteria 6144
76 Ga0075364_10033008 3300006051 Bacteria 3330
77 Ga0075364_10080503 3300006051 Bacteria 2153
78 Ga0075364_10361468 3300006051 Bacteria 990
79 Ga0075364_10416310 3300006051 Bacteria 917
80 Ga0070712_101946949 3300006175 Bacteria 515
81 Ga0075367_10005437 3300006178 Bacteria 6324
82 Ga0075367_10114083 3300006178 Bacteria 1661
83 Ga0097621_100873122 3300006237 Bacteria 837
84 Ga0075370_10016492 3300006353 Bacteria 3975
85 Ga0068871_101403912 3300006358 Bacteria 658
86 Ga0068865_101351281 3300006881 Bacteria 635
87 Ga0097620_101521651 3300006931 Bacteria 739
88 Ga0105244_10097307 3300009036 Bacteria 1442
89 Ga0105240_11863310 3300009093 Bacteria 626
90 Ga0111539_10763967 3300009094 Bacteria 1125
91 Ga0105243_10535319 3300009148 Bacteria 1116
92 Ga0105242_10851146 3300009176 Bacteria 907
93 Ga0105242_11512882 3300009176 Bacteria 702
94 Ga0105237_10698211 3300009545 Bacteria 1021
95 Ga0105238_11076391 3300009551 Bacteria 826
96 Ga0105239_10346480 3300010375 Bacteria 1677
97 Ga0157322_1010279 3300012490 Bacteria 751
98 Ga0157371_10987827 3300013102 Bacteria 642
99 Ga0157370_10109747 3300013104 Bacteria 2579
100 Ga0157370_11155675 3300013104 Bacteria 699
101 Ga0157369_10008006 3300013105 Bacteria 12135
102 Ga0157369_10053423 3300013105 Bacteria 4367
103 Ga0157369_10620713 3300013105 Bacteria 1115
104 Ga0157369_10656893 3300013105 Bacteria 1081
105 Ga0157369_10881186 3300013105 Bacteria 918
106 Ga0157369_11050446 3300013105 Bacteria 833
107 Ga0157378_10312691 3300013297 Bacteria 1524
108 Ga0163162_10243371 3300013306 Bacteria 1930
109 Ga0157372_10088555 3300013307 Bacteria 3515
110 Ga0157375_10055451 3300013308 Bacteria 3908
111 Ga0157375_10198223 3300013308 Bacteria 2163
112 Ga0157375_10286909 3300013308 Bacteria 1809
113 Ga0157375_12273941 3300013308 Bacteria 646
114 Ga0163163_10178310 3300014325 Bacteria 2172
115 Ga0163163_10188297 3300014325 Bacteria 2112
116 Ga0163163_10526748 3300014325 Bacteria 1244
117 Ga0163163_11720054 3300014325 Bacteria 688
118 Ga0182008_10728831 3300014497 Bacteria 569
119 Ga0157377_10181140 3300014745 Bacteria 1325
120 Ga0157377_10729211 3300014745 Bacteria 723
121 Ga0157379_10142723 3300014968 Bacteria 2159
122 Ga0157376_10781458 3300014969 Bacteria 966
123 Ga0163161_11458890 3300017792 Bacteria 599
124 Ga0206356_10447951 3300020070 Bacteria 1029
125 Ga0206353_11259515 3300020082 Bacteria 2052
126 Ga0209672_100011 3300025228 Bacteria 856297
127 Ga0209147_100725 3300025229 Bacteria 16526
128 Ga0207427_100024 3300025231 Bacteria 438403
129 Ga0209437_100960 3300025233 Bacteria 10564
130 Ga0209258_104038 3300025242 Bacteria 2914
131 Ga0209646_1000088 3300025246 Bacteria 192345
132 Ga0209148_1000023 3300025254 Bacteria 680511
133 Ga0209233_1000001 3300025261 Bacteria 2992747
134 Ga0209455_1000023 3300025272 Bacteria 680449
135 Ga0207655_1098626 3300025728 Bacteria 1011
136 Ga0207655_1175687 3300025728 Bacteria 658
137 Ga0207692_10032302 3300025898 Bacteria 2515
138 Ga0207642_10352771 3300025899 Bacteria 868
139 Ga0207688_10500857 3300025901 Bacteria 761
140 Ga0207688_10956520 3300025901 Bacteria 542
141 Ga0207647_10072268 3300025904 Bacteria 2080
142 Ga0207647_10737096 3300025904 Bacteria 534
143 Ga0207647_10812694 3300025904 Bacteria 502
144 Ga0207643_10123654 3300025908 Bacteria 1534
145 Ga0207705_10558292 3300025909 Bacteria 890
146 Ga0207707_11358719 3300025912 Bacteria 568
147 Ga0207671_10803375 3300025914 Bacteria 746
148 Ga0207660_10092251 3300025917 Bacteria 2248
149 Ga0207660_10659380 3300025917 Bacteria 853
150 Ga0207657_10175158 3300025919 Bacteria 1736
151 Ga0207657_10263811 3300025919 Bacteria 1370
152 Ga0207657_10315785 3300025919 Bacteria 1236
153 Ga0207652_10100931 3300025921 Bacteria 2548
154 Ga0207694_10581026 3300025924 Bacteria 942
155 Ga0207650_10076209 3300025925 Bacteria 2533
156 Ga0207687_10537068 3300025927 Bacteria 980
157 Ga0207700_10669826 3300025928 Bacteria 925
158 Ga0207664_11179011 3300025929 Bacteria 683
159 Ga0207644_10001193 3300025931 Bacteria 16723
160 Ga0207644_10522333 3300025931 Bacteria 981
161 Ga0207644_11761200 3300025931 Bacteria 519
162 Ga0207690_10114601 3300025932 Bacteria 1947
163 Ga0207690_10335446 3300025932 Bacteria 1192
164 Ga0207690_10982878 3300025932 Bacteria 702
165 Ga0207690_11077805 3300025932 Bacteria 669
166 Ga0207686_11146371 3300025934 Bacteria 635
167 Ga0207691_10217080 3300025940 Bacteria 1659
168 Ga0207661_10287174 3300025944 Bacteria 1472
169 Ga0207661_10413328 3300025944 Bacteria 1225
170 Ga0207679_10019846 3300025945 Bacteria 4526
171 Ga0207679_11743392 3300025945 Bacteria 569
172 Ga0207667_11110427 3300025949 Bacteria 774
173 Ga0207668_10161358 3300025972 Bacteria 1747
174 Ga0207668_11372818 3300025972 Bacteria 637
175 Ga0207658_10058377 3300025986 Bacteria 2871
176 Ga0207658_10151827 3300025986 Bacteria 1888
177 Ga0207658_10542249 3300025986 Bacteria 1040
178 Ga0207703_10005710 3300026035 Bacteria 9983
179 Ga0207703_10221662 3300026035 Bacteria 1691
180 Ga0207639_11055937 3300026041 Bacteria 761
181 Ga0207639_11455379 3300026041 Bacteria 643
182 Ga0207678_10023565 3300026067 Bacteria 5382
183 Ga0207678_10063314 3300026067 Bacteria 3178
184 Ga0207641_10414100 3300026088 Bacteria 1296
185 Ga0207648_10336420 3300026089 Bacteria 1359
186 Ga0207676_10670671 3300026095 Bacteria 1002
187 Ga0207674_10208250 3300026116 Bacteria 1905
188 Ga0207674_10848169 3300026116 Bacteria 881
189 Ga0207675_101662425 3300026118 Bacteria 659
190 Ga0207675_101881352 3300026118 Bacteria 617
191 Ga0207683_10305492 3300026121 Bacteria 1455
192 Ga0207698_11830379 3300026142 Bacteria 622
193 Ga0268265_10100047 3300028380 Bacteria 2339
194 Ga0268264_10000305 3300028381 Bacteria 78992
195 Ga0268264_10053080 3300028381 Bacteria 3381
196 Ga0316579_10000005 3300031691 Bacteria 58305
197 Ga0307413_10436435 3300031824 Bacteria 1036
198 Ga0307413_10486596 3300031824 Bacteria 988
199 Ga0307413_11562931 3300031824 Bacteria 585
200 Ga0307410_10065038 3300031852 Bacteria 2508
201 Ga0307406_10009250 3300031901 Bacteria 5520
202 Ga0307406_10078615 3300031901 Bacteria 2186
203 Ga0307406_10172925 3300031901 Bacteria 1565
204 Ga0307407_10392503 3300031903 Bacteria 994
205 Ga0307412_10154515 3300031911 Bacteria 1697
206 Ga0307409_100177003 3300031995 Bacteria 1884
207 Ga0307409_100650298 3300031995 Bacteria 1048
208 Ga0307409_100973500 3300031995 Bacteria 865
209 Ga0307409_101320623 3300031995 Bacteria 747
210 Ga0307416_100204315 3300032002 Bacteria 1878
211 Ga0307416_100294426 3300032002 Bacteria 1609
212 Ga0307416_100432392 3300032002 Bacteria 1364
213 Ga0307416_100434897 3300032002 Bacteria 1360
214 Ga0307414_10102257 3300032004 Bacteria 2159
215 Ga0307414_10125987 3300032004 Bacteria 1979
216 Ga0307414_10197643 3300032004 Bacteria 1633
217 Ga0307414_10582122 3300032004 Bacteria 1002
218 Ga0307414_11163161 3300032004 Bacteria 714
219 Ga0307415_100004289 3300032126 Bacteria 7378
220 Ga0307415_100205010 3300032126 Bacteria 1568
221 Ga0307415_100239337 3300032126 Bacteria 1467
222 Ga0307415_100434981 3300032126 Bacteria 1130
223 Ga0307415_100449232 3300032126 Bacteria 1114
224 Ga0307415_100452011 3300032126 Bacteria 1111
225 Ga0307415_100982779 3300032126 Bacteria 783
226 Ga0307415_101001361 3300032126 Bacteria 777
227 Ga0373951_0000491 3300035091 Bacteria 11225
228 Ga0373936_0249203 3300035113 Bacteria 793
229 Ga0373941_0289346 3300035115 Bacteria 651
230 Ga0373943_0238305 3300035170 Bacteria 1019
231 Ga0395899_0017320 3300037312 Bacteria 5491
232 Ga0395899_0274191 3300037312 Bacteria 1150
233 Ga0395900_0004579 3300037418 Bacteria 14590
234 Ga0395900_0087974 3300037418 Bacteria 3193
235 Ga0395900_0173678 3300037418 Bacteria 2193
236 Ga0395900_0351813 3300037418 Bacteria 1447
237 Ga0395900_0721433 3300037418 Bacteria 929
238 Ga0395898_0000355 3300037466 Bacteria 101003
239 Ga0395898_0045034 3300037466 Bacteria 4338
240 Ga0395898_0219295 3300037466 Bacteria 1815
241 Ga0395898_1464899 3300037466 Bacteria 609
242 Ga0395905_0129337 3300037471 Bacteria 2375
243 Ga0395905_0524755 3300037471 Bacteria 1085
244 Ga0395905_0982752 3300037471 Bacteria 747
245 Ga0395901_0041877 3300038443 Bacteria 4747
246 Ga0395901_0197895 3300038443 Bacteria 2107
247 Ga0395901_0263024 3300038443 Bacteria 1795
248 Ga0395901_0386055 3300038443 Bacteria 1441
249 Ga0395901_0567353 3300038443 Bacteria 1148
250 Ga0395901_1569011 3300038443 Bacteria 612
251 Ga0436365_0524299 3300039437 Bacteria 522
252 Ga0451791_0571599 3300041451 Bacteria 589
253 Ga0451791_1154508 3300041451 Bacteria 980
254 Ga0451793_1240687 3300041452 Bacteria 641
255 Ga0451839_1352337 3300041496 Bacteria 515
256 Ga0451853_2457073 3300041512 Bacteria 813
257 Ga0439448_0060487 3300042005 Bacteria 1252
258 Ga0439464_0090469 3300042439 Bacteria 922
259 Ga0466972_0016008 3300044658 Bacteria 3749
260 Ga0466972_0098039 3300044658 Bacteria 1388
261 Ga0466972_0104312 3300044658 Bacteria 1341
262 Ga0466965_0010475 3300044683 Bacteria 4326
263 Ga0466965_0090668 3300044683 Bacteria 1555
264 Ga0466965_0142077 3300044683 Bacteria 1251
265 Ga0466965_0417082 3300044683 Bacteria 744
266 Ga0466965_0433743 3300044683 Bacteria 730
267 Ga0466965_0590837 3300044683 Bacteria 630
268 Ga0466965_0611894 3300044683 Bacteria 620
269 Ga0466966_0038571 3300044684 Bacteria 3079
270 Ga0466966_0640255 3300044684 Bacteria 640
271 Ga0466961_0030714 3300044693 Bacteria 3452
272 Ga0466961_0046053 3300044693 Bacteria 2790
273 Ga0466961_0257443 3300044693 Bacteria 1071
274 Ga0466961_0485608 3300044693 Bacteria 746
275 Ga0466963_0013887 3300044694 Bacteria 4959
276 Ga0466963_0576681 3300044694 Bacteria 795
277 Ga0466964_0096497 3300044706 Bacteria 1296
278 Ga0466971_0130800 3300044719 Bacteria 1165
279 Ga0466968_0372342 3300044735 Bacteria 697
280 Ga0466970_0005660 3300044765 Bacteria 6206
281 Ga0466970_0008716 3300044765 Bacteria 5110
282 Ga0466970_0013087 3300044765 Bacteria 4251
283 Ga0466970_0058309 3300044765 Bacteria 2066
284 Ga0466970_0210265 3300044765 Bacteria 1084
285 Ga0466970_0284452 3300044765 Bacteria 930
286 Ga0466970_0621623 3300044765 Bacteria 627
287 Ga0466970_0700938 3300044765 Bacteria 590
288 Ga0466970_0827482 3300044765 Bacteria 543
289 Ga0466957_0015658 3300044842 Bacteria 4430
290 Ga0466957_0024166 3300044842 Bacteria 3596
291 Ga0466957_0187593 3300044842 Bacteria 1353
292 Ga0466960_0001954 3300044901 Bacteria 7622
293 Ga0466960_0081131 3300044901 Bacteria 1635
294 Ga0466960_0096845 3300044901 Bacteria 1513
295 Ga0466960_0258952 3300044901 Bacteria 969
296 Ga0466960_0276316 3300044901 Bacteria 940
297 Ga0466960_0318481 3300044901 Bacteria 880
298 Ga0466960_0697900 3300044901 Bacteria 609
299 Ga0466958_0049122 3300045836 Bacteria 2552
300 Ga0466958_0151496 3300045836 Bacteria 1463
301 Ga0466958_0170998 3300045836 Bacteria 1376
302 Ga0466958_0384821 3300045836 Bacteria 905
303 Ga0466958_0558489 3300045836 Bacteria 744
304 Ga0466958_0964413 3300045836 Bacteria 556
305 Ga0466967_0007345 3300045976 Bacteria 7937
306 Ga0466967_0095489 3300045976 Bacteria 2710
307 Ga0466967_0180876 3300045976 Bacteria 1989
308 Ga0466967_0257879 3300045976 Bacteria 1667
309 Ga0466967_0275333 3300045976 Bacteria 1614
310 Ga0466967_0276606 3300045976 Bacteria 1610
311 Ga0466967_0499758 3300045976 Bacteria 1193
312 Ga0466967_0631085 3300045976 Bacteria 1059
313 Ga0466967_0698409 3300045976 Bacteria 1005
314 Ga0466967_0787777 3300045976 Bacteria 944
315 Ga0495627_000366 3300046453 Bacteria 42078
316 Ga0495629_0585902 3300046459 Bacteria 747
317 Ga0495606_0298343 3300046507 Bacteria 874
318 Ga0495632_0165322 3300046519 Bacteria 1018
319 Ga0495634_0147830 3300046642 Bacteria 1488
320 Ga0495588_0300648 3300046674 Bacteria 845
321 Ga0495676_0910869 3300047321 Bacteria 563
322 Ga0495686_0105648 3300047472 Bacteria 1694
323 Ga0495686_0182052 3300047472 Bacteria 1217
324 Ga0495686_0439965 3300047472 Bacteria 694
325 Ga0495602_1035458 3300048088 Bacteria 540
326 Ga0495614_0524208 3300048089 Bacteria 565
327 Ga0496100_0025649 3300048903 Bacteria 3606
328 Ga0496100_0900124 3300048903 Bacteria 695
329 Ga0496101_0104608 3300048904 Bacteria 2123
330 Ga0496101_0656513 3300048904 Bacteria 829
331 Ga0496102_0188535 3300048905 Bacteria 1943
332 Ga0496102_0314034 3300048905 Bacteria 1477
333 Ga0496102_0610606 3300048905 Bacteria 1014
334 Ga0496102_1843257 3300048905 Bacteria 522
335 Ga0496103_0089814 3300048906 Bacteria 1938
336 Ga0496103_0937644 3300048906 Bacteria 541
337 Ga0496104_0007772 3300048907 Bacteria 9501
338 Ga0496105_0045121 3300048908 Bacteria 3636
339 Ga0496105_1188207 3300048908 Bacteria 562
340 Ga0496106_0576410 3300048909 Bacteria 902
341 Ga0496107_0210391 3300048910 Bacteria 1446
342 Ga0496108_0000019 3300048911 Bacteria 234657
343 Ga0496108_0061685 3300048911 Bacteria 3156
344 Ga0496109_0045741 3300048912 Bacteria 3973
345 Ga0496109_0205307 3300048912 Bacteria 1853
346 Ga0496110_0094439 3300048913 Bacteria 2678
347 Ga0496110_0501254 3300048913 Bacteria 1105
348 Ga0496111_0225273 3300048914 Bacteria 1393
349 Ga0496111_0354771 3300048914 Bacteria 1085
350 Ga0496114_0003349 3300048917 Bacteria 12318
351 Ga0496114_0097696 3300048917 Bacteria 2502
352 Ga0496114_0160808 3300048917 Bacteria 1953
353 Ga0496115_0030507 3300048918 Bacteria 4241
354 Ga0496117_0001811 3300048920 Bacteria 29041
355 Ga0496117_0244063 3300048920 Bacteria 984
356 Ga0496118_0065991 3300048921 Bacteria 2644
357 Ga0496118_0172883 3300048921 Bacteria 1317
358 Ga0496119_0268821 3300048922 Bacteria 852
359 Ga0496120_0074381 3300048923 Bacteria 1856
360 Ga0496120_0248262 3300048923 Bacteria 837
361 Ga0496122_0017904 3300048925 Bacteria 6580
362 Ga0496122_0032296 3300048925 Bacteria 4333
363 Ga0496122_0062828 3300048925 Bacteria 2716
364 Ga0496122_0584148 3300048925 Bacteria 525
365 Ga0496124_0048782 3300048927 Bacteria 3615
366 Ga0496124_0281571 3300048927 Bacteria 1212
367 Ga0496125_0000894 3300048928 Bacteria 47247
368 Ga0496125_0005566 3300048928 Bacteria 13931
369 Ga0496125_0024003 3300048928 Bacteria 5617
370 Ga0496126_0011450 3300048929 Bacteria 9179
371 Ga0496126_0051147 3300048929 Bacteria 3763
372 Ga0496126_0072654 3300048929 Bacteria 3059
373 Ga0496126_0366644 3300048929 Bacteria 1175
374 Ga0501311_019904 3300049527 Bacteria 904
375 Ga0501031_0323695 3300049568 Bacteria 999
376 Ga0501031_0417286 3300049568 Bacteria 868
377 Ga0501031_0521819 3300049568 Bacteria 766
378 Ga0501032_0042244 3300049569 Bacteria 3093
379 Ga0501034_0026403 3300049571 Bacteria 5914
380 Ga0501034_0126993 3300049571 Bacteria 2535
381 Ga0501034_0332732 3300049571 Bacteria 1450
382 Ga0501034_0740327 3300049571 Bacteria 879
383 Ga0501034_1260738 3300049571 Bacteria 617
384 Ga0501034_1644322 3300049571 Bacteria 515
385 Ga0501036_0232822 3300049572 Bacteria 1545
386 Ga0501036_1420184 3300049572 Bacteria 562
387 Ga0501037_0107282 3300049573 Bacteria 2012
388 Ga0501037_0142897 3300049573 Bacteria 1712
389 Ga0501037_0529872 3300049573 Bacteria 797
390 Ga0501038_0000606 3300049574 Bacteria 31851
391 Ga0501039_0191325 3300049575 Bacteria 1609
392 Ga0501039_0285503 3300049575 Bacteria 1297
393 Ga0501039_0981843 3300049575 Bacteria 656
394 Ga0501040_0009768 3300049576 Bacteria 6265
395 Ga0501040_0315466 3300049576 Bacteria 1118
396 Ga0501040_0349127 3300049576 Bacteria 1060
397 Ga0501041_0082060 3300049577 Bacteria 1986
398 Ga0501043_0074950 3300049579 Bacteria 2658
399 Ga0501043_0632623 3300049579 Bacteria 787
400 Ga0501046_0083071 3300049580 Bacteria 2473
401 Ga0501047_0013007 3300049581 Bacteria 7879
402 Ga0501047_0211117 3300049581 Bacteria 1800
403 Ga0501048_0093074 3300049582 Bacteria 2126
404 Ga0501048_0298700 3300049582 Bacteria 1146
405 Ga0501048_0677069 3300049582 Bacteria 741
406 Ga0501070_0000407 3300049586 Bacteria 39131
407 Ga0501070_0002371 3300049586 Bacteria 16526
408 Ga0501070_0239160 3300049586 Bacteria 1486
409 Ga0501070_0265586 3300049586 Bacteria 1402
410 Ga0501070_1035273 3300049586 Bacteria 635
411 Ga0501070_1093197 3300049586 Bacteria 615
412 Ga0501071_1002006 3300049587 Bacteria 645
413 Ga0501072_1386169 3300049588 Bacteria 544
414 Ga0501073_0285975 3300049589 Bacteria 1138
415 Ga0501073_0324137 3300049589 Bacteria 1063
416 Ga0501074_1096149 3300049590 Bacteria 559
417 Ga0501074_1189509 3300049590 Bacteria 535
418 Ga0501075_1188902 3300049591 Bacteria 579
419 Ga0501076_0186530 3300049592 Bacteria 1692
420 Ga0501076_0366474 3300049592 Bacteria 1184
421 Ga0501076_0621139 3300049592 Bacteria 892
422 Ga0501076_1616688 3300049592 Bacteria 532
423 Ga0501079_0915277 3300049741 Bacteria 691
424 Ga0501079_0920284 3300049741 Bacteria 689
425 Ga0501079_1574347 3300049741 Bacteria 517
426 Ga0501081_0600310 3300049743 Bacteria 824
427 Ga0501035_0005064 3300049822 Bacteria 12489
428 Ga0501035_0006739 3300049822 Bacteria 10738
429 Ga0501035_0028818 3300049822 Bacteria 5066
430 Ga0501044_0025294 3300049823 Bacteria 6291
431 Ga0501044_0029996 3300049823 Bacteria 5733
432 Ga0501045_0749832 3300049824 Bacteria 720
433 nmdc:mga03683_571665_c1 3300050489 Bacteria 551
434 nmdc:mga03n38_102449_c1 3300050490 Bacteria 1382
435 nmdc:mga03n38_26049_c1 3300050490 Bacteria 2411
436 nmdc:mga03n38_723976_c1 3300050490 Bacteria 575
437 nmdc:mga00v17_134432_c1 3300050491 Bacteria 1582
438 nmdc:mga00v17_330967_c1 3300050491 Bacteria 990
439 nmdc:mga00v17_49017_c1 3300050491 Bacteria 2561
440 nmdc:mga00v17_69318_c1 3300050491 Bacteria 2182
441 nmdc:mga00v17_94699_c1 3300050491 Bacteria 1879
442 nmdc:mga0yw44_12973_c1 3300050492 Bacteria 4367
443 nmdc:mga0yw44_31803_c1 3300050492 Bacteria 3071
444 nmdc:mga0yw44_349064_c1 3300050492 Bacteria 996
445 nmdc:mga0yw44_395021_c1 3300050492 Bacteria 935
446 nmdc:mga0yw44_497816_c1 3300050492 Bacteria 827
447 nmdc:mga0yw44_561576_c1 3300050492 Bacteria 775
448 nmdc:mga0yw44_62045_c1 3300050492 Bacteria 2295
449 nmdc:mga0yw44_79866_c1 3300050492 Bacteria 2047
450 nmdc:mga06z11_108567_c1 3300050494 Bacteria 1533
451 nmdc:mga06z11_770314_c1 3300050494 Bacteria 586
452 nmdc:mga06z11_9356_c1 3300050494 Bacteria 4127
453 nmdc:mga07m45_33799_c1 3300050496 Bacteria 2841
454 Ga0495601_0070027 3300053077 Bacteria 2238
455 Ga0500635_0000198 3300053080 Bacteria 30223
456 Ga0495655_0001237 3300053083 Bacteria 3950
457 Ga0500644_0031614 3300053088 Bacteria 1685
458 Ga0500556_0001418 3300053104 Bacteria 10317
459 Ga0500593_000469 3300053117 Bacteria 16057
460 Ga0500620_019901 3300053155 Bacteria 1981
461 Ga0500620_234834 3300053155 Bacteria 615
462 Ga0501084_0120927 3300054114 Bacteria 2202
463 Ga0501084_0621188 3300054114 Bacteria 913
464 Ga0590075_163251 3300059424 Bacteria 588
465 Ga0587084_094106 3300059477 Bacteria 598
466 Ga0587070_051324 3300059491 Bacteria 824
467 Ga0587073_0107285 3300059492 Bacteria 735
468 Ga0587082_044612 3300059504 Bacteria 825
469 Ga0587101_099526 3300059623 Bacteria 576
470 Ga0587101_127646 3300059623 Bacteria 532
471 Ga0587128_013673 3300059630 Bacteria 1149
472 Ga0587076_006468 3300059645 Bacteria 1563
473 Ga0587100_013197 3300059648 Bacteria 732
474 Ga0587110_004087 3300059654 Bacteria 1256
475 Ga0466962_0020093 3300061719 Bacteria 3210
476 2643734828 2643221542 Bacteria 3563959
477 2644031718 2643221604 Bacteria 5014917
478 2644094053 2643221615 Bacteria 5487866
479 2644097472 2643221616 Bacteria 4066575
480 2644100289 2643221617 Bacteria 5139111
481 2644116697 2643221620 Bacteria 5134593
482 2644172988 2643221630 Bacteria 3601215
483 2644231953 2643221641 Bacteria 4490190
484 2644279199 2643221649 Bacteria 3867359
485 2644323896 2643221657 Bacteria 5490246
486 2644523660 2643221694 Bacteria 4392972
487 2738869183 2738541305 Bacteria 4910150
488 2740168658 2739367898 Bacteria 4367674
489 2812331259 2811994874 Bacteria 5367947
490 2852665870 2852663356 Bacteria 4090475
491 2855388282 2855386786 Bacteria 4752232
492 2884767294 2884763398 Bacteria 4091164
493 2884998165 2884994152 Bacteria 4492978
494 Ga0501047_0000066
495 JGI24739J22299_10171043
496 JGI25154J39366_1002744
497 JGI25165J46597_1000005
498 Ga0007423J48922_100510
499 Ga0007423J48922_100511
500 Ga0006777J48905_1032610
501 rootL2_10169173
502 Ga0007427J51700_138482
503 Ga0006562J51391_1055036
504 Ga0007429J51699_1045415
505 Ga0070658_10347096
506 Ga0070683_101110575
507 Ga0070670_100078830
508 Ga0070680_100202591
509 Ga0070680_100876653
510 Ga0070660_100509238
511 Ga0070660_101919299
512 Ga0070692_10300895
513 Ga0070668_100342877
514 Ga0070668_101515942
515 Ga0070671_100009213
516 Ga0070671_100288340
517 Ga0070671_100608356
518 Ga0070688_100129424
519 Ga0070659_100328795
520 Ga0070659_100424699
521 Ga0070659_101394123
522 Ga0070667_100051474
523 Ga0070667_100077251
524 Ga0070667_100626556
525 Ga0070714_100865693
526 Ga0070713_102315673
527 Ga0070710_10063401
528 Ga0070663_100012720
529 Ga0070681_10606503
530 Ga0068867_100219268
531 Ga0070679_100115770
532 Ga0070679_101257725
533 Ga0068853_100207885
534 Ga0068853_100562519
535 Ga0070672_100181739
536 Ga0070672_100801895
537 Ga0070686_100182865
538 Ga0070696_100500428
539 Ga0070665_100187107
540 Ga0068855_100331811
541 Ga0070664_100011037
542 Ga0068857_100769844
543 Ga0068856_101563210
544 Ga0068852_101273131
545 Ga0068859_101521692
546 Ga0068866_11042519
547 Ga0068861_100427858
548 Ga0068861_101705012
549 Ga0068863_100161109
550 Ga0068858_100001610
551 Ga0068858_100009311
552 Ga0068860_100028511
553 Ga0068860_100032725
554 Ga0068862_100159016
555 Ga0075365_10005946
556 Ga0075365_10105174
557 Ga0075365_10141363
558 Ga0075365_10235032
559 Ga0075365_10307144
560 Ga0075365_10710626
561 Ga0075365_10953092
562 Ga0075365_11176643
563 Ga0075363_100009431
564 Ga0075363_100131237
565 Ga0075363_100426023
566 Ga0075364_10002437
567 Ga0075364_10006366
568 Ga0075364_10008493
569 Ga0075364_10033008
570 Ga0075364_10080503
571 Ga0075364_10361468
572 Ga0075364_10416310
573 Ga0070712_101946949
574 Ga0075367_10005437
575 Ga0075367_10114083
576 Ga0097621_100873122
577 Ga0075370_10016492
578 Ga0068871_101403912
579 Ga0068865_101351281
580 Ga0097620_101521651
581 Ga0105244_10097307
582 Ga0105240_11863310
583 Ga0111539_10763967
584 Ga0105243_10535319
585 Ga0105242_10851146
586 Ga0105242_11512882
587 Ga0105237_10698211
588 Ga0105238_11076391
589 Ga0105239_10346480
590 Ga0157322_1010279
591 Ga0157371_10987827
592 Ga0157370_10109747
593 Ga0157370_11155675
594 Ga0157369_10008006
595 Ga0157369_10053423
596 Ga0157369_10620713
597 Ga0157369_10656893
598 Ga0157369_10881186
599 Ga0157369_11050446
600 Ga0157378_10312691
601 Ga0163162_10243371
602 Ga0157372_10088555
603 Ga0157375_10055451
604 Ga0157375_10198223
605 Ga0157375_10286909
606 Ga0157375_12273941
607 Ga0163163_10178310
608 Ga0163163_10188297
609 Ga0163163_10526748
610 Ga0163163_11720054
611 Ga0182008_10728831
612 Ga0157377_10181140
613 Ga0157377_10729211
614 Ga0157379_10142723
615 Ga0157376_10781458
616 Ga0163161_11458890
617 Ga0206356_10447951
618 Ga0206353_11259515
619 Ga0209672_100011
620 Ga0209147_100725
621 Ga0207427_100024
622 Ga0209437_100960
623 Ga0209258_104038
624 Ga0209646_1000088
625 Ga0209148_1000023
626 Ga0209233_1000001
627 Ga0209455_1000023
628 Ga0207655_1098626
629 Ga0207655_1175687
630 Ga0207692_10032302
631 Ga0207642_10352771
632 Ga0207688_10500857
633 Ga0207688_10956520
634 Ga0207647_10072268
635 Ga0207647_10737096
636 Ga0207647_10812694
637 Ga0207643_10123654
638 Ga0207705_10558292
639 Ga0207707_11358719
640 Ga0207671_10803375
641 Ga0207660_10092251
642 Ga0207660_10659380
643 Ga0207657_10175158
644 Ga0207657_10263811
645 Ga0207657_10315785
646 Ga0207652_10100931
647 Ga0207694_10581026
648 Ga0207650_10076209
649 Ga0207687_10537068
650 Ga0207700_10669826
651 Ga0207664_11179011
652 Ga0207644_10001193
653 Ga0207644_10522333
654 Ga0207644_11761200
655 Ga0207690_10114601
656 Ga0207690_10335446
657 Ga0207690_10982878
658 Ga0207690_11077805
659 Ga0207686_11146371
660 Ga0207691_10217080
661 Ga0207661_10287174
662 Ga0207661_10413328
663 Ga0207679_10019846
664 Ga0207679_11743392
665 Ga0207667_11110427
666 Ga0207668_10161358
667 Ga0207668_11372818
668 Ga0207658_10058377
669 Ga0207658_10151827
670 Ga0207658_10542249
671 Ga0207703_10005710
672 Ga0207703_10221662
673 Ga0207639_11055937
674 Ga0207639_11455379
675 Ga0207678_10023565
676 Ga0207678_10063314
677 Ga0207641_10414100
678 Ga0207648_10336420
679 Ga0207676_10670671
680 Ga0207674_10208250
681 Ga0207674_10848169
682 Ga0207675_101662425
683 Ga0207675_101881352
684 Ga0207683_10305492
685 Ga0207698_11830379
686 Ga0268265_10100047
687 Ga0268264_10000305
688 Ga0268264_10053080
689 Ga0316579_10000005
690 Ga0307413_10436435
691 Ga0307413_10486596
692 Ga0307413_11562931
693 Ga0307410_10065038
694 Ga0307406_10009250
695 Ga0307406_10078615
696 Ga0307406_10172925
697 Ga0307407_10392503
698 Ga0307412_10154515
699 Ga0307409_100177003
700 Ga0307409_100650298
701 Ga0307409_100973500
702 Ga0307409_101320623
703 Ga0307416_100204315
704 Ga0307416_100294426
705 Ga0307416_100432392
706 Ga0307416_100434897
707 Ga0307414_10102257
708 Ga0307414_10125987
709 Ga0307414_10197643
710 Ga0307414_10582122
711 Ga0307414_11163161
712 Ga0307415_100004289
713 Ga0307415_100205010
714 Ga0307415_100239337
715 Ga0307415_100434981
716 Ga0307415_100449232
717 Ga0307415_100452011
718 Ga0307415_100982779
719 Ga0307415_101001361
720 Ga0373951_0000491
721 Ga0373936_0249203
722 Ga0373941_0289346
723 Ga0373943_0238305
724 Ga0395899_0017320
725 Ga0395899_0274191
726 Ga0395900_0004579
727 Ga0395900_0087974
728 Ga0395900_0173678
729 Ga0395900_0351813
730 Ga0395900_0721433
731 Ga0395898_0000355
732 Ga0395898_0045034
733 Ga0395898_0219295
734 Ga0395898_1464899
735 Ga0395905_0129337
736 Ga0395905_0524755
737 Ga0395905_0982752
738 Ga0395901_0041877
739 Ga0395901_0197895
740 Ga0395901_0263024
741 Ga0395901_0386055
742 Ga0395901_0567353
743 Ga0395901_1569011
744 Ga0436365_0524299
745 Ga0451791_0571599
746 Ga0451791_1154508
747 Ga0451793_1240687
748 Ga0451839_1352337
749 Ga0451853_2457073
750 Ga0439448_0060487
751 Ga0439464_0090469
752 Ga0466972_0016008
753 Ga0466972_0098039
754 Ga0466972_0104312
755 Ga0466965_0010475
756 Ga0466965_0090668
757 Ga0466965_0142077
758 Ga0466965_0417082
759 Ga0466965_0433743
760 Ga0466965_0590837
761 Ga0466965_0611894
762 Ga0466966_0038571
763 Ga0466966_0640255
764 Ga0466961_0030714
765 Ga0466961_0046053
766 Ga0466961_0257443
767 Ga0466961_0485608
768 Ga0466963_0013887
769 Ga0466963_0576681
770 Ga0466964_0096497
771 Ga0466971_0130800
772 Ga0466968_0372342
773 Ga0466970_0005660
774 Ga0466970_0008716
775 Ga0466970_0013087
776 Ga0466970_0058309
777 Ga0466970_0210265
778 Ga0466970_0284452
779 Ga0466970_0621623
780 Ga0466970_0700938
781 Ga0466970_0827482
782 Ga0466957_0015658
783 Ga0466957_0024166
784 Ga0466957_0187593
785 Ga0466960_0001954
786 Ga0466960_0081131
787 Ga0466960_0096845
788 Ga0466960_0258952
789 Ga0466960_0276316
790 Ga0466960_0318481
791 Ga0466960_0697900
792 Ga0466958_0049122
793 Ga0466958_0151496
794 Ga0466958_0170998
795 Ga0466958_0384821
796 Ga0466958_0558489
797 Ga0466958_0964413
798 Ga0466967_0007345
799 Ga0466967_0095489
800 Ga0466967_0180876
801 Ga0466967_0257879
802 Ga0466967_0275333
803 Ga0466967_0276606
804 Ga0466967_0499758
805 Ga0466967_0631085
806 Ga0466967_0698409
807 Ga0466967_0787777
808 Ga0495627_000366
809 Ga0495629_0585902
810 Ga0495606_0298343
811 Ga0495632_0165322
812 Ga0495634_0147830
813 Ga0495588_0300648
814 Ga0495676_0910869
815 Ga0495686_0105648
816 Ga0495686_0182052
817 Ga0495686_0439965
818 Ga0495602_1035458
819 Ga0495614_0524208
820 Ga0496100_0025649
821 Ga0496100_0900124
822 Ga0496101_0104608
823 Ga0496101_0656513
824 Ga0496102_0188535
825 Ga0496102_0314034
826 Ga0496102_0610606
827 Ga0496102_1843257
828 Ga0496103_0089814
829 Ga0496103_0937644
830 Ga0496104_0007772
831 Ga0496105_0045121
832 Ga0496105_1188207
833 Ga0496106_0576410
834 Ga0496107_0210391
835 Ga0496108_0000019
836 Ga0496108_0061685
837 Ga0496109_0045741
838 Ga0496109_0205307
839 Ga0496110_0094439
840 Ga0496110_0501254
841 Ga0496111_0225273
842 Ga0496111_0354771
843 Ga0496114_0003349
844 Ga0496114_0097696
845 Ga0496114_0160808
846 Ga0496115_0030507
847 Ga0496117_0001811
848 Ga0496117_0244063
849 Ga0496118_0065991
850 Ga0496118_0172883
851 Ga0496119_0268821
852 Ga0496120_0074381
853 Ga0496120_0248262
854 Ga0496122_0017904
855 Ga0496122_0032296
856 Ga0496122_0062828
857 Ga0496122_0584148
858 Ga0496124_0048782
859 Ga0496124_0281571
860 Ga0496125_0000894
861 Ga0496125_0005566
862 Ga0496125_0024003
863 Ga0496126_0011450
864 Ga0496126_0051147
865 Ga0496126_0072654
866 Ga0496126_0366644
867 Ga0501311_019904
868 Ga0501031_0323695
869 Ga0501031_0417286
870 Ga0501031_0521819
871 Ga0501032_0042244
872 Ga0501034_0026403
873 Ga0501034_0126993
874 Ga0501034_0332732
875 Ga0501034_0740327
876 Ga0501034_1260738
877 Ga0501034_1644322
878 Ga0501036_0232822
879 Ga0501036_1420184
880 Ga0501037_0107282
881 Ga0501037_0142897
882 Ga0501037_0529872
883 Ga0501038_0000606
884 Ga0501039_0191325
885 Ga0501039_0285503
886 Ga0501039_0981843
887 Ga0501040_0009768
888 Ga0501040_0315466
889 Ga0501040_0349127
890 Ga0501041_0082060
891 Ga0501043_0074950
892 Ga0501043_0632623
893 Ga0501046_0083071
894 Ga0501047_0013007
895 Ga0501047_0211117
896 Ga0501048_0093074
897 Ga0501048_0298700
898 Ga0501048_0677069
899 Ga0501070_0000407
900 Ga0501070_0002371
901 Ga0501070_0239160
902 Ga0501070_0265586
903 Ga0501070_1035273
904 Ga0501070_1093197
905 Ga0501071_1002006
906 Ga0501072_1386169
907 Ga0501073_0285975
908 Ga0501073_0324137
909 Ga0501074_1096149
910 Ga0501074_1189509
911 Ga0501075_1188902
912 Ga0501076_0186530
913 Ga0501076_0366474
914 Ga0501076_0621139
915 Ga0501076_1616688
916 Ga0501079_0915277
917 Ga0501079_0920284
918 Ga0501079_1574347
919 Ga0501081_0600310
920 Ga0501035_0005064
921 Ga0501035_0006739
922 Ga0501035_0028818
923 Ga0501044_0025294
924 Ga0501044_0029996
925 Ga0501045_0749832
926 nmdc:mga03683_571665_c1
927 nmdc:mga03n38_102449_c1
928 nmdc:mga03n38_26049_c1
929 nmdc:mga03n38_723976_c1
930 nmdc:mga00v17_134432_c1
931 nmdc:mga00v17_330967_c1
932 nmdc:mga00v17_49017_c1
933 nmdc:mga00v17_69318_c1
934 nmdc:mga00v17_94699_c1
935 nmdc:mga0yw44_12973_c1
936 nmdc:mga0yw44_31803_c1
937 nmdc:mga0yw44_349064_c1
938 nmdc:mga0yw44_395021_c1
939 nmdc:mga0yw44_497816_c1
940 nmdc:mga0yw44_561576_c1
941 nmdc:mga0yw44_62045_c1
942 nmdc:mga0yw44_79866_c1
943 nmdc:mga06z11_108567_c1
944 nmdc:mga06z11_770314_c1
945 nmdc:mga06z11_9356_c1
946 nmdc:mga07m45_33799_c1
947 Ga0495601_0070027
948 Ga0500635_0000198
949 Ga0495655_0001237
950 Ga0500644_0031614
951 Ga0500556_0001418
952 Ga0500593_000469
953 Ga0500620_019901
954 Ga0500620_234834
955 Ga0501084_0120927
956 Ga0501084_0621188
957 Ga0590075_163251
958 Ga0587084_094106
959 Ga0587070_051324
960 Ga0587073_0107285
961 Ga0587082_044612
962 Ga0587101_099526
963 Ga0587101_127646
964 Ga0587128_013673
965 Ga0587076_006468
966 Ga0587100_013197
967 Ga0587110_004087
968 Ga0466962_0020093
969 2643734828
970 2644031718
971 2644094053
972 2644097472
973 2644100289
974 2644116697
975 2644172988
976 2644231953
977 2644279199
978 2644323896
979 2644523660
980 2738869183
981 2740168658
982 2812331259
983 2852665870
984 2855388282
985 2884767294
986 2884998165

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00460

Flg_bb_rod

Flagella basal body rod protein

13

42

0.92

PF06429

Flg_bbr_C

Flagellar basal body rod FlgEFG protein C-terminal

92

137

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cg0-assembly1.cif.gz_p cryo-em structure of the flagellar proximal rod with flif peptides from salmonella 0.8803 4 128
7nvg-assembly1.cif.gz_V2 salmonella flagellar basal body refined in c1 map 0.8656 6 129
7cg0-assembly1.cif.gz_h cryo-em structure of the flagellar proximal rod with flif peptides from salmonella 0.8628 4 126
7bin-assembly1.cif.gz_W salmonella export gate and rod refined in focussed c1 map 0.8623 6 126
7cg0-assembly1.cif.gz_i cryo-em structure of the flagellar proximal rod with flif peptides from salmonella 0.8622 4 126
ID Description Score Start End Superfamily
af_G5EDU9_166_462_2.60.40.150 Mainly Beta;Sandwich;Immunoglobulin-like;C2 domain 0.8727 4 127 2.60.40.150
af_F1RDD6_1_124_1.10.287.1490 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7765 4 131 1.10.287.1490
af_Q642A0_14_110_1.10.287.370 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7422 3 127 1.10.287.370
af_Q9NUG6_13_110_1.10.287.370 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7398 3 127 1.10.287.370
af_C6SW11_8_117_1.10.287.370 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7278 1 127 1.10.287.370
ID Description Score Start End GO Terms
AF-A0A495N5B1-F1-model_v4 deleted 0.9863 4 130
AF-A0A4P7GJZ2-F1-model_v4 Flagellar basal-body rod protein FlgC 0.9826 4 132 GO:0009288
GO:0071978
AF-A0A7W7WZ28-F1-model_v4 Flagellar basal-body rod protein FlgC 0.9767 5 132
AF-A0A7W7WZ28-F1-model_v4 Flagellar basal-body rod protein FlgC 0.9619 5 132
AF-A0A4P7GJZ2-F1-model_v4 Flagellar basal-body rod protein FlgC 0.9605 4 132 GO:0009288
GO:0071978

Map