F454485

General Info

Members Datasets Scaffolds Average Seq Length
493 270 490 294

Family's Representative Sequence

Representative Sequence 3300048915|Ga0496112_0192145|Ga0496112_0192145_629_1696
Length 355
Sequence LVHDCVVLLWKLAKWVRGRLAARRAGSAGPEAARAVTEVGRPAVDRRTSPVDPDAVVSVRGLRKSYGGFEAVRGVDLDVQHGEVFAFLGPNGAGKTTTVEILEGYRPRNGGEVRVFGVDPAEAPRSWRDRLGVVLQDSQPESYLTVRQCLELYAGYFTAPRPIAETLELVGLADRMEAMTTELSGGQRRRLDVALALVGNPELVFLDEPTTGFDPSARRAAWEVIAGLRSLGKTIFLTTHYMDEAERLADRIAVIADGVIVAEGTPWTLGGRDRAASIISFSLPDGHSLETLPDAFRHEAQVEVSGRVTIRSERPMPALQALSAWALERRLDLADIDVHRPTLEDVYLSLIGQPS

Samples

Sample ID Description Type Environment
1 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
2 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
3 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
50 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
131 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
132 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
133 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
134 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
135 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
136 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
137 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
138 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
139 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
140 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
141 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
142 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
143 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
144 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
145 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
146 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
147 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
148 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
150 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
151 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
152 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
153 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
154 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
155 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
156 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
157 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
158 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
159 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
160 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
161 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
162 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
163 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
164 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
165 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
166 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
167 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
168 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
169 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
170 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
171 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
172 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
173 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
174 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
175 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
176 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
177 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
178 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
179 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
180 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
181 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
182 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
183 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
184 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
185 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
186 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
187 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
188 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
189 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
190 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
191 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
192 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
193 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
194 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
195 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
196 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
197 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
198 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
199 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
200 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
201 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
202 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
203 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
204 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
205 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
206 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
207 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
208 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
209 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
210 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
211 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
212 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
213 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
214 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
215 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
216 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
217 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
218 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
219 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
220 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
221 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
222 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
238 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
239 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
240 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
241 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
242 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
243 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
244 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
245 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
246 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
247 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
248 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
249 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
250 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
251 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
254 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
255 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
256 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
257 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
258 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
259 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
260 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
261 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
262 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
263 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
264 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
265 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
266 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
267 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
268 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
269 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
270 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.19
Metatranscriptomes 0.2
Isolates 0.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.61
Nodule 0
Rhizoplane 12.78
Rhizosphere 85.19
Stem 0
Stem Tuber 0
Unclassified 1.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25404J52841_10001178 3300003659 Bacteria 4464
2 Ga0070683_100013919 3300005329 Bacteria 7027
3 Ga0070683_100043328 3300005329 Bacteria 4148
4 Ga0070683_100103216 3300005329 Bacteria 2686
5 Ga0070677_10000004 3300005333 Bacteria 81101
6 Ga0070680_100056117 3300005336 Bacteria 3219
7 Ga0070682_100000013 3300005337 Bacteria 254641
8 Ga0068868_100000285 3300005338 Bacteria 33993
9 Ga0070689_100250616 3300005340 Bacteria 1461
10 Ga0070691_10013209 3300005341 Bacteria 3784
11 Ga0070661_100000023 3300005344 Bacteria 123104
12 Ga0070675_100000101 3300005354 Bacteria 50140
13 Ga0070674_100000008 3300005356 Bacteria 143844
14 Ga0070674_100000029 3300005356 Bacteria 69489
15 Ga0070673_100005926 3300005364 Bacteria 7897
16 Ga0070703_10020521 3300005406 Bacteria 1923
17 Ga0070714_100019159 3300005435 Bacteria 5570
18 Ga0070714_100074136 3300005435 Bacteria 2950
19 Ga0070713_100000009 3300005436 Bacteria 153056
20 Ga0070713_100247322 3300005436 Bacteria 1625
21 Ga0070713_100471207 3300005436 Bacteria 1182
22 Ga0070701_10063552 3300005438 Bacteria 1953
23 Ga0070711_100003340 3300005439 Bacteria 9338
24 Ga0070700_100109911 3300005441 Bacteria 1831
25 Ga0070708_100011753 3300005445 Bacteria 7123
26 Ga0070708_100059392 3300005445 Archaea 3409
27 Ga0070663_100003079 3300005455 Bacteria 9535
28 Ga0070678_100002401 3300005456 Bacteria 10255
29 Ga0070662_100000004 3300005457 Bacteria 195534
30 Ga0070681_10008992 3300005458 Bacteria 9822
31 Ga0070681_10151849 3300005458 Bacteria 2242
32 Ga0070707_100000019 3300005468 Bacteria 132161
33 Ga0070707_100053678 3300005468 Archaea 3864
34 Ga0070707_100404541 3300005468 Unclassified 1325
35 Ga0070699_100004955 3300005518 Archaea 11743
36 Ga0070699_100251724 3300005518 Bacteria 1578
37 Ga0070679_100001522 3300005530 Bacteria 20653
38 Ga0070679_100082234 3300005530 Bacteria 3210
39 Ga0070684_100025299 3300005535 Bacteria 4988
40 Ga0070684_100042362 3300005535 Bacteria 3929
41 Ga0070684_100111966 3300005535 Bacteria 2448
42 Ga0070697_100003630 3300005536 Bacteria 11853
43 Ga0070697_100011615 3300005536 Bacteria 6884
44 Ga0068853_100103929 3300005539 Bacteria 2514
45 Ga0070665_100000106 3300005548 Bacteria 157315
46 Ga0070704_100142480 3300005549 Bacteria 1873
47 Ga0068855_100061658 3300005563 Bacteria 4381
48 Ga0068857_100215924 3300005577 Bacteria 1751
49 Ga0068854_100000114 3300005578 Bacteria 55089
50 Ga0068854_100030249 3300005578 Bacteria 3756
51 Ga0068856_100000577 3300005614 Bacteria 40018
52 Ga0068856_100267644 3300005614 Bacteria 1725
53 Ga0068852_100000184 3300005616 Bacteria 42515
54 Ga0068852_100039119 3300005616 Bacteria 3991
55 Ga0068852_100133781 3300005616 Bacteria 2287
56 Ga0068859_100009154 3300005617 Bacteria 10001
57 Ga0068864_100000045 3300005618 Bacteria 154739
58 Ga0068866_10000001 3300005718 Bacteria 519680
59 Ga0068866_10000031 3300005718 Bacteria 56943
60 Ga0068866_10134243 3300005718 Bacteria 1412
61 Ga0068861_100190574 3300005719 Bacteria 1714
62 Ga0068851_10136390 3300005834 Bacteria 1331
63 Ga0068858_100099843 3300005842 Bacteria 2707
64 Ga0068860_100022494 3300005843 Bacteria 6097
65 Ga0068860_100638755 3300005843 Bacteria 1072
66 Ga0068862_100016408 3300005844 Bacteria 6163
67 Ga0081455_10002158 3300005937 Bacteria 23486
68 Ga0081455_10045334 3300005937 Bacteria 3826
69 Ga0081455_10122181 3300005937 Bacteria 2050
70 Ga0081538_10029740 3300005981 Bacteria 3725
71 Ga0081538_10089907 3300005981 Bacteria 1592
72 Ga0081538_10144826 3300005981 Bacteria 1088
73 Ga0081540_1000139 3300005983 Bacteria 76578
74 Ga0081540_1000392 3300005983 Bacteria 43576
75 Ga0081539_10000791 3300005985 Bacteria 61600
76 Ga0081539_10002283 3300005985 Bacteria 27787
77 Ga0081539_10002976 3300005985 Bacteria 22226
78 Ga0070715_10000001 3300006163 Bacteria 693690
79 Ga0070716_100289077 3300006173 Bacteria 1135
80 Ga0075434_100311289 3300006871 Bacteria 1595
81 Ga0068865_100000160 3300006881 Bacteria 36781
82 Ga0075436_100002125 3300006914 Bacteria 13667
83 Ga0097620_100009154 3300006931 Bacteria 10001
84 Ga0075435_100002843 3300007076 Bacteria 11586
85 Ga0099794_10006908 3300007265 Archaea 4628
86 Ga0105240_10543539 3300009093 Bacteria 1286
87 Ga0111539_11085785 3300009094 Bacteria 930
88 Ga0105245_10008155 3300009098 Bacteria 9161
89 Ga0105247_10000393 3300009101 Bacteria 37140
90 Ga0105243_10146104 3300009148 Bacteria 2023
91 Ga0105241_10121290 3300009174 Bacteria 2105
92 Ga0105242_10000893 3300009176 Bacteria 23179
93 Ga0105242_10046076 3300009176 Bacteria 3537
94 Ga0105248_10000249 3300009177 Bacteria 62662
95 Ga0105248_10020610 3300009177 Bacteria 7306
96 Ga0105248_10530594 3300009177 Bacteria 1327
97 Ga0105238_10000011 3300009551 Bacteria 261080
98 Ga0105238_10136363 3300009551 Bacteria 2432
99 Ga0105249_10026806 3300009553 Bacteria 5197
100 Ga0105249_10306849 3300009553 Bacteria 1594
101 Ga0105249_10538302 3300009553 Bacteria 1217
102 Ga0105239_10076029 3300010375 Bacteria 3693
103 Ga0105239_10104990 3300010375 Bacteria 3128
104 Ga0157371_10002351 3300013102 Bacteria 18095
105 Ga0157370_10024759 3300013104 Bacteria 5943
106 Ga0157369_10016377 3300013105 Bacteria 8340
107 Ga0157374_10034846 3300013296 Bacteria 4602
108 Ga0157378_10031324 3300013297 Bacteria 4699
109 Ga0157378_10092729 3300013297 Bacteria 2748
110 Ga0157372_10000129 3300013307 Bacteria 82491
111 Ga0157372_10046424 3300013307 Bacteria 4822
112 Ga0157375_10000112 3300013308 Bacteria 79146
113 Ga0157375_10469068 3300013308 Bacteria 1424
114 Ga0157380_10000093 3300014326 Bacteria 48915
115 Ga0157380_10000408 3300014326 Bacteria 26076
116 Ga0157380_10141471 3300014326 Bacteria 2068
117 Ga0157379_10001717 3300014968 Bacteria 18137
118 Ga0157379_10044467 3300014968 Bacteria 3965
119 Ga0157379_10275441 3300014968 Bacteria 1531
120 Ga0163161_10167243 3300017792 Bacteria 1680
121 Ga0206353_10089411 3300020082 Bacteria 2756
122 Ga0207656_10096329 3300025321 Bacteria 1351
123 Ga0207682_10000031 3300025893 Bacteria 57806
124 Ga0207642_10000002 3300025899 Bacteria 658166
125 Ga0207642_10000919 3300025899 Bacteria 9217
126 Ga0207710_10000195 3300025900 Bacteria 57216
127 Ga0207685_10000036 3300025905 Bacteria 65666
128 Ga0207643_10137897 3300025908 Bacteria 1455
129 Ga0207707_10013823 3300025912 Bacteria 7038
130 Ga0207707_10016625 3300025912 Bacteria 6414
131 Ga0207707_10112429 3300025912 Bacteria 2381
132 Ga0207695_10100322 3300025913 Bacteria 2891
133 Ga0207663_10143876 3300025916 Bacteria 1664
134 Ga0207649_10000063 3300025920 Bacteria 96360
135 Ga0207652_10000349 3300025921 Bacteria 47896
136 Ga0207652_10043823 3300025921 Bacteria 3811
137 Ga0207652_10056664 3300025921 Bacteria 3374
138 Ga0207646_10000001 3300025922 Bacteria 1242027
139 Ga0207646_10000006 3300025922 Bacteria 510716
140 Ga0207646_10010529 3300025922 Archaea 9026
141 Ga0207646_10172851 3300025922 Bacteria 1951
142 Ga0207646_10308907 3300025922 Unclassified 1429
143 Ga0207646_10354406 3300025922 Unclassified 1326
144 Ga0207681_10177338 3300025923 Bacteria 1620
145 Ga0207694_10000004 3300025924 Bacteria 967075
146 Ga0207694_10049610 3300025924 Bacteria 3249
147 Ga0207659_10000010 3300025926 Bacteria 286639
148 Ga0207687_10000018 3300025927 Bacteria 236159
149 Ga0207687_10000177 3300025927 Bacteria 42164
150 Ga0207687_10004028 3300025927 Bacteria 9845
151 Ga0207687_10010603 3300025927 Bacteria 6023
152 Ga0207700_10000025 3300025928 Bacteria 147429
153 Ga0207700_10048817 3300025928 Bacteria 3145
154 Ga0207664_10048957 3300025929 Bacteria 3326
155 Ga0207706_10000012 3300025933 Bacteria 195475
156 Ga0207686_10023096 3300025934 Bacteria 3588
157 Ga0207686_10265341 3300025934 Bacteria 1261
158 Ga0207709_10096394 3300025935 Bacteria 1946
159 Ga0207670_10167372 3300025936 Bacteria 1645
160 Ga0207669_10000004 3300025937 Bacteria 196828
161 Ga0207669_10000012 3300025937 Bacteria 138242
162 Ga0207704_10000236 3300025938 Bacteria 27317
163 Ga0207704_10449357 3300025938 Bacteria 1028
164 Ga0207665_10291061 3300025939 Bacteria 1218
165 Ga0207711_10000020 3300025941 Bacteria 363325
166 Ga0207711_10044815 3300025941 Bacteria 3778
167 Ga0207711_10373744 3300025941 Bacteria 1322
168 Ga0207661_10000095 3300025944 Bacteria 56458
169 Ga0207661_10070678 3300025944 Bacteria 2850
170 Ga0207661_10074244 3300025944 Bacteria 2787
171 Ga0207667_10062752 3300025949 Bacteria 3884
172 Ga0207651_10000460 3300025960 Bacteria 17106
173 Ga0207712_10000007 3300025961 Bacteria 539589
174 Ga0207712_10037840 3300025961 Bacteria 3295
175 Ga0207668_10144035 3300025972 Bacteria 1836
176 Ga0207640_10000015 3300025981 Bacteria 215411
177 Ga0207640_10028740 3300025981 Bacteria 3404
178 Ga0207640_10137065 3300025981 Bacteria 1778
179 Ga0207677_10000331 3300026023 Bacteria 34043
180 Ga0207703_10000040 3300026035 Bacteria 168191
181 Ga0207703_10081201 3300026035 Bacteria 2702
182 Ga0207703_10117759 3300026035 Bacteria 2276
183 Ga0207639_10007405 3300026041 Bacteria 7482
184 Ga0207678_10007745 3300026067 Bacteria 9489
185 Ga0207708_10131923 3300026075 Bacteria 1954
186 Ga0207708_10203293 3300026075 Bacteria 1581
187 Ga0207702_10000060 3300026078 Bacteria 125473
188 Ga0207702_10003607 3300026078 Bacteria 14060
189 Ga0207702_10244217 3300026078 Bacteria 1683
190 Ga0207702_10256597 3300026078 Bacteria 1644
191 Ga0207641_10025406 3300026088 Bacteria 4884
192 Ga0207648_10081248 3300026089 Bacteria 2827
193 Ga0207676_10000016 3300026095 Bacteria 311561
194 Ga0207676_10122445 3300026095 Bacteria 2196
195 Ga0207674_10028955 3300026116 Bacteria 5838
196 Ga0207674_10099830 3300026116 Bacteria 2885
197 Ga0207675_100218471 3300026118 Bacteria 1836
198 Ga0207675_100509528 3300026118 Bacteria 1199
199 Ga0207683_10003745 3300026121 Bacteria 13186
200 Ga0207683_10127556 3300026121 Bacteria 2287
201 Ga0207698_10000012 3300026142 Bacteria 260061
202 Ga0207698_10031252 3300026142 Bacteria 3841
203 Ga0207698_10070948 3300026142 Bacteria 2762
204 Ga0209588_1000724 3300027671 Bacteria 8330
205 Ga0209588_1002617 3300027671 Bacteria 4899
206 Ga0268265_10072570 3300028380 Bacteria 2685
207 Ga0268264_10031067 3300028381 Bacteria 4379
208 Ga0265337_1000231 3300028556 Bacteria 30088
209 Ga0265326_10000007 3300028558 Bacteria 223057
210 Ga0265319_1000025 3300028563 Bacteria 142639
211 Ga0265322_10000001 3300028654 Bacteria 543854
212 Ga0265336_10009094 3300028666 Bacteria 3448
213 Ga0265338_10000473 3300028800 Bacteria 71777
214 Ga0265338_10000764 3300028800 Bacteria 54866
215 Ga0265338_10325401 3300028800 Bacteria 1112
216 Ga0265324_10001009 3300029957 Bacteria 17266
217 Ga0265328_10009838 3300031239 Bacteria 3872
218 Ga0265320_10000002 3300031240 Bacteria 542875
219 Ga0265325_10001007 3300031241 Bacteria 20278
220 Ga0265329_10006540 3300031242 Bacteria 4613
221 Ga0265339_10000855 3300031249 Bacteria 23413
222 Ga0265339_10119610 3300031249 Bacteria 1355
223 Ga0265331_10016502 3300031250 Bacteria 3875
224 Ga0265327_10000011 3300031251 Bacteria 543807
225 Ga0265316_10037070 3300031344 Bacteria 3940
226 Ga0265313_10001275 3300031595 Bacteria 23871
227 Ga0265314_10000062 3300031711 Bacteria 159496
228 Ga0265314_10011335 3300031711 Bacteria 7368
229 Ga0307409_100030889 3300031995 Bacteria 3857
230 Ga0373937_0064484 3300036401 Bacteria 3370
231 Ga0373937_0539446 3300036401 Bacteria 1108
232 Ga0395899_0198897 3300037312 Bacteria 1399
233 Ga0395900_0254734 3300037418 Bacteria 1755
234 Ga0395898_0071994 3300037466 Bacteria 3340
235 Ga0395898_0262701 3300037466 Bacteria 1647
236 Ga0436364_0955823 3300037853 Bacteria 15001
237 Ga0395901_0022836 3300038443 Bacteria 6414
238 Ga0395901_0398136 3300038443 Bacteria 1415
239 Ga0439434_0025262 3300042435 Bacteria 1792
240 Ga0466966_0063617 3300044684 Bacteria 2324
241 Ga0466966_0082841 3300044684 Bacteria 1996
242 Ga0466963_0000001 3300044694 Bacteria 110556
243 Ga0466963_0000739 3300044694 Bacteria 16098
244 Ga0466971_0024517 3300044719 Bacteria 2691
245 Ga0466957_0015669 3300044842 Bacteria 4428
246 Ga0466957_0078135 3300044842 Bacteria 2057
247 Ga0466960_0069729 3300044901 Bacteria 1747
248 Ga0466958_0050321 3300045836 Bacteria 2523
249 Ga0466967_0000065 3300045976 Bacteria 39018
250 Ga0466967_0008096 3300045976 Bacteria 7666
251 Ga0466967_0251359 3300045976 Bacteria 1689
252 Ga0466967_0436365 3300045976 Bacteria 1278
253 Ga0466967_0437856 3300045976 Bacteria 1276
254 Ga0495592_0000036 3300046454 Bacteria 125461
255 Ga0495592_0177405 3300046454 Bacteria 1454
256 Ga0495603_0000030 3300046455 Bacteria 60760
257 Ga0495603_0006771 3300046455 Bacteria 6875
258 Ga0495629_0000272 3300046459 Bacteria 44883
259 Ga0495629_0043316 3300046459 Bacteria 3160
260 Ga0495638_0079564 3300046460 Bacteria 1993
261 Ga0495641_0000044 3300046461 Bacteria 77415
262 Ga0495582_0000011 3300046473 Bacteria 113352
263 Ga0495662_0000458 3300046476 Bacteria 18383
264 Ga0495662_0006939 3300046476 Bacteria 5628
265 Ga0495594_0000003 3300046499 Bacteria 199267
266 Ga0495608_0000068 3300046511 Bacteria 79694
267 Ga0495608_0001071 3300046511 Bacteria 19292
268 Ga0495608_0009335 3300046511 Bacteria 6859
269 Ga0495608_0062435 3300046511 Bacteria 2448
270 Ga0495618_0000594 3300046514 Bacteria 25841
271 Ga0495620_0000144 3300046515 Bacteria 58204
272 Ga0495620_0082178 3300046515 Bacteria 1302
273 Ga0495628_0001219 3300046516 Bacteria 23555
274 Ga0495628_0002850 3300046516 Bacteria 15497
275 Ga0495628_0040965 3300046516 Bacteria 3698
276 Ga0495630_0000056 3300046517 Bacteria 91477
277 Ga0495630_0000408 3300046517 Bacteria 33471
278 Ga0495630_0000541 3300046517 Bacteria 27642
279 Ga0495644_0000642 3300046523 Bacteria 14607
280 Ga0495652_0000019 3300046529 Bacteria 190248
281 Ga0495587_0002971 3300046536 Bacteria 11337
282 Ga0495587_0043155 3300046536 Bacteria 2687
283 Ga0495645_0019069 3300046543 Bacteria 4938
284 Ga0495622_0000180 3300046557 Bacteria 51095
285 Ga0495633_0042722 3300046558 Bacteria 2152
286 Ga0495667_0000032 3300046559 Bacteria 143493
287 Ga0495634_0000247 3300046642 Bacteria 50931
288 Ga0495634_0024941 3300046642 Bacteria 4191
289 Ga0495625_0000696 3300046660 Bacteria 47763
290 Ga0495635_0000016 3300046663 Bacteria 214088
291 Ga0495588_0000165 3300046674 Bacteria 85841
292 Ga0495657_0000004 3300046675 Bacteria 266465
293 Ga0495657_0041818 3300046675 Bacteria 3134
294 Ga0495657_0085327 3300046675 Bacteria 2035
295 Ga0495623_0216623 3300046679 Bacteria 1093
296 Ga0495647_0000008 3300046681 Bacteria 101193
297 Ga0495658_0000005 3300046683 Bacteria 149839
298 Ga0495658_0019458 3300046683 Bacteria 3544
299 Ga0495613_0000113 3300046689 Bacteria 79559
300 Ga0495613_0000203 3300046689 Bacteria 58232
301 Ga0495624_0000008 3300046690 Bacteria 145035
302 Ga0495624_0009779 3300046690 Bacteria 6636
303 Ga0495649_0000554 3300046694 Bacteria 31688
304 Ga0495600_0000787 3300046809 Bacteria 16744
305 Ga0495600_0030738 3300046809 Bacteria 3478
306 Ga0495604_0000019 3300047317 Bacteria 175064
307 Ga0495604_0030624 3300047317 Bacteria 4272
308 Ga0495676_0000299 3300047321 Bacteria 40098
309 Ga0495676_0002794 3300047321 Bacteria 15713
310 Ga0495676_0042134 3300047321 Bacteria 3751
311 Ga0495680_0003366 3300047322 Bacteria 15791
312 Ga0495680_0007700 3300047322 Bacteria 9831
313 Ga0495675_0000107 3300047444 Bacteria 59970
314 Ga0495675_0051399 3300047444 Bacteria 2617
315 Ga0495685_022930 3300047447 Bacteria 2148
316 Ga0495684_0084544 3300047471 Bacteria 2407
317 Ga0495602_0000208 3300048088 Bacteria 54818
318 Ga0495602_0000497 3300048088 Bacteria 36490
319 Ga0496100_0000002 3300048903 Bacteria 489057
320 Ga0496100_0000018 3300048903 Bacteria 162451
321 Ga0496100_0388084 3300048903 Bacteria 1061
322 Ga0496101_0000001 3300048904 Bacteria 489057
323 Ga0496101_0000062 3300048904 Bacteria 126595
324 Ga0496101_0018529 3300048904 Bacteria 4736
325 Ga0496101_0285093 3300048904 Bacteria 1291
326 Ga0496102_0000039 3300048905 Bacteria 198306
327 Ga0496102_0036045 3300048905 Bacteria 4455
328 Ga0496102_0056328 3300048905 Bacteria 3586
329 Ga0496103_0000008 3300048906 Bacteria 340474
330 Ga0496103_0049895 3300048906 Bacteria 2588
331 Ga0496104_0000009 3300048907 Bacteria 488055
332 Ga0496104_0000129 3300048907 Bacteria 69982
333 Ga0496104_0007265 3300048907 Bacteria 9776
334 Ga0496104_0141265 3300048907 Bacteria 2313
335 Ga0496104_0301916 3300048907 Bacteria 1513
336 Ga0496105_0000001 3300048908 Bacteria 1328178
337 Ga0496105_0000007 3300048908 Bacteria 339658
338 Ga0496105_0000846 3300048908 Bacteria 20846
339 Ga0496105_0074027 3300048908 Bacteria 2814
340 Ga0496105_0308836 3300048908 Bacteria 1270
341 Ga0496106_0000061 3300048909 Bacteria 86524
342 Ga0496106_0000081 3300048909 Bacteria 76468
343 Ga0496106_0000145 3300048909 Bacteria 52447
344 Ga0496106_0042207 3300048909 Bacteria 3420
345 Ga0496107_0000006 3300048910 Bacteria 258746
346 Ga0496107_0000013 3300048910 Bacteria 178284
347 Ga0496108_0000001 3300048911 Bacteria 919044
348 Ga0496108_0001921 3300048911 Bacteria 16645
349 Ga0496108_0040100 3300048911 Bacteria 3902
350 Ga0496108_0219360 3300048911 Bacteria 1652
351 Ga0496108_0299991 3300048911 Bacteria 1399
352 Ga0496109_0000003 3300048912 Bacteria 420862
353 Ga0496109_0000129 3300048912 Bacteria 77469
354 Ga0496109_0000168 3300048912 Bacteria 64462
355 Ga0496109_0002305 3300048912 Bacteria 15886
356 Ga0496109_0013512 3300048912 Bacteria 7085
357 Ga0496109_0155719 3300048912 Bacteria 2140
358 Ga0496110_0000062 3300048913 Bacteria 53333
359 Ga0496110_0007132 3300048913 Bacteria 8897
360 Ga0496110_0096386 3300048913 Bacteria 2651
361 Ga0496110_0272069 3300048913 Bacteria 1542
362 Ga0496111_0000010 3300048914 Bacteria 92600
363 Ga0496111_0019285 3300048914 Bacteria 4735
364 Ga0496112_0000003 3300048915 Bacteria 660147
365 Ga0496112_0001122 3300048915 Bacteria 19906
366 Ga0496112_0008237 3300048915 Bacteria 9326
367 Ga0496112_0026696 3300048915 Bacteria 5563
368 Ga0496112_0192145 3300048915 Bacteria 2003
369 Ga0496113_0000014 3300048916 Bacteria 79850
370 Ga0496113_0004352 3300048916 Bacteria 8681
371 Ga0496113_0030382 3300048916 Bacteria 3911
372 Ga0496113_0100520 3300048916 Bacteria 2241
373 Ga0496114_0000014 3300048917 Bacteria 297902
374 Ga0496114_0080517 3300048917 Bacteria 2751
375 Ga0496114_0222822 3300048917 Bacteria 1656
376 Ga0496114_0460344 3300048917 Bacteria 1126
377 Ga0496115_0000003 3300048918 Bacteria 354994
378 Ga0496115_0000125 3300048918 Bacteria 69936
379 Ga0496115_0000278 3300048918 Bacteria 44969
380 Ga0496115_0012965 3300048918 Bacteria 6288
381 Ga0496115_0549403 3300048918 Bacteria 923
382 Ga0496116_0000680 3300048919 Bacteria 44185
383 Ga0496118_0179807 3300048921 Bacteria 1279
384 Ga0496119_0001947 3300048922 Bacteria 23515
385 Ga0496124_0289424 3300048927 Bacteria 1190
386 Ga0496126_0035687 3300048929 Bacteria 4657
387 Ga0501031_0000822 3300049568 Bacteria 18682
388 Ga0501032_0004405 3300049569 Bacteria 10630
389 Ga0501033_0000862 3300049570 Bacteria 27744
390 Ga0501034_0077206 3300049571 Bacteria 3336
391 Ga0501036_0000938 3300049572 Bacteria 21916
392 Ga0501036_0198485 3300049572 Bacteria 1688
393 Ga0501037_0003441 3300049573 Bacteria 11505
394 Ga0501038_0000933 3300049574 Bacteria 26040
395 Ga0501038_0028459 3300049574 Bacteria 4965
396 Ga0501039_0003186 3300049575 Bacteria 12272
397 Ga0501040_0003033 3300049576 Bacteria 10888
398 Ga0501040_0067954 3300049576 Bacteria 2457
399 Ga0501041_0001177 3300049577 Bacteria 14243
400 Ga0501041_0250291 3300049577 Bacteria 1114
401 Ga0501041_0267738 3300049577 Bacteria 1075
402 Ga0501042_0000761 3300049578 Bacteria 17537
403 Ga0501042_0017127 3300049578 Bacteria 4993
404 Ga0501042_0100091 3300049578 Bacteria 2084
405 Ga0501042_0126448 3300049578 Bacteria 1841
406 Ga0501043_0002346 3300049579 Bacteria 16049
407 Ga0501043_0201227 3300049579 Bacteria 1546
408 Ga0501046_0008844 3300049580 Bacteria 8746
409 Ga0501046_0042414 3300049580 Bacteria 3628
410 Ga0501046_0123105 3300049580 Bacteria 1972
411 Ga0501047_0000244 3300049581 Bacteria 64596
412 Ga0501047_0064173 3300049581 Bacteria 3542
413 Ga0501047_0111335 3300049581 Bacteria 2620
414 Ga0501048_0000223 3300049582 Bacteria 37247
415 Ga0501048_0117158 3300049582 Bacteria 1881
416 Ga0501048_0184093 3300049582 Bacteria 1481
417 Ga0501067_0029461 3300049583 Bacteria 3042
418 Ga0501067_0040207 3300049583 Bacteria 2597
419 Ga0501067_0104916 3300049583 Bacteria 1570
420 Ga0501068_0000806 3300049584 Bacteria 16281
421 Ga0501068_0026835 3300049584 Bacteria 3397
422 Ga0501068_0037089 3300049584 Bacteria 2918
423 Ga0501069_0000303 3300049585 Bacteria 22395
424 Ga0501069_0000775 3300049585 Bacteria 14978
425 Ga0501069_0063788 3300049585 Bacteria 2058
426 Ga0501069_0153265 3300049585 Bacteria 1325
427 Ga0501070_0004059 3300049586 Bacteria 12581
428 Ga0501070_0028555 3300049586 Bacteria 4679
429 Ga0501070_0304401 3300049586 Bacteria 1298
430 Ga0501071_0000001 3300049587 Bacteria 123952
431 Ga0501071_0021501 3300049587 Bacteria 4494
432 Ga0501071_0087841 3300049587 Bacteria 2281
433 Ga0501072_0000550 3300049588 Bacteria 26960
434 Ga0501072_0154891 3300049588 Bacteria 1827
435 Ga0501074_0001650 3300049590 Bacteria 15137
436 Ga0501074_0103587 3300049590 Bacteria 2037
437 Ga0501074_0152410 3300049590 Bacteria 1652
438 Ga0501075_0001018 3300049591 Bacteria 17943
439 Ga0501075_0001259 3300049591 Bacteria 16393
440 Ga0501075_0031578 3300049591 Bacteria 3932
441 Ga0501075_0049579 3300049591 Bacteria 3156
442 Ga0501075_0317504 3300049591 Bacteria 1187
443 Ga0501076_0000523 3300049592 Bacteria 24385
444 Ga0501076_0045432 3300049592 Bacteria 3468
445 Ga0501076_0054888 3300049592 Bacteria 3158
446 Ga0501077_0000028 3300049593 Bacteria 74757
447 Ga0501079_0000387 3300049741 Bacteria 28343
448 Ga0501079_0158491 3300049741 Bacteria 1764
449 Ga0501080_0001311 3300049742 Bacteria 20737
450 Ga0501080_0071423 3300049742 Bacteria 3229
451 Ga0501081_0000043 3300049743 Bacteria 47758
452 Ga0501081_0060551 3300049743 Bacteria 2623
453 Ga0501081_0089150 3300049743 Bacteria 2168
454 Ga0501083_0000412 3300049744 Bacteria 27299
455 Ga0501083_0090765 3300049744 Bacteria 2018
456 Ga0501083_0098999 3300049744 Bacteria 1923
457 Ga0501083_0390346 3300049744 Bacteria 905
458 Ga0501035_0001272 3300049822 Bacteria 26065
459 Ga0501044_0380074 3300049823 Bacteria 1327
460 Ga0501045_0007778 3300049824 Bacteria 7454
461 Ga0501045_0025998 3300049824 Bacteria 4209
462 Ga0501045_0419990 3300049824 Bacteria 995
463 nmdc:mga05p37_65799_c1 3300050507 Bacteria 4460
464 nmdc:mga08y16_446432_c1 3300050511 Bacteria 1319
465 nmdc:mga0n895_424927_c1 3300050512 Bacteria 1343
466 nmdc:mga0rr50_369481_c1 3300050513 Bacteria 1208
467 nmdc:mga0rr50_4219_c1 3300050513 Bacteria 8403
468 nmdc:mga08x19_158854_c1 3300050514 Bacteria 1534
469 nmdc:mga08x19_97794_c1 3300050514 Bacteria 1944
470 nmdc:mga0a205_24_c2 3300050515 Bacteria 81894
471 nmdc:mga0a205_554492_c1 3300050515 Bacteria 1004
472 Ga0495601_0000013 3300053077 Bacteria 226476
473 Ga0495601_0000326 3300053077 Bacteria 25282
474 Ga0495612_0009748 3300053078 Bacteria 3890
475 Ga0495655_0000001 3300053083 Bacteria 419518
476 Ga0495655_0006554 3300053083 Bacteria 2121
477 Ga0495595_0000003 3300053084 Bacteria 266465
478 Ga0495595_0000172 3300053084 Bacteria 25608
479 Ga0495595_0010201 3300053084 Bacteria 3901
480 Ga0495619_0000031 3300053085 Bacteria 145508
481 Ga0495619_0000106 3300053085 Bacteria 62413
482 Ga0495619_0019190 3300053085 Bacteria 4345
483 Ga0500566_0136933 3300053094 Bacteria 1303
484 Ga0500614_000324 3300053123 Bacteria 12378
485 Ga0500628_000010 3300053129 Bacteria 122210
486 Ga0501084_0000118 3300054114 Bacteria 60290
487 Ga0501084_0018321 3300054114 Bacteria 5830
488 Ga0501082_0000720 3300060353 Bacteria 29137
489 Ga0501082_0236309 3300060353 Bacteria 1590
490 Ga0530510_0000507 3300061734 Bacteria 24742

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025908 Ga0207643_10137897 Ga0207643_101378971 237
2 3300026121 Ga0207683_10127556 Ga0207683_101275564 257
3 3300050513 nmdc:mga0rr50_369481_c1 nmdc:mga0rr50_369481_c1_307_1170 262
4 3300014326 Ga0157380_10141471 Ga0157380_101414712 263
5 3300005718 Ga0068866_10134243 Ga0068866_101342432 264
6 3300005983 Ga0081540_1000392 Ga0081540_100039229 264
7 3300031995 Ga0307409_100030889 Ga0307409_1000308893 264
8 3300044684 Ga0466966_0082841 Ga0466966_0082841_158_1081 264
9 3300005333 Ga0070677_10000004 Ga0070677_1000000421 265
10 3300025893 Ga0207682_10000031 Ga0207682_1000003146 265
11 3300005937 Ga0081455_10002158 Ga0081455_1000215819 268
12 3300005406 Ga0070703_10020521 Ga0070703_100205212 269
13 3300005438 Ga0070701_10063552 Ga0070701_100635522 269
14 3300005549 Ga0070704_100142480 Ga0070704_1001424802 269
15 3300005578 Ga0068854_100030249 Ga0068854_1000302493 269
16 3300005617 Ga0068859_100009154 Ga0068859_1000091544 269
17 3300005719 Ga0068861_100190574 Ga0068861_1001905742 269
18 3300005844 Ga0068862_100016408 Ga0068862_1000164084 269
19 3300006931 Ga0097620_100009154 Ga0097620_1000091544 269
20 3300009177 Ga0105248_10020610 Ga0105248_100206102 269
21 3300009553 Ga0105249_10026806 Ga0105249_100268064 269
22 3300014968 Ga0157379_10001717 Ga0157379_100017173 269
23 3300017792 Ga0163161_10167243 Ga0163161_101672432 269
24 3300025923 Ga0207681_10177338 Ga0207681_101773382 269
25 3300025941 Ga0207711_10044815 Ga0207711_100448153 269
26 3300025961 Ga0207712_10037840 Ga0207712_100378405 269
27 3300025981 Ga0207640_10028740 Ga0207640_100287403 269
28 3300026035 Ga0207703_10081201 Ga0207703_100812012 269
29 3300026075 Ga0207708_10203293 Ga0207708_102032932 269
30 3300026095 Ga0207676_10122445 Ga0207676_101224452 269
31 3300026116 Ga0207674_10028955 Ga0207674_100289555 269
32 3300026118 Ga0207675_100218471 Ga0207675_1002184712 269
33 3300028380 Ga0268265_10072570 Ga0268265_100725702 269
34 3300045976 Ga0466967_0251359 Ga0466967_0251359_690_1544 269
35 3300045976 Ga0466967_0437856 Ga0466967_0437856_30_896 269
36 3300046515 Ga0495620_0000144 Ga0495620_0000144_42574_43467 269
37 3300046516 Ga0495628_0001219 Ga0495628_0001219_10887_11735 269
38 3300048088 Ga0495602_0000497 Ga0495602_0000497_16255_17103 269
39 3300048903 Ga0496100_0000002 Ga0496100_0000002_275969_276862 269
40 3300048904 Ga0496101_0000001 Ga0496101_0000001_275969_276862 269
41 3300048907 Ga0496104_0000009 Ga0496104_0000009_149713_150606 269
42 3300048908 Ga0496105_0000007 Ga0496105_0000007_337450_338343 269
43 3300048909 Ga0496106_0000061 Ga0496106_0000061_74380_75273 269
44 3300048910 Ga0496107_0000013 Ga0496107_0000013_103013_103906 269
45 3300048911 Ga0496108_0000001 Ga0496108_0000001_564370_565263 269
46 3300048912 Ga0496109_0000003 Ga0496109_0000003_238916_239809 269
47 3300050515 nmdc:mga0a205_554492_c1 nmdc:mga0a205_554492_c1_76_966 269
48 3300044719 Ga0466971_0024517 Ga0466971_0024517_489_1385 270
49 3300045976 Ga0466967_0436365 Ga0466967_0436365_106_975 270
50 3300046476 Ga0495662_0006939 Ga0495662_0006939_4006_4827 270
51 3300046559 Ga0495667_0000032 Ga0495667_0000032_20123_20998 270
52 3300047322 Ga0495680_0003366 Ga0495680_0003366_796_1671 270
53 3300005341 Ga0070691_10013209 Ga0070691_100132093 271
54 3300005356 Ga0070674_100000008 Ga0070674_10000000838 271
55 3300005445 Ga0070708_100011753 Ga0070708_1000117538 271
56 3300005445 Ga0070708_100059392 Ga0070708_1000593922 271
57 3300005468 Ga0070707_100000019 Ga0070707_100000019128 271
58 3300005468 Ga0070707_100053678 Ga0070707_1000536783 271
59 3300005468 Ga0070707_100404541 Ga0070707_1004045412 271
60 3300005518 Ga0070699_100004955 Ga0070699_1000049552 271
61 3300005518 Ga0070699_100251724 Ga0070699_1002517242 271
62 3300005536 Ga0070697_100003630 Ga0070697_10000363012 271
63 3300005536 Ga0070697_100011615 Ga0070697_1000116154 271
64 3300005618 Ga0068864_100000045 Ga0068864_100000045121 271
65 3300005718 Ga0068866_10000031 Ga0068866_100000318 271
66 3300007265 Ga0099794_10006908 Ga0099794_100069082 271
67 3300009148 Ga0105243_10146104 Ga0105243_101461042 271
68 3300009176 Ga0105242_10046076 Ga0105242_100460762 271
69 3300013104 Ga0157370_10024759 Ga0157370_100247592 271
70 3300013308 Ga0157375_10000112 Ga0157375_100001127 271
71 3300025899 Ga0207642_10000919 Ga0207642_100009194 271
72 3300025922 Ga0207646_10000001 Ga0207646_10000001899 271
73 3300025922 Ga0207646_10000006 Ga0207646_10000006322 271
74 3300025922 Ga0207646_10010529 Ga0207646_1001052910 271
75 3300025922 Ga0207646_10172851 Ga0207646_101728512 271
76 3300025922 Ga0207646_10308907 Ga0207646_103089072 271
77 3300025922 Ga0207646_10354406 Ga0207646_103544062 271
78 3300025934 Ga0207686_10023096 Ga0207686_100230963 271
79 3300025934 Ga0207686_10265341 Ga0207686_102653412 271
80 3300025935 Ga0207709_10096394 Ga0207709_100963942 271
81 3300025937 Ga0207669_10000004 Ga0207669_10000004170 271
82 3300026035 Ga0207703_10000040 Ga0207703_10000040169 271
83 3300026095 Ga0207676_10000016 Ga0207676_1000001643 271
84 3300027671 Ga0209588_1000724 Ga0209588_10007244 271
85 3300027671 Ga0209588_1002617 Ga0209588_10026171 271
86 3300028800 Ga0265338_10325401 Ga0265338_103254011 271
87 3300036401 Ga0373937_0064484 Ga0373937_0064484_2222_3088 271
88 3300046511 Ga0495608_0009335 Ga0495608_0009335_2718_3569 271
89 3300046517 Ga0495630_0000408 Ga0495630_0000408_32068_32934 271
90 3300046642 Ga0495634_0000247 Ga0495634_0000247_1035_1889 271
91 3300046675 Ga0495657_0041818 Ga0495657_0041818_321_1187 271
92 3300047471 Ga0495684_0084544 Ga0495684_0084544_500_1366 271
93 3300048907 Ga0496104_0301916 Ga0496104_0301916_301_1269 271
94 3300048908 Ga0496105_0308836 Ga0496105_0308836_76_990 271
95 3300048911 Ga0496108_0001921 Ga0496108_0001921_781_1632 271
96 3300048912 Ga0496109_0000168 Ga0496109_0000168_809_1660 271
97 3300048912 Ga0496109_0155719 Ga0496109_0155719_186_1100 271
98 3300048915 Ga0496112_0192145 Ga0496112_0192145_629_1696 271
99 3300049743 Ga0501081_0060551 Ga0501081_0060551_1751_2578 271
100 3300050515 nmdc:mga0a205_24_c2 nmdc:mga0a205_24_c2_1754_2611 271
101 iso_pu_bacteria 2873314349 2873321648 271
102 3300005435 Ga0070714_100074136 Ga0070714_1000741363 272
103 3300005436 Ga0070713_100471207 Ga0070713_1004712071 272
104 3300005937 Ga0081455_10045334 Ga0081455_100453342 272
105 3300005937 Ga0081455_10122181 Ga0081455_101221813 272
106 3300005981 Ga0081538_10089907 Ga0081538_100899072 272
107 3300006173 Ga0070716_100289077 Ga0070716_1002890772 272
108 3300009094 Ga0111539_11085785 Ga0111539_110857851 272
109 3300026089 Ga0207648_10081248 Ga0207648_100812484 272
110 3300037312 Ga0395899_0198897 Ga0395899_0198897_78_932 272
111 3300037466 Ga0395898_0071994 Ga0395898_0071994_623_1477 272
112 3300037466 Ga0395898_0262701 Ga0395898_0262701_162_1205 272
113 3300038443 Ga0395901_0022836 Ga0395901_0022836_3037_3891 272
114 3300044684 Ga0466966_0063617 Ga0466966_0063617_152_1192 272
115 3300048904 Ga0496101_0018529 Ga0496101_0018529_2437_3285 272
116 3300048907 Ga0496104_0007265 Ga0496104_0007265_500_1348 272
117 3300048911 Ga0496108_0040100 Ga0496108_0040100_1637_2485 272
118 3300048912 Ga0496109_0002305 Ga0496109_0002305_6299_7147 272
119 3300048914 Ga0496111_0019285 Ga0496111_0019285_2402_3250 272
120 3300048915 Ga0496112_0008237 Ga0496112_0008237_2921_3769 272
121 3300048916 Ga0496113_0004352 Ga0496113_0004352_2299_3147 272
122 3300048918 Ga0496115_0000278 Ga0496115_0000278_12276_13157 272
123 3300048918 Ga0496115_0549403 Ga0496115_0549403_65_913 272
124 3300049572 Ga0501036_0198485 Ga0501036_0198485_461_1312 272
125 3300049576 Ga0501040_0067954 Ga0501040_0067954_643_1494 272
126 3300049577 Ga0501041_0250291 Ga0501041_0250291_124_975 272
127 3300049580 Ga0501046_0123105 Ga0501046_0123105_601_1452 272
128 3300049582 Ga0501048_0184093 Ga0501048_0184093_235_1086 272
129 3300049587 Ga0501071_0021501 Ga0501071_0021501_1876_2727 272
130 3300049590 Ga0501074_0152410 Ga0501074_0152410_656_1507 272
131 3300049591 Ga0501075_0031578 Ga0501075_0031578_1374_2225 272
132 3300049591 Ga0501075_0317504 Ga0501075_0317504_124_975 272
133 3300049592 Ga0501076_0045432 Ga0501076_0045432_1677_2528 272
134 3300049592 Ga0501076_0054888 Ga0501076_0054888_299_1150 272
135 3300049742 Ga0501080_0071423 Ga0501080_0071423_1223_2074 272
136 3300049743 Ga0501081_0089150 Ga0501081_0089150_880_1731 272
137 3300049744 Ga0501083_0390346 Ga0501083_0390346_36_887 272
138 3300049824 Ga0501045_0025998 Ga0501045_0025998_2115_2966 272
139 3300049824 Ga0501045_0419990 Ga0501045_0419990_101_955 272
140 3300054114 Ga0501084_0018321 Ga0501084_0018321_2232_3083 272
141 3300060353 Ga0501082_0236309 Ga0501082_0236309_90_941 272
142 3300005329 Ga0070683_100043328 Ga0070683_1000433283 273
143 3300005364 Ga0070673_100005926 Ga0070673_1000059267 273
144 3300005614 Ga0068856_100267644 Ga0068856_1002676441 273
145 3300005843 Ga0068860_100022494 Ga0068860_1000224942 273
146 3300005981 Ga0081538_10029740 Ga0081538_100297403 273
147 3300005981 Ga0081538_10144826 Ga0081538_101448262 273
148 3300005985 Ga0081539_10002283 Ga0081539_1000228329 273
149 3300005985 Ga0081539_10002976 Ga0081539_1000297621 273
150 3300009177 Ga0105248_10530594 Ga0105248_105305942 273
151 3300009553 Ga0105249_10306849 Ga0105249_103068492 273
152 3300013102 Ga0157371_10002351 Ga0157371_1000235119 273
153 3300025941 Ga0207711_10373744 Ga0207711_103737442 273
154 3300025960 Ga0207651_10000460 Ga0207651_100004608 273
155 3300025961 Ga0207712_10000007 Ga0207712_10000007279 273
156 3300026078 Ga0207702_10003607 Ga0207702_100036079 273
157 3300028381 Ga0268264_10031067 Ga0268264_100310672 273
158 3300028556 Ga0265337_1000231 Ga0265337_10002319 273
159 3300028558 Ga0265326_10000007 Ga0265326_1000000713 273
160 3300028654 Ga0265322_10000001 Ga0265322_10000001292 273
161 3300028666 Ga0265336_10009094 Ga0265336_100090942 273
162 3300029957 Ga0265324_10001009 Ga0265324_1000100913 273
163 3300031239 Ga0265328_10009838 Ga0265328_100098382 273
164 3300031240 Ga0265320_10000002 Ga0265320_10000002291 273
165 3300031242 Ga0265329_10006540 Ga0265329_100065403 273
166 3300031249 Ga0265339_10119610 Ga0265339_101196102 273
167 3300031251 Ga0265327_10000011 Ga0265327_10000011291 273
168 3300031711 Ga0265314_10000062 Ga0265314_1000006225 273
169 3300037418 Ga0395900_0254734 Ga0395900_0254734_459_1310 273
170 3300038443 Ga0395901_0398136 Ga0395901_0398136_22_873 273
171 3300042435 Ga0439434_0025262 Ga0439434_0025262_511_1362 273
172 3300044842 Ga0466957_0015669 Ga0466957_0015669_1633_2541 273
173 3300046455 Ga0495603_0000030 Ga0495603_0000030_13423_14250 273
174 3300046455 Ga0495603_0006771 Ga0495603_0006771_815_1672 273
175 3300046473 Ga0495582_0000011 Ga0495582_0000011_15441_16307 273
176 3300046679 Ga0495623_0216623 Ga0495623_0216623_176_1033 273
177 3300046683 Ga0495658_0000005 Ga0495658_0000005_97043_97909 273
178 3300047317 Ga0495604_0000019 Ga0495604_0000019_114777_115634 273
179 3300048903 Ga0496100_0388084 Ga0496100_0388084_28_1002 273
180 3300048904 Ga0496101_0285093 Ga0496101_0285093_65_1039 273
181 3300048909 Ga0496106_0000081 Ga0496106_0000081_56837_57664 273
182 3300048909 Ga0496106_0042207 Ga0496106_0042207_1152_2126 273
183 3300048913 Ga0496110_0096386 Ga0496110_0096386_482_1309 273
184 3300048915 Ga0496112_0000003 Ga0496112_0000003_65519_66376 273
185 3300048917 Ga0496114_0460344 Ga0496114_0460344_230_1051 273
186 3300048918 Ga0496115_0012965 Ga0496115_0012965_4796_5653 273
187 3300049568 Ga0501031_0000822 Ga0501031_0000822_813_1664 273
188 3300049569 Ga0501032_0004405 Ga0501032_0004405_1716_2567 273
189 3300049570 Ga0501033_0000862 Ga0501033_0000862_21829_22680 273
190 3300049571 Ga0501034_0077206 Ga0501034_0077206_67_918 273
191 3300049572 Ga0501036_0000938 Ga0501036_0000938_5793_6644 273
192 3300049573 Ga0501037_0003441 Ga0501037_0003441_5065_5916 273
193 3300049574 Ga0501038_0000933 Ga0501038_0000933_16994_17845 273
194 3300049574 Ga0501038_0028459 Ga0501038_0028459_3353_4204 273
195 3300049575 Ga0501039_0003186 Ga0501039_0003186_8196_9047 273
196 3300049576 Ga0501040_0003033 Ga0501040_0003033_1588_2439 273
197 3300049577 Ga0501041_0001177 Ga0501041_0001177_5197_6048 273
198 3300049577 Ga0501041_0267738 Ga0501041_0267738_171_1031 273
199 3300049578 Ga0501042_0000761 Ga0501042_0000761_4974_5825 273
200 3300049578 Ga0501042_0126448 Ga0501042_0126448_725_1576 273
201 3300049579 Ga0501043_0002346 Ga0501043_0002346_14331_15182 273
202 3300049580 Ga0501046_0008844 Ga0501046_0008844_5037_5888 273
203 3300049580 Ga0501046_0042414 Ga0501046_0042414_368_1219 273
204 3300049581 Ga0501047_0000244 Ga0501047_0000244_33735_34586 273
205 3300049582 Ga0501048_0000223 Ga0501048_0000223_8196_9047 273
206 3300049582 Ga0501048_0117158 Ga0501048_0117158_822_1673 273
207 3300049584 Ga0501068_0000806 Ga0501068_0000806_10366_11217 273
208 3300049584 Ga0501068_0026835 Ga0501068_0026835_386_1237 273
209 3300049585 Ga0501069_0000303 Ga0501069_0000303_16991_17842 273
210 3300049586 Ga0501070_0004059 Ga0501070_0004059_5942_6763 273
211 3300049586 Ga0501070_0028555 Ga0501070_0028555_2939_3790 273
212 3300049587 Ga0501071_0000001 Ga0501071_0000001_5065_5916 273
213 3300049588 Ga0501072_0000550 Ga0501072_0000550_8187_9038 273
214 3300049588 Ga0501072_0154891 Ga0501072_0154891_745_1596 273
215 3300049590 Ga0501074_0001650 Ga0501074_0001650_1587_2438 273
216 3300049590 Ga0501074_0103587 Ga0501074_0103587_160_1011 273
217 3300049591 Ga0501075_0001018 Ga0501075_0001018_16998_17849 273
218 3300049591 Ga0501075_0001259 Ga0501075_0001259_9877_10734 273
219 3300049591 Ga0501075_0049579 Ga0501075_0049579_17_868 273
220 3300049592 Ga0501076_0000523 Ga0501076_0000523_14638_15489 273
221 3300049593 Ga0501077_0000028 Ga0501077_0000028_25207_26058 273
222 3300049741 Ga0501079_0000387 Ga0501079_0000387_10753_11604 273
223 3300049742 Ga0501080_0001311 Ga0501080_0001311_16661_17512 273
224 3300049743 Ga0501081_0000043 Ga0501081_0000043_25207_26058 273
225 3300049744 Ga0501083_0000412 Ga0501083_0000412_5037_5888 273
226 3300049822 Ga0501035_0001272 Ga0501035_0001272_17019_17870 273
227 3300049824 Ga0501045_0007778 Ga0501045_0007778_26_877 273
228 3300050507 nmdc:mga05p37_65799_c1 nmdc:mga05p37_65799_c1_1779_2630 273
229 3300053077 Ga0495601_0000326 Ga0495601_0000326_6450_7307 273
230 3300053094 Ga0500566_0136933 Ga0500566_0136933_404_1234 273
231 3300054114 Ga0501084_0000118 Ga0501084_0000118_46644_47495 273
232 3300060353 Ga0501082_0000720 Ga0501082_0000720_11685_12536 273
233 3300061734 Ga0530510_0000507 Ga0530510_0000507_8196_9047 273
234 3300005356 Ga0070674_100000029 Ga0070674_10000002935 274
235 3300005439 Ga0070711_100003340 Ga0070711_1000033408 274
236 3300005539 Ga0068853_100103929 Ga0068853_1001039294 274
237 3300005548 Ga0070665_100000106 Ga0070665_100000106138 274
238 3300005718 Ga0068866_10000001 Ga0068866_10000001288 274
239 3300006163 Ga0070715_10000001 Ga0070715_10000001262 274
240 3300009093 Ga0105240_10543539 Ga0105240_105435392 274
241 3300009098 Ga0105245_10008155 Ga0105245_100081558 274
242 3300009551 Ga0105238_10000011 Ga0105238_10000011105 274
243 3300013297 Ga0157378_10092729 Ga0157378_100927294 274
244 3300014968 Ga0157379_10044467 Ga0157379_100444674 274
245 3300025899 Ga0207642_10000002 Ga0207642_100000028 274
246 3300025905 Ga0207685_10000036 Ga0207685_1000003649 274
247 3300025916 Ga0207663_10143876 Ga0207663_101438762 274
248 3300025924 Ga0207694_10000004 Ga0207694_10000004518 274
249 3300025927 Ga0207687_10000177 Ga0207687_1000017711 274
250 3300025937 Ga0207669_10000012 Ga0207669_10000012107 274
251 3300025938 Ga0207704_10449357 Ga0207704_104493572 274
252 3300025944 Ga0207661_10070678 Ga0207661_100706783 274
253 3300026041 Ga0207639_10007405 Ga0207639_100074054 274
254 3300028800 Ga0265338_10000764 Ga0265338_1000076412 274
255 3300031241 Ga0265325_10001007 Ga0265325_100010076 274
256 3300031249 Ga0265339_10000855 Ga0265339_1000085518 274
257 3300031250 Ga0265331_10016502 Ga0265331_100165022 274
258 3300031344 Ga0265316_10037070 Ga0265316_100370703 274
259 3300031595 Ga0265313_10001275 Ga0265313_100012756 274
260 3300031711 Ga0265314_10011335 Ga0265314_100113351 274
261 3300044694 Ga0466963_0000739 Ga0466963_0000739_7366_8343 274
262 3300044842 Ga0466957_0078135 Ga0466957_0078135_819_1796 274
263 3300045976 Ga0466967_0008096 Ga0466967_0008096_2170_3147 274
264 3300046454 Ga0495592_0177405 Ga0495592_0177405_64_924 274
265 3300046459 Ga0495629_0043316 Ga0495629_0043316_1674_2537 274
266 3300046461 Ga0495641_0000044 Ga0495641_0000044_33290_34150 274
267 3300046511 Ga0495608_0001071 Ga0495608_0001071_11652_12512 274
268 3300046511 Ga0495608_0062435 Ga0495608_0062435_66_896 274
269 3300046536 Ga0495587_0043155 Ga0495587_0043155_234_1094 274
270 3300046694 Ga0495649_0000554 Ga0495649_0000554_748_1608 274
271 3300047321 Ga0495676_0000299 Ga0495676_0000299_23842_24702 274
272 3300047321 Ga0495676_0042134 Ga0495676_0042134_121_948 274
273 3300047322 Ga0495680_0007700 Ga0495680_0007700_92_952 274
274 3300048915 Ga0496112_0001122 Ga0496112_0001122_1517_2377 274
275 3300048916 Ga0496113_0000014 Ga0496113_0000014_60452_61312 274
276 3300048916 Ga0496113_0100520 Ga0496113_0100520_352_1209 274
277 3300050511 nmdc:mga08y16_446432_c1 nmdc:mga08y16_446432_c1_87_995 274
278 3300053084 Ga0495595_0000172 Ga0495595_0000172_8709_9569 274
279 3300053085 Ga0495619_0019190 Ga0495619_0019190_3417_4286 274
280 3300053123 Ga0500614_000324 Ga0500614_000324_3446_4306 274
281 iso_pu_bacteria 2818991318 2819428459 274
282 3300005329 Ga0070683_100013919 Ga0070683_1000139192 275
283 3300005329 Ga0070683_100103216 Ga0070683_1001032163 275
284 3300005336 Ga0070680_100056117 Ga0070680_1000561172 275
285 3300005340 Ga0070689_100250616 Ga0070689_1002506162 275
286 3300005344 Ga0070661_100000023 Ga0070661_10000002347 275
287 3300005354 Ga0070675_100000101 Ga0070675_10000010149 275
288 3300005457 Ga0070662_100000004 Ga0070662_10000000435 275
289 3300005458 Ga0070681_10151849 Ga0070681_101518492 275
290 3300005535 Ga0070684_100025299 Ga0070684_1000252997 275
291 3300005535 Ga0070684_100042362 Ga0070684_1000423623 275
292 3300005535 Ga0070684_100111966 Ga0070684_1001119662 275
293 3300005563 Ga0068855_100061658 Ga0068855_1000616584 275
294 3300005577 Ga0068857_100215924 Ga0068857_1002159242 275
295 3300005616 Ga0068852_100039119 Ga0068852_1000391193 275
296 3300005842 Ga0068858_100099843 Ga0068858_1000998434 275
297 3300005843 Ga0068860_100638755 Ga0068860_1006387551 275
298 3300006871 Ga0075434_100311289 Ga0075434_1003112891 275
299 3300006914 Ga0075436_100002125 Ga0075436_1000021257 275
300 3300007076 Ga0075435_100002843 Ga0075435_1000028439 275
301 3300009176 Ga0105242_10000893 Ga0105242_100008939 275
302 3300009177 Ga0105248_10000249 Ga0105248_1000024951 275
303 3300009551 Ga0105238_10136363 Ga0105238_101363632 275
304 3300010375 Ga0105239_10076029 Ga0105239_100760293 275
305 3300013105 Ga0157369_10016377 Ga0157369_100163778 275
306 3300013296 Ga0157374_10034846 Ga0157374_100348463 275
307 3300013307 Ga0157372_10046424 Ga0157372_100464242 275
308 3300013308 Ga0157375_10469068 Ga0157375_104690682 275
309 3300014326 Ga0157380_10000093 Ga0157380_1000009354 275
310 3300014968 Ga0157379_10275441 Ga0157379_102754412 275
311 3300020082 Ga0206353_10089411 Ga0206353_100894113 275
312 3300025912 Ga0207707_10016625 Ga0207707_100166257 275
313 3300025913 Ga0207695_10100322 Ga0207695_101003222 275
314 3300025920 Ga0207649_10000063 Ga0207649_1000006322 275
315 3300025921 Ga0207652_10043823 Ga0207652_100438233 275
316 3300025924 Ga0207694_10049610 Ga0207694_100496102 275
317 3300025926 Ga0207659_10000010 Ga0207659_10000010153 275
318 3300025927 Ga0207687_10010603 Ga0207687_100106032 275
319 3300025933 Ga0207706_10000012 Ga0207706_10000012183 275
320 3300025936 Ga0207670_10167372 Ga0207670_101673722 275
321 3300025941 Ga0207711_10000020 Ga0207711_1000002019 275
322 3300025944 Ga0207661_10000095 Ga0207661_1000009558 275
323 3300025944 Ga0207661_10074244 Ga0207661_100742442 275
324 3300025949 Ga0207667_10062752 Ga0207667_100627522 275
325 3300025972 Ga0207668_10144035 Ga0207668_101440352 275
326 3300025981 Ga0207640_10137065 Ga0207640_101370652 275
327 3300026035 Ga0207703_10117759 Ga0207703_101177593 275
328 3300026078 Ga0207702_10244217 Ga0207702_102442171 275
329 3300026078 Ga0207702_10256597 Ga0207702_102565972 275
330 3300026088 Ga0207641_10025406 Ga0207641_100254062 275
331 3300026116 Ga0207674_10099830 Ga0207674_100998302 275
332 3300026142 Ga0207698_10070948 Ga0207698_100709481 275
333 3300028563 Ga0265319_1000025 Ga0265319_100002537 275
334 3300028800 Ga0265338_10000473 Ga0265338_1000047340 275
335 3300044901 Ga0466960_0069729 Ga0466960_0069729_34_1014 275
336 3300046529 Ga0495652_0000019 Ga0495652_0000019_42773_43636 275
337 3300046536 Ga0495587_0002971 Ga0495587_0002971_8828_9691 275
338 3300046690 Ga0495624_0000008 Ga0495624_0000008_56766_57629 275
339 3300047321 Ga0495676_0002794 Ga0495676_0002794_2194_3060 275
340 3300047444 Ga0495675_0051399 Ga0495675_0051399_1621_2451 275
341 3300048903 Ga0496100_0000018 Ga0496100_0000018_78278_79144 275
342 3300048904 Ga0496101_0000062 Ga0496101_0000062_114083_114949 275
343 3300048905 Ga0496102_0000039 Ga0496102_0000039_152769_153602 275
344 3300048905 Ga0496102_0056328 Ga0496102_0056328_1145_2125 275
345 3300048906 Ga0496103_0000008 Ga0496103_0000008_274024_274857 275
346 3300048906 Ga0496103_0049895 Ga0496103_0049895_1066_1893 275
347 3300048907 Ga0496104_0000129 Ga0496104_0000129_29783_30646 275
348 3300048908 Ga0496105_0000846 Ga0496105_0000846_9175_10038 275
349 3300048909 Ga0496106_0000145 Ga0496106_0000145_45354_46220 275
350 3300048910 Ga0496107_0000006 Ga0496107_0000006_147201_148067 275
351 3300048911 Ga0496108_0219360 Ga0496108_0219360_77_904 275
352 3300048911 Ga0496108_0299991 Ga0496108_0299991_203_1183 275
353 3300048912 Ga0496109_0000129 Ga0496109_0000129_105_932 275
354 3300048912 Ga0496109_0013512 Ga0496109_0013512_4774_5754 275
355 3300048913 Ga0496110_0007132 Ga0496110_0007132_3677_4657 275
356 3300048915 Ga0496112_0026696 Ga0496112_0026696_59_1039 275
357 3300048917 Ga0496114_0000014 Ga0496114_0000014_206479_207342 275
358 3300048917 Ga0496114_0222822 Ga0496114_0222822_622_1602 275
359 3300048918 Ga0496115_0000003 Ga0496115_0000003_244554_245387 275
360 3300048918 Ga0496115_0000125 Ga0496115_0000125_28138_29001 275
361 3300049578 Ga0501042_0017127 Ga0501042_0017127_1018_1920 275
362 3300049583 Ga0501067_0029461 Ga0501067_0029461_10_978 275
363 3300049583 Ga0501067_0040207 Ga0501067_0040207_47_1024 275
364 3300049583 Ga0501067_0104916 Ga0501067_0104916_609_1556 275
365 3300049584 Ga0501068_0037089 Ga0501068_0037089_1673_2557 275
366 3300049585 Ga0501069_0063788 Ga0501069_0063788_179_1078 275
367 3300049585 Ga0501069_0153265 Ga0501069_0153265_37_999 275
368 3300050512 nmdc:mga0n895_424927_c1 nmdc:mga0n895_424927_c1_366_1289 275
369 3300050513 nmdc:mga0rr50_4219_c1 nmdc:mga0rr50_4219_c1_3945_4922 275
370 3300050514 nmdc:mga08x19_97794_c1 nmdc:mga08x19_97794_c1_167_1144 275
371 3300053083 Ga0495655_0000001 Ga0495655_0000001_136159_137022 275
372 3300053083 Ga0495655_0006554 Ga0495655_0006554_1193_2056 275
373 3300053129 Ga0500628_000010 Ga0500628_000010_10360_11223 275
374 3300005337 Ga0070682_100000013 Ga0070682_100000013107 276
375 3300005338 Ga0068868_100000285 Ga0068868_1000002855 276
376 3300005455 Ga0070663_100003079 Ga0070663_1000030791 276
377 3300005456 Ga0070678_100002401 Ga0070678_1000024015 276
378 3300005458 Ga0070681_10008992 Ga0070681_100089924 276
379 3300005530 Ga0070679_100001522 Ga0070679_1000015222 276
380 3300005530 Ga0070679_100082234 Ga0070679_1000822344 276
381 3300005578 Ga0068854_100000114 Ga0068854_10000011412 276
382 3300005614 Ga0068856_100000577 Ga0068856_10000057728 276
383 3300005834 Ga0068851_10136390 Ga0068851_101363902 276
384 3300009174 Ga0105241_10121290 Ga0105241_101212903 276
385 3300009553 Ga0105249_10538302 Ga0105249_105383021 276
386 3300010375 Ga0105239_10104990 Ga0105239_101049904 276
387 3300013307 Ga0157372_10000129 Ga0157372_1000012942 276
388 3300014326 Ga0157380_10000408 Ga0157380_100004084 276
389 3300025321 Ga0207656_10096329 Ga0207656_100963292 276
390 3300025912 Ga0207707_10013823 Ga0207707_100138235 276
391 3300025912 Ga0207707_10112429 Ga0207707_101124293 276
392 3300025921 Ga0207652_10000349 Ga0207652_100003499 276
393 3300025921 Ga0207652_10056664 Ga0207652_100566643 276
394 3300025927 Ga0207687_10000018 Ga0207687_10000018152 276
395 3300025927 Ga0207687_10004028 Ga0207687_1000402811 276
396 3300025981 Ga0207640_10000015 Ga0207640_1000001552 276
397 3300026023 Ga0207677_10000331 Ga0207677_1000033132 276
398 3300026067 Ga0207678_10007745 Ga0207678_100077451 276
399 3300026078 Ga0207702_10000060 Ga0207702_1000006074 276
400 3300026121 Ga0207683_10003745 Ga0207683_100037454 276
401 3300036401 Ga0373937_0539446 Ga0373937_0539446_88_954 276
402 3300037853 Ga0436364_0955823 Ga0436364_0955823_3416_4360 276
403 3300044694 Ga0466963_0000001 Ga0466963_0000001_74566_75432 276
404 3300046454 Ga0495592_0000036 Ga0495592_0000036_112270_113136 276
405 3300046476 Ga0495662_0000458 Ga0495662_0000458_11200_12066 276
406 3300046514 Ga0495618_0000594 Ga0495618_0000594_10000_10866 276
407 3300046516 Ga0495628_0002850 Ga0495628_0002850_9249_10115 276
408 3300046516 Ga0495628_0040965 Ga0495628_0040965_181_1047 276
409 3300046517 Ga0495630_0000541 Ga0495630_0000541_56_922 276
410 3300046523 Ga0495644_0000642 Ga0495644_0000642_11300_12166 276
411 3300046543 Ga0495645_0019069 Ga0495645_0019069_669_1538 276
412 3300046558 Ga0495633_0042722 Ga0495633_0042722_969_1835 276
413 3300046642 Ga0495634_0024941 Ga0495634_0024941_3260_4126 276
414 3300046663 Ga0495635_0000016 Ga0495635_0000016_122136_123002 276
415 3300046675 Ga0495657_0085327 Ga0495657_0085327_128_994 276
416 3300046681 Ga0495647_0000008 Ga0495647_0000008_84986_85852 276
417 3300046689 Ga0495613_0000203 Ga0495613_0000203_11358_12224 276
418 3300046690 Ga0495624_0009779 Ga0495624_0009779_4662_5528 276
419 3300046809 Ga0495600_0000787 Ga0495600_0000787_5873_6739 276
420 3300047447 Ga0495685_022930 Ga0495685_022930_780_1646 276
421 3300048919 Ga0496116_0000680 Ga0496116_0000680_30295_31134 276
422 3300048921 Ga0496118_0179807 Ga0496118_0179807_412_1248 276
423 3300048922 Ga0496119_0001947 Ga0496119_0001947_9592_10431 276
424 3300048927 Ga0496124_0289424 Ga0496124_0289424_150_1028 276
425 3300048929 Ga0496126_0035687 Ga0496126_0035687_3780_4616 276
426 3300049579 Ga0501043_0201227 Ga0501043_0201227_461_1330 276
427 3300049581 Ga0501047_0064173 Ga0501047_0064173_2378_3226 276
428 3300049581 Ga0501047_0111335 Ga0501047_0111335_422_1300 276
429 3300049585 Ga0501069_0000775 Ga0501069_0000775_2327_3196 276
430 3300049586 Ga0501070_0304401 Ga0501070_0304401_327_1205 276
431 3300049587 Ga0501071_0087841 Ga0501071_0087841_697_1566 276
432 3300049741 Ga0501079_0158491 Ga0501079_0158491_329_1198 276
433 3300049744 Ga0501083_0090765 Ga0501083_0090765_773_1642 276
434 3300049744 Ga0501083_0098999 Ga0501083_0098999_976_1824 276
435 3300049823 Ga0501044_0380074 Ga0501044_0380074_57_926 276
436 3300050514 nmdc:mga08x19_158854_c1 nmdc:mga08x19_158854_c1_245_1111 276
437 3300053085 Ga0495619_0000031 Ga0495619_0000031_22105_22971 276
438 3300009101 Ga0105247_10000393 Ga0105247_1000039322 278
439 3300025900 Ga0207710_10000195 Ga0207710_100001956 278
440 3300005616 Ga0068852_100133781 Ga0068852_1001337812 279
441 3300005985 Ga0081539_10000791 Ga0081539_100007916 279
442 3300025939 Ga0207665_10291061 Ga0207665_102910612 279
443 3300026142 Ga0207698_10031252 Ga0207698_100312523 279
444 3300046459 Ga0495629_0000272 Ga0495629_0000272_39211_40089 279
445 3300046460 Ga0495638_0079564 Ga0495638_0079564_69_917 279
446 3300046517 Ga0495630_0000056 Ga0495630_0000056_31194_32072 279
447 3300046660 Ga0495625_0000696 Ga0495625_0000696_352_1236 279
448 3300048905 Ga0496102_0036045 Ga0496102_0036045_1826_2773 279
449 3300048913 Ga0496110_0272069 Ga0496110_0272069_297_1139 279
450 3300048917 Ga0496114_0080517 Ga0496114_0080517_436_1389 279
451 3300053078 Ga0495612_0009748 Ga0495612_0009748_2552_3394 279
452 3300005616 Ga0068852_100000184 Ga0068852_1000001843 280
453 3300013297 Ga0157378_10031324 Ga0157378_100313242 280
454 3300026142 Ga0207698_10000012 Ga0207698_1000001237 280
455 3300046499 Ga0495594_0000003 Ga0495594_0000003_125168_126019 280
456 3300046557 Ga0495622_0000180 Ga0495622_0000180_38093_38944 280
457 3300003659 JGI25404J52841_10001178 JGI25404J52841_100011782 281
458 3300005435 Ga0070714_100019159 Ga0070714_1000191592 281
459 3300005436 Ga0070713_100000009 Ga0070713_100000009154 281
460 3300005436 Ga0070713_100247322 Ga0070713_1002473222 281
461 3300005441 Ga0070700_100109911 Ga0070700_1001099111 281
462 3300005983 Ga0081540_1000139 Ga0081540_100013965 281
463 3300006881 Ga0068865_100000160 Ga0068865_10000016024 281
464 3300025928 Ga0207700_10000025 Ga0207700_10000025155 281
465 3300025928 Ga0207700_10048817 Ga0207700_100488172 281
466 3300025929 Ga0207664_10048957 Ga0207664_100489572 281
467 3300025938 Ga0207704_10000236 Ga0207704_1000023611 281
468 3300026075 Ga0207708_10131923 Ga0207708_101319232 281
469 3300026118 Ga0207675_100509528 Ga0207675_1005095282 281
470 3300045836 Ga0466958_0050321 Ga0466958_0050321_788_1678 281
471 3300045976 Ga0466967_0000065 Ga0466967_0000065_7662_8522 281
472 3300046511 Ga0495608_0000068 Ga0495608_0000068_23368_24258 281
473 3300046515 Ga0495620_0082178 Ga0495620_0082178_78_995 281
474 3300046674 Ga0495588_0000165 Ga0495588_0000165_74278_75129 281
475 3300046675 Ga0495657_0000004 Ga0495657_0000004_67117_68007 281
476 3300046683 Ga0495658_0019458 Ga0495658_0019458_1397_2245 281
477 3300046689 Ga0495613_0000113 Ga0495613_0000113_106_963 281
478 3300046809 Ga0495600_0030738 Ga0495600_0030738_2415_3269 281
479 3300047317 Ga0495604_0030624 Ga0495604_0030624_1456_2310 281
480 3300047444 Ga0495675_0000107 Ga0495675_0000107_20903_21793 281
481 3300048088 Ga0495602_0000208 Ga0495602_0000208_18258_19112 281
482 3300048907 Ga0496104_0141265 Ga0496104_0141265_1152_2114 281
483 3300048908 Ga0496105_0000001 Ga0496105_0000001_494184_495092 281
484 3300048908 Ga0496105_0074027 Ga0496105_0074027_1640_2602 281
485 3300048913 Ga0496110_0000062 Ga0496110_0000062_30963_31844 281
486 3300048914 Ga0496111_0000010 Ga0496111_0000010_70539_71420 281
487 3300048916 Ga0496113_0030382 Ga0496113_0030382_339_1301 281
488 3300049578 Ga0501042_0100091 Ga0501042_0100091_147_1040 281
489 3300053077 Ga0495601_0000013 Ga0495601_0000013_151752_152615 281
490 3300053084 Ga0495595_0000003 Ga0495595_0000003_67117_68007 281
491 3300053084 Ga0495595_0010201 Ga0495595_0010201_2675_3529 281
492 3300053085 Ga0495619_0000106 Ga0495619_0000106_38166_39056 281
493 iso_pu_bacteria 2818991458 2819664790 281

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

72

211

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6z4w-assembly1.cif.gz_A ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) 0.9209 1 202
1vpl-assembly1.cif.gz_A-2 crystal structure of abc transporter atp-binding protein (tm0544) from thermotoga maritima at 2.10 a resolution 0.9204 2 205
6z67-assembly2.cif.gz_B ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution 0.9186 8 202
1ji0-assembly1.cif.gz_A crystal structure analysis of the abc transporter from thermotoga maritima 0.9028 2 202
6b89-assembly1.cif.gz_A e. coli lptb in complex with adp and novobiocin 0.9018 1 205
ID Description Score Start End Superfamily
af_P9WQL9_1_244_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9444 1 205 3.40.50.300
af_Q8T6J0_514_774_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9425 8 204 3.40.50.300
af_A0A1D6KPM2_510_779_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9363 8 202 3.40.50.300
af_O53149_2_239_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9361 1 205 3.40.50.300
af_A0A0R0KIK5_1390_1640_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9358 8 204 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7V9B0A6-F1-model_v4 ABC transporter ATP-binding protein 0.9682 73 205 GO:0005524
GO:0016887
AF-A0A348B4H2-F1-model_v4 ABC transporter domain-containing protein 0.963 21 204 GO:0005524
GO:0016887
AF-A0A7J8BN72-F1-model_v4 ATP binding cassette subfamily A member 7 0.9534 5 202 GO:0005524
GO:0016020
GO:0016887
GO:0033344
GO:0033700
GO:0034188
GO:0043231
GO:0090554
GO:0090556
GO:0140359
AF-A0A7X8XW61-F1-model_v4 ABC transporter ATP-binding protein 0.9515 1 205 GO:0005524
GO:0005886
GO:0016887
AF-A0A536FTK2-F1-model_v4 ABC transporter ATP-binding protein 0.9507 1 202 GO:0005524
GO:0016887

Feature Viewer

pLDDT pTM Quality
88.57 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map