F454480

General Info

Members Datasets Scaffolds Average Seq Length
493 231 986 130

Family's Representative Sequence

Representative Sequence 3300048903|Ga0496100_0243785|Ga0496100_0243785_771_1226
Length 151
Sequence MQDVDELALAMPQASKTVSEDGRPTYLVHGKMFCFHRSPRPDAVDETGARLDDVFVLRVEDLEVKELLLADPRGVFFTSPHWNGYAAVLIRIPDLAHLDRGELEELVIDAWLTRAQKRVAKAWLADHEPDSASRSVRRVRXXXXRRGRADR

Samples

Sample ID Description Type Environment
1 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
94 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
95 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
96 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
97 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
98 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
99 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
100 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
101 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
102 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
103 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
104 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
105 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
106 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
107 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
108 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
109 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
110 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
111 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
112 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
113 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
114 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
115 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
116 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
117 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
118 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
120 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
121 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
122 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
123 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
124 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
125 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
126 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
127 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
128 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
129 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
130 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
131 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
132 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
133 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
134 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
135 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
136 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
137 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
138 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
139 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
140 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
141 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
142 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
143 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
144 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
145 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
146 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
147 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
148 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
149 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
150 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
151 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
152 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
153 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
154 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
155 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
156 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
157 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
158 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
159 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
160 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
161 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
162 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
163 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
164 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
165 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
166 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
167 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
168 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
169 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
170 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
171 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
172 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
173 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
174 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
175 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
176 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
177 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
178 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
179 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
180 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
181 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
182 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
183 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
184 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
185 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
186 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
187 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
188 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
189 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
190 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
191 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
192 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
193 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
194 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
195 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
196 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
197 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
198 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
199 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
200 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
201 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
202 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
203 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
204 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
205 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
206 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
207 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
208 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
209 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
210 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
211 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
212 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
213 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
214 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
215 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
216 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
217 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
218 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
219 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
220 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
221 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
222 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
223 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
224 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
225 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
226 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
227 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
228 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
229 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
230 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
231 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.51
Rhizosphere 91.68
Stem 0
Stem Tuber 0
Unclassified 8.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496100_0243785 3300048903 Bacteria 1327
2 rootH2_10213490 3300003320 Bacteria 1579
3 Ga0070683_100149329 3300005329 Bacteria 2215
4 Ga0070683_100170711 3300005329 Unclassified 2064
5 Ga0070677_10039320 3300005333 Unclassified 1856
6 Ga0070660_100415411 3300005339 Bacteria 1114
7 Ga0070675_100335053 3300005354 Bacteria 1339
8 Ga0070671_100057278 3300005355 Bacteria 3243
9 Ga0070671_100184533 3300005355 Bacteria 1767
10 Ga0070709_10006472 3300005434 Bacteria 6388
11 Ga0070714_100007455 3300005435 Bacteria 8516
12 Ga0070714_100052153 3300005435 Bacteria 3488
13 Ga0070714_100102751 3300005435 Bacteria 2520
14 Ga0070713_100436608 3300005436 Bacteria 1228
15 Ga0070713_101002471 3300005436 Bacteria 806
16 Ga0070710_10031858 3300005437 Bacteria 2850
17 Ga0070710_10037106 3300005437 Bacteria 2668
18 Ga0070700_100458898 3300005441 Bacteria 971
19 Ga0070708_100040156 3300005445 Bacteria 4097
20 Ga0070708_100541071 3300005445 Bacteria 1099
21 Ga0070663_100287212 3300005455 Bacteria 1313
22 Ga0070678_100527103 3300005456 Unclassified 1046
23 Ga0070685_10082716 3300005466 Bacteria 1927
24 Ga0070707_101370251 3300005468 Bacteria 674
25 Ga0070699_100406985 3300005518 Bacteria 1231
26 Ga0070679_100195774 3300005530 Bacteria 1989
27 Ga0070684_100491261 3300005535 Bacteria 1136
28 Ga0068853_100107940 3300005539 Bacteria 2469
29 Ga0070672_100356035 3300005543 Unclassified 1248
30 Ga0070686_100611744 3300005544 Unclassified 860
31 Ga0070695_100000051 3300005545 Bacteria 46328
32 Ga0070695_100286860 3300005545 Bacteria 1212
33 Ga0070695_100416889 3300005545 Bacteria 1021
34 Ga0070695_100659898 3300005545 Bacteria 827
35 Ga0070696_100331364 3300005546 Bacteria 1174
36 Ga0070704_100034164 3300005549 Bacteria 3445
37 Ga0068855_100540403 3300005563 Bacteria 1262
38 Ga0068855_100863756 3300005563 Bacteria 958
39 Ga0070664_100211203 3300005564 Unclassified 1734
40 Ga0068854_100195331 3300005578 Unclassified 1588
41 Ga0068856_100282494 3300005614 Bacteria 1676
42 Ga0068856_100329843 3300005614 Bacteria 1543
43 Ga0070702_100557448 3300005615 Bacteria 852
44 Ga0068852_100140756 3300005616 Unclassified 2232
45 Ga0068852_101014170 3300005616 Bacteria 849
46 Ga0068859_100130186 3300005617 Bacteria 2587
47 Ga0068861_100026352 3300005719 Bacteria 4225
48 Ga0068861_100861240 3300005719 Unclassified 855
49 Ga0081455_10022719 3300005937 Bacteria 5853
50 Ga0081540_1008332 3300005983 Bacteria 7248
51 Ga0070717_10004804 3300006028 Bacteria 9829
52 Ga0070717_10006751 3300006028 Bacteria 8466
53 Ga0070717_10009595 3300006028 Bacteria 7281
54 Ga0070717_11381436 3300006028 Bacteria 640
55 Ga0070715_10003379 3300006163 Bacteria 5061
56 Ga0070715_10121553 3300006163 Bacteria 1246
57 Ga0070716_100009244 3300006173 Bacteria 4912
58 Ga0070712_100379304 3300006175 Unclassified 1163
59 Ga0097621_100107204 3300006237 Bacteria 2357
60 Ga0075428_100193646 3300006844 Bacteria 2199
61 Ga0075428_100612940 3300006844 Bacteria 1162
62 Ga0075431_100122564 3300006847 Bacteria 2682
63 Ga0075433_10123396 3300006852 Bacteria 2301
64 Ga0075434_100002396 3300006871 Bacteria 16448
65 Ga0075434_100424007 3300006871 Bacteria 1351
66 Ga0075429_100416281 3300006880 Bacteria 1177
67 Ga0068865_100315604 3300006881 Bacteria 1255
68 Ga0075436_100022874 3300006914 Bacteria 4293
69 Ga0075436_100259707 3300006914 Bacteria 1238
70 Ga0097620_100130183 3300006931 Bacteria 2587
71 Ga0075435_100116440 3300007076 Bacteria 2226
72 Ga0075435_100199571 3300007076 Bacteria 1695
73 Ga0105240_10150660 3300009093 Bacteria 2771
74 Ga0105240_10192952 3300009093 Bacteria 2394
75 Ga0111539_10775549 3300009094 Bacteria 1116
76 Ga0105245_10016574 3300009098 Bacteria 6429
77 Ga0105245_10032043 3300009098 Bacteria 4654
78 Ga0105245_10050507 3300009098 Bacteria 3727
79 Ga0114129_10189589 3300009147 Bacteria 2793
80 Ga0105241_10413724 3300009174 Bacteria 1185
81 Ga0105242_10029946 3300009176 Bacteria 4345
82 Ga0105242_10253995 3300009176 Bacteria 1585
83 Ga0105248_10132469 3300009177 Bacteria 2812
84 Ga0105248_10213382 3300009177 Bacteria 2175
85 Ga0105248_10283516 3300009177 Bacteria 1865
86 Ga0105237_10093151 3300009545 Bacteria 3002
87 Ga0105237_10390898 3300009545 Unclassified 1396
88 Ga0105238_11703780 3300009551 Bacteria 661
89 Ga0105249_10168877 3300009553 Bacteria 2120
90 Ga0105249_10191255 3300009553 Bacteria 1997
91 Ga0105239_10610225 3300010375 Bacteria 1245
92 Ga0105246_10623494 3300011119 Bacteria 935
93 Ga0157373_10286314 3300013100 Unclassified 1168
94 Ga0157370_10448830 3300013104 Bacteria 1186
95 Ga0157369_10577709 3300013105 Bacteria 1161
96 Ga0157369_10800500 3300013105 Bacteria 968
97 Ga0157374_10333099 3300013296 Bacteria 1506
98 Ga0163162_10137544 3300013306 Bacteria 2554
99 Ga0157372_11064543 3300013307 Bacteria 936
100 Ga0157375_10364183 3300013308 Unclassified 1612
101 Ga0157380_10222591 3300014326 Unclassified 1689
102 Ga0157379_10153910 3300014968 Bacteria 2074
103 Ga0157376_10117787 3300014969 Bacteria 2349
104 Ga0207697_10473996 3300025315 Bacteria 554
105 Ga0207692_10009257 3300025898 Bacteria 4106
106 Ga0207685_10012299 3300025905 Bacteria 2607
107 Ga0207699_10045561 3300025906 Bacteria 2560
108 Ga0207699_10106959 3300025906 Unclassified 1786
109 Ga0207695_10085052 3300025913 Bacteria 3192
110 Ga0207693_10001250 3300025915 Bacteria 22628
111 Ga0207693_10003465 3300025915 Bacteria 13466
112 Ga0207693_10148869 3300025915 Bacteria 1841
113 Ga0207663_10105005 3300025916 Bacteria 1905
114 Ga0207646_10612044 3300025922 Unclassified 977
115 Ga0207687_10049312 3300025927 Bacteria 2927
116 Ga0207687_10232466 3300025927 Bacteria 1457
117 Ga0207687_11396189 3300025927 Bacteria 602
118 Ga0207700_10091867 3300025928 Bacteria 2399
119 Ga0207700_10129421 3300025928 Bacteria 2059
120 Ga0207664_10024936 3300025929 Bacteria 4498
121 Ga0207664_10039088 3300025929 Bacteria 3682
122 Ga0207664_10056377 3300025929 Bacteria 3121
123 Ga0207664_10061618 3300025929 Bacteria 2993
124 Ga0207664_10168423 3300025929 Bacteria 1873
125 Ga0207664_10458628 3300025929 Bacteria 1138
126 Ga0207644_10789109 3300025931 Unclassified 794
127 Ga0207669_10224663 3300025937 Bacteria 1381
128 Ga0207665_10000620 3300025939 Bacteria 23807
129 Ga0207665_10319932 3300025939 Unclassified 1164
130 Ga0207711_10179451 3300025941 Bacteria 1925
131 Ga0207711_10276677 3300025941 Bacteria 1545
132 Ga0207711_10382215 3300025941 Bacteria 1307
133 Ga0207677_10355401 3300026023 Bacteria 1229
134 Ga0207708_10674218 3300026075 Bacteria 882
135 Ga0207702_10062722 3300026078 Bacteria 3175
136 Ga0207675_100582758 3300026118 Unclassified 1120
137 Ga0207683_10082987 3300026121 Bacteria 2848
138 Ga0207683_10725796 3300026121 Unclassified 921
139 Ga0207428_10003447 3300027907 Bacteria 15358
140 Ga0265319_1062147 3300028563 Bacteria 1210
141 Ga0265336_10001393 3300028666 Bacteria 11150
142 Ga0265338_10002351 3300028800 Bacteria 28551
143 Ga0265338_10009388 3300028800 Bacteria 11676
144 Ga0265338_10276883 3300028800 Bacteria 1227
145 Ga0265324_10049812 3300029957 Bacteria 1440
146 Ga0307408_100787324 3300031548 Bacteria 862
147 Ga0265313_10023412 3300031595 Bacteria 3326
148 Ga0307409_100208630 3300031995 Bacteria 1754
149 Ga0307409_100480232 3300031995 Bacteria 1206
150 Ga0307416_100501523 3300032002 Bacteria 1278
151 Ga0307415_100060650 3300032126 Bacteria 2615
152 Ga0373959_0074738 3300034820 Bacteria 772
153 Ga0373926_0005984 3300035083 Bacteria 4026
154 Ga0373926_0067772 3300035083 Bacteria 1308
155 Ga0373934_0446241 3300035086 Bacteria 542
156 Ga0373944_0001747 3300035089 Bacteria 5489
157 Ga0373944_0082333 3300035089 Bacteria 1065
158 Ga0373949_0082716 3300035090 Bacteria 858
159 Ga0373936_0078267 3300035113 Bacteria 1373
160 Ga0373939_0044466 3300035114 Bacteria 1352
161 Ga0373945_0001152 3300035116 Bacteria 8017
162 Ga0373945_0275919 3300035116 Bacteria 715
163 Ga0373943_0000484 3300035170 Bacteria 17010
164 Ga0373943_0008950 3300035170 Bacteria 4486
165 Ga0373946_0024384 3300035171 Bacteria 2370
166 Ga0373955_0134431 3300035172 Bacteria 1446
167 Ga0373955_0563882 3300035172 Unclassified 697
168 Ga0373931_0265230 3300035691 Bacteria 1049
169 Ga0373931_0561686 3300035691 Bacteria 742
170 Ga0373935_0043557 3300035692 Bacteria 2825
171 Ga0373935_0331139 3300035692 Bacteria 1082
172 Ga0373927_0135087 3300035695 Bacteria 1612
173 Ga0373927_0347106 3300035695 Bacteria 978
174 Ga0373947_0000968 3300035725 Bacteria 17536
175 Ga0373947_0013258 3300035725 Bacteria 4721
176 Ga0373947_0157155 3300035725 Unclassified 1468
177 Ga0373947_0253633 3300035725 Bacteria 1164
178 Ga0373937_0387255 3300036401 Bacteria 1326
179 Ga0373925_0003980 3300037068 Bacteria 11262
180 Ga0373925_0105513 3300037068 Bacteria 2171
181 Ga0395899_0124090 3300037312 Bacteria 1847
182 Ga0395900_0823283 3300037418 Bacteria 855
183 Ga0395898_0039691 3300037466 Bacteria 4657
184 Ga0395898_0410631 3300037466 Bacteria 1291
185 Ga0395901_0034132 3300038443 Bacteria 5253
186 Ga0436360_1309095 3300039438 Unclassified 571
187 Ga0436363_0006142 3300039450 Unclassified 788
188 Ga0436363_1367952 3300039450 Bacteria 503
189 Ga0451807_0875620 3300041486 Unclassified 694
190 Ga0451839_0436633 3300041496 Bacteria 747
191 Ga0439448_0044191 3300042005 Bacteria 1448
192 Ga0439463_053701 3300042016 Bacteria 1029
193 Ga0439458_0066912 3300042157 Bacteria 903
194 Ga0439458_0126519 3300042157 Bacteria 675
195 Ga0466969_0011692 3300044656 Bacteria 4644
196 Ga0466969_0396723 3300044656 Bacteria 626
197 Ga0466965_0066615 3300044683 Bacteria 1806
198 Ga0466965_0089403 3300044683 Unclassified 1565
199 Ga0466966_0034137 3300044684 Bacteria 3292
200 Ga0466966_0057743 3300044684 Bacteria 2453
201 Ga0466966_0602581 3300044684 Bacteria 661
202 Ga0466961_0039784 3300044693 Bacteria 3014
203 Ga0466961_0048560 3300044693 Bacteria 2712
204 Ga0466961_0086341 3300044693 Bacteria 1983
205 Ga0466961_0181340 3300044693 Unclassified 1307
206 Ga0466963_0000324 3300044694 Bacteria 21649
207 Ga0466963_0017377 3300044694 Bacteria 4484
208 Ga0466963_0060556 3300044694 Bacteria 2528
209 Ga0466963_0063590 3300044694 Bacteria 2470
210 Ga0466963_0111699 3300044694 Bacteria 1876
211 Ga0466963_0138572 3300044694 Bacteria 1684
212 Ga0466963_0361040 3300044694 Bacteria 1023
213 Ga0466963_0941316 3300044694 Bacteria 608
214 Ga0466963_1221542 3300044694 Bacteria 528
215 Ga0466963_1258257 3300044694 Bacteria 520
216 Ga0466964_0000706 3300044706 Bacteria 10789
217 Ga0466964_0003986 3300044706 Bacteria 5430
218 Ga0466964_0123884 3300044706 Bacteria 1168
219 Ga0466971_0052153 3300044719 Bacteria 1842
220 Ga0466971_0052761 3300044719 Bacteria 1831
221 Ga0466971_0111376 3300044719 Bacteria 1263
222 Ga0466968_0001306 3300044735 Bacteria 8907
223 Ga0466968_0025195 3300044735 Bacteria 2435
224 Ga0466968_0028157 3300044735 Bacteria 2316
225 Ga0466968_0048598 3300044735 Unclassified 1806
226 Ga0466968_0115716 3300044735 Bacteria 1209
227 Ga0466970_0009035 3300044765 Bacteria 5027
228 Ga0466957_0001047 3300044842 Bacteria 14263
229 Ga0466957_0110650 3300044842 Bacteria 1741
230 Ga0466957_0226551 3300044842 Bacteria 1236
231 Ga0466957_0666345 3300044842 Bacteria 732
232 Ga0466959_0000319 3300045049 Bacteria 28408
233 Ga0466959_0031345 3300045049 Bacteria 3934
234 Ga0466959_0245524 3300045049 Bacteria 1235
235 Ga0451576_2051388 3300045051 Bacteria 589
236 Ga0466958_0001642 3300045836 Bacteria 10774
237 Ga0466958_0007911 3300045836 Bacteria 5876
238 Ga0466958_0076807 3300045836 Bacteria 2050
239 Ga0466967_0000427 3300045976 Bacteria 20041
240 Ga0466967_0005935 3300045976 Bacteria 8567
241 Ga0466967_0015356 3300045976 Bacteria 5999
242 Ga0466967_0023400 3300045976 Bacteria 5061
243 Ga0466967_0248266 3300045976 Bacteria 1699
244 Ga0466967_0311625 3300045976 Bacteria 1516
245 Ga0466967_0461532 3300045976 Bacteria 1242
246 Ga0466967_0657642 3300045976 Bacteria 1036
247 Ga0466967_1000198 3300045976 Unclassified 832
248 Ga0495592_0054955 3300046454 Bacteria 2947
249 Ga0495592_0133602 3300046454 Bacteria 1733
250 Ga0495592_0727416 3300046454 Bacteria 595
251 Ga0495603_0006799 3300046455 Bacteria 6861
252 Ga0495603_0062320 3300046455 Bacteria 2202
253 Ga0495629_0001312 3300046459 Bacteria 19557
254 Ga0495629_0013957 3300046459 Bacteria 5791
255 Ga0495629_0059981 3300046459 Bacteria 2659
256 Ga0495629_0130275 3300046459 Bacteria 1752
257 Ga0495629_0180596 3300046459 Bacteria 1463
258 Ga0495629_0181786 3300046459 Bacteria 1457
259 Ga0495641_0000109 3300046461 Bacteria 57910
260 Ga0495641_0020780 3300046461 Bacteria 3319
261 Ga0495641_0031947 3300046461 Bacteria 2510
262 Ga0495641_0502962 3300046461 Bacteria 553
263 Ga0495651_0060772 3300046462 Bacteria 2893
264 Ga0495651_0098162 3300046462 Bacteria 2186
265 Ga0495651_0138591 3300046462 Bacteria 1767
266 Ga0495651_0398313 3300046462 Bacteria 899
267 Ga0495651_0781141 3300046462 Bacteria 590
268 Ga0495653_0164318 3300046463 Bacteria 1538
269 Ga0495653_0174551 3300046463 Bacteria 1480
270 Ga0495653_0199663 3300046463 Bacteria 1358
271 Ga0495653_0351067 3300046463 Bacteria 948
272 Ga0495653_0752764 3300046463 Bacteria 588
273 Ga0495580_0199124 3300046472 Bacteria 1380
274 Ga0495582_0000708 3300046473 Bacteria 18420
275 Ga0495582_0022165 3300046473 Bacteria 3475
276 Ga0495582_0141314 3300046473 Bacteria 1364
277 Ga0495582_0196573 3300046473 Bacteria 1151
278 Ga0495605_0151369 3300046474 Bacteria 1035
279 Ga0495639_0000937 3300046475 Bacteria 13192
280 Ga0495662_0003189 3300046476 Bacteria 8284
281 Ga0495662_0109278 3300046476 Bacteria 1354
282 Ga0495662_0234018 3300046476 Bacteria 905
283 Ga0495662_0266859 3300046476 Bacteria 842
284 Ga0495664_0009584 3300046477 Bacteria 5420
285 Ga0495664_0389369 3300046477 Bacteria 837
286 Ga0495584_0136366 3300046491 Bacteria 1246
287 Ga0495584_0244548 3300046491 Bacteria 912
288 Ga0495585_0142393 3300046492 Bacteria 1255
289 Ga0495594_0099821 3300046499 Bacteria 1633
290 Ga0495594_0136515 3300046499 Bacteria 1390
291 Ga0495594_0236281 3300046499 Bacteria 1042
292 Ga0495594_0565587 3300046499 Bacteria 645
293 Ga0495596_0094391 3300046500 Bacteria 1161
294 Ga0495608_0009437 3300046511 Bacteria 6821
295 Ga0495608_0079886 3300046511 Bacteria 2126
296 Ga0495608_0310035 3300046511 Bacteria 976
297 Ga0495608_0410988 3300046511 Bacteria 827
298 Ga0495608_0731424 3300046511 Unclassified 587
299 Ga0495618_0047789 3300046514 Bacteria 2701
300 Ga0495618_0190231 3300046514 Bacteria 1301
301 Ga0495618_0217583 3300046514 Bacteria 1206
302 Ga0495618_0229829 3300046514 Bacteria 1168
303 Ga0495618_0300910 3300046514 Bacteria 997
304 Ga0495628_0014092 3300046516 Bacteria 6710
305 Ga0495628_0348624 3300046516 Bacteria 1089
306 Ga0495628_0585306 3300046516 Bacteria 798
307 Ga0495630_0020464 3300046517 Bacteria 4879
308 Ga0495630_0082597 3300046517 Bacteria 2425
309 Ga0495630_0090966 3300046517 Bacteria 2305
310 Ga0495630_0132324 3300046517 Bacteria 1894
311 Ga0495630_0289145 3300046517 Bacteria 1252
312 Ga0495630_0298344 3300046517 Bacteria 1231
313 Ga0495630_0536619 3300046517 Bacteria 897
314 Ga0495630_0666542 3300046517 Bacteria 796
315 Ga0495630_0767694 3300046517 Bacteria 736
316 Ga0495631_0407516 3300046518 Bacteria 579
317 Ga0495666_0026205 3300046526 Bacteria 2876
318 Ga0495666_0053585 3300046526 Bacteria 1935
319 Ga0495666_0086942 3300046526 Bacteria 1477
320 Ga0495642_0307806 3300046528 Bacteria 695
321 Ga0495652_0076262 3300046529 Bacteria 2781
322 Ga0495652_0133100 3300046529 Bacteria 1965
323 Ga0495665_0000595 3300046531 Bacteria 18495
324 Ga0495665_0231878 3300046531 Bacteria 953
325 Ga0495640_0010945 3300046533 Bacteria 6990
326 Ga0495640_0111177 3300046533 Bacteria 1790
327 Ga0495640_0263018 3300046533 Bacteria 1077
328 Ga0495640_0370091 3300046533 Bacteria 883
329 Ga0495640_0432380 3300046533 Bacteria 805
330 Ga0495640_0599872 3300046533 Unclassified 665
331 Ga0495586_0219239 3300046535 Bacteria 1081
332 Ga0495586_0494639 3300046535 Bacteria 705
333 Ga0495587_0063587 3300046536 Bacteria 2158
334 Ga0495587_0344166 3300046536 Unclassified 831
335 Ga0495645_0087649 3300046543 Bacteria 2226
336 Ga0495645_0188967 3300046543 Bacteria 1405
337 Ga0495645_0833854 3300046543 Bacteria 551
338 Ga0495667_0003948 3300046559 Bacteria 9947
339 Ga0495667_0032225 3300046559 Bacteria 3514
340 Ga0495667_0198777 3300046559 Bacteria 1283
341 Ga0495667_0205011 3300046559 Bacteria 1261
342 Ga0495634_0006807 3300046642 Bacteria 8651
343 Ga0495634_0027797 3300046642 Bacteria 3933
344 Ga0495634_0036200 3300046642 Bacteria 3376
345 Ga0495634_0054052 3300046642 Bacteria 2688
346 Ga0495634_0134528 3300046642 Bacteria 1573
347 Ga0495634_0316534 3300046642 Bacteria 940
348 Ga0495611_0031288 3300046648 Bacteria 2342
349 Ga0495635_0012715 3300046663 Bacteria 5902
350 Ga0495635_0083831 3300046663 Bacteria 2181
351 Ga0495635_0111726 3300046663 Bacteria 1866
352 Ga0495635_0147353 3300046663 Bacteria 1602
353 Ga0495635_0192691 3300046663 Bacteria 1383
354 Ga0495659_0087409 3300046664 Bacteria 1192
355 Ga0495659_0244566 3300046664 Unclassified 746
356 Ga0495661_0096998 3300046665 Bacteria 1666
357 Ga0495588_0566327 3300046674 Bacteria 595
358 Ga0495657_0027685 3300046675 Bacteria 3997
359 Ga0495657_0242140 3300046675 Unclassified 1088
360 Ga0495657_0379815 3300046675 Bacteria 833
361 Ga0495599_0095099 3300046678 Bacteria 1858
362 Ga0495599_0503979 3300046678 Bacteria 712
363 Ga0495623_0020727 3300046679 Bacteria 4249
364 Ga0495646_0117123 3300046680 Bacteria 1511
365 Ga0495646_0164881 3300046680 Bacteria 1224
366 Ga0495646_0168623 3300046680 Bacteria 1208
367 Ga0495647_0034450 3300046681 Bacteria 1896
368 Ga0495647_0045251 3300046681 Bacteria 1690
369 Ga0495647_0054259 3300046681 Bacteria 1565
370 Ga0495647_0640058 3300046681 Unclassified 500
371 Ga0495658_0000408 3300046683 Bacteria 24069
372 Ga0495658_0002069 3300046683 Bacteria 10168
373 Ga0495658_0048836 3300046683 Bacteria 2388
374 Ga0495613_0001195 3300046689 Bacteria 19811
375 Ga0495613_0015868 3300046689 Bacteria 5608
376 Ga0495613_0066040 3300046689 Bacteria 2643
377 Ga0495613_0265535 3300046689 Bacteria 1194
378 Ga0495613_0300794 3300046689 Bacteria 1110
379 Ga0495624_0006896 3300046690 Bacteria 8014
380 Ga0495624_0011644 3300046690 Bacteria 6041
381 Ga0495624_0017323 3300046690 Bacteria 4839
382 Ga0495600_0015018 3300046809 Bacteria 4890
383 Ga0495600_0029810 3300046809 Bacteria 3534
384 Ga0495600_0235103 3300046809 Bacteria 1169
385 Ga0495581_0000833 3300047315 Bacteria 16417
386 Ga0495581_0061588 3300047315 Bacteria 2168
387 Ga0495604_0042874 3300047317 Bacteria 3544
388 Ga0495604_0115537 3300047317 Bacteria 1950
389 Ga0495604_0353793 3300047317 Bacteria 975
390 Ga0495674_0007068 3300047319 Bacteria 10736
391 Ga0495674_0084322 3300047319 Bacteria 2723
392 Ga0495674_0088363 3300047319 Bacteria 2650
393 Ga0495674_0091913 3300047319 Bacteria 2591
394 Ga0495674_0470189 3300047319 Bacteria 1008
395 Ga0495674_0617490 3300047319 Bacteria 857
396 Ga0495676_0000262 3300047321 Bacteria 42485
397 Ga0495676_0388636 3300047321 Bacteria 927
398 Ga0495676_0487418 3300047321 Bacteria 810
399 Ga0495676_0737053 3300047321 Bacteria 636
400 Ga0495680_0002800 3300047322 Bacteria 17559
401 Ga0495680_0051127 3300047322 Bacteria 3228
402 Ga0495680_0065842 3300047322 Bacteria 2774
403 Ga0495680_0158923 3300047322 Bacteria 1642
404 Ga0495675_0350704 3300047444 Bacteria 868
405 Ga0495679_025332 3300047446 Bacteria 1985
406 Ga0495684_0001745 3300047471 Bacteria 17474
407 Ga0495684_0004256 3300047471 Bacteria 11171
408 Ga0495684_0085381 3300047471 Bacteria 2393
409 Ga0495684_0096253 3300047471 Bacteria 2241
410 Ga0495684_0102229 3300047471 Bacteria 2167
411 Ga0495593_0002225 3300047673 Bacteria 11636
412 Ga0495593_0040576 3300047673 Bacteria 2505
413 Ga0495602_0029837 3300048088 Bacteria 5184
414 Ga0495602_0150053 3300048088 Bacteria 1834
415 Ga0495602_0326753 3300048088 Bacteria 1114
416 Ga0495614_0053738 3300048089 Bacteria 1727
417 Ga0495614_0067641 3300048089 Bacteria 1537
418 Ga0496100_0007667 3300048903 Bacteria 5971
419 Ga0496101_0048189 3300048904 Unclassified 3061
420 Ga0496101_0158032 3300048904 Bacteria 1737
421 Ga0496102_0009250 3300048905 Bacteria 8451
422 Ga0496102_0109409 3300048905 Bacteria 2575
423 Ga0496102_0455662 3300048905 Bacteria 1200
424 Ga0496103_0018309 3300048906 Bacteria 4201
425 Ga0496103_0558182 3300048906 Bacteria 731
426 Ga0496104_0089588 3300048907 Bacteria 2939
427 Ga0496104_0196603 3300048907 Bacteria 1928
428 Ga0496104_1454466 3300048907 Bacteria 588
429 Ga0496105_0032617 3300048908 Bacteria 4275
430 Ga0496105_0087181 3300048908 Bacteria 2579
431 Ga0496105_0254608 3300048908 Bacteria 1421
432 Ga0496106_0002913 3300048909 Bacteria 12735
433 Ga0496107_0006420 3300048910 Bacteria 8085
434 Ga0496108_0011997 3300048911 Bacteria 7050
435 Ga0496108_0553430 3300048911 Bacteria 1004
436 Ga0496109_0072291 3300048912 Bacteria 3168
437 Ga0496110_0044117 3300048913 Bacteria 3893
438 Ga0496110_0472870 3300048913 Bacteria 1142
439 Ga0496111_0003164 3300048914 Bacteria 10138
440 Ga0496111_0132802 3300048914 Bacteria 1843
441 Ga0496112_0157379 3300048915 Bacteria 2239
442 Ga0496112_0548796 3300048915 Unclassified 1089
443 Ga0496112_0849270 3300048915 Bacteria 836
444 Ga0496113_1150255 3300048916 Bacteria 607
445 Ga0496113_1268598 3300048916 Bacteria 574
446 Ga0496114_0005660 3300048917 Bacteria 9797
447 Ga0496114_0073351 3300048917 Bacteria 2880
448 Ga0496114_0148167 3300048917 Bacteria 2035
449 Ga0496115_0007918 3300048918 Bacteria 7839
450 Ga0496115_0071716 3300048918 Bacteria 2809
451 Ga0496115_0073531 3300048918 Bacteria 2774
452 Ga0496115_1383940 3300048918 Bacteria 520
453 Ga0501067_0164348 3300049583 Bacteria 1236
454 Ga0501067_0229427 3300049583 Unclassified 1033
455 Ga0501069_0003948 3300049585 Bacteria 7648
456 Ga0501071_0229855 3300049587 Bacteria 1397
457 Ga0501071_0779847 3300049587 Bacteria 737
458 Ga0501045_1181119 3300049824 Unclassified 559
459 nmdc:mga05p37_221290_c1 3300050507 Bacteria 2284
460 nmdc:mga06r32_34811_c1 3300050510 Bacteria 4751
461 nmdc:mga08y16_1644088_c1 3300050511 Bacteria 599
462 nmdc:mga08y16_17548_c1 3300050511 Bacteria 7538
463 nmdc:mga0n895_13217_c1 3300050512 Bacteria 7438
464 nmdc:mga0n895_27552_c1 3300050512 Bacteria 5400
465 nmdc:mga0n895_769887_c1 3300050512 Bacteria 954
466 nmdc:mga0rr50_195118_c1 3300050513 Bacteria 1661
467 nmdc:mga0rr50_28668_c1 3300050513 Bacteria 3917
468 nmdc:mga08x19_12941_c1 3300050514 Bacteria 5037
469 nmdc:mga0a205_2605_c1 3300050515 Bacteria 15936
470 nmdc:mga0a205_264348_c1 3300050515 Bacteria 1598
471 nmdc:mga0a205_911780_c1 3300050515 Unclassified 726
472 Ga0495601_0109843 3300053077 Unclassified 1785
473 Ga0495601_0188693 3300053077 Bacteria 1347
474 Ga0495601_0193422 3300053077 Bacteria 1329
475 Ga0495601_0220240 3300053077 Bacteria 1239
476 Ga0495601_0263635 3300053077 Bacteria 1124
477 Ga0495601_0264945 3300053077 Bacteria 1121
478 Ga0495601_0329870 3300053077 Bacteria 993
479 Ga0495601_0935707 3300053077 Unclassified 547
480 Ga0495612_0028719 3300053078 Bacteria 2239
481 Ga0495612_0340345 3300053078 Bacteria 676
482 Ga0495612_0391727 3300053078 Bacteria 630
483 Ga0495595_0001011 3300053084 Bacteria 10826
484 Ga0495595_0005512 3300053084 Bacteria 5125
485 Ga0495595_0100232 3300053084 Bacteria 1397
486 Ga0495619_0018279 3300053085 Bacteria 4448
487 Ga0495619_0029827 3300053085 Bacteria 3527
488 Ga0495619_0051390 3300053085 Bacteria 2723
489 Ga0466962_0029222 3300061719 Bacteria 2638
490 Ga0466962_0029387 3300061719 Bacteria 2631
491 Ga0466962_0062564 3300061719 Bacteria 1777
492 Ga0466962_0064443 3300061719 Bacteria 1749
493 Ga0466962_0278502 3300061719 Bacteria 825
494 Ga0496100_0243785
495 rootH2_10213490
496 Ga0070683_100149329
497 Ga0070683_100170711
498 Ga0070677_10039320
499 Ga0070660_100415411
500 Ga0070675_100335053
501 Ga0070671_100057278
502 Ga0070671_100184533
503 Ga0070709_10006472
504 Ga0070714_100007455
505 Ga0070714_100052153
506 Ga0070714_100102751
507 Ga0070713_100436608
508 Ga0070713_101002471
509 Ga0070710_10031858
510 Ga0070710_10037106
511 Ga0070700_100458898
512 Ga0070708_100040156
513 Ga0070708_100541071
514 Ga0070663_100287212
515 Ga0070678_100527103
516 Ga0070685_10082716
517 Ga0070707_101370251
518 Ga0070699_100406985
519 Ga0070679_100195774
520 Ga0070684_100491261
521 Ga0068853_100107940
522 Ga0070672_100356035
523 Ga0070686_100611744
524 Ga0070695_100000051
525 Ga0070695_100286860
526 Ga0070695_100416889
527 Ga0070695_100659898
528 Ga0070696_100331364
529 Ga0070704_100034164
530 Ga0068855_100540403
531 Ga0068855_100863756
532 Ga0070664_100211203
533 Ga0068854_100195331
534 Ga0068856_100282494
535 Ga0068856_100329843
536 Ga0070702_100557448
537 Ga0068852_100140756
538 Ga0068852_101014170
539 Ga0068859_100130186
540 Ga0068861_100026352
541 Ga0068861_100861240
542 Ga0081455_10022719
543 Ga0081540_1008332
544 Ga0070717_10004804
545 Ga0070717_10006751
546 Ga0070717_10009595
547 Ga0070717_11381436
548 Ga0070715_10003379
549 Ga0070715_10121553
550 Ga0070716_100009244
551 Ga0070712_100379304
552 Ga0097621_100107204
553 Ga0075428_100193646
554 Ga0075428_100612940
555 Ga0075431_100122564
556 Ga0075433_10123396
557 Ga0075434_100002396
558 Ga0075434_100424007
559 Ga0075429_100416281
560 Ga0068865_100315604
561 Ga0075436_100022874
562 Ga0075436_100259707
563 Ga0097620_100130183
564 Ga0075435_100116440
565 Ga0075435_100199571
566 Ga0105240_10150660
567 Ga0105240_10192952
568 Ga0111539_10775549
569 Ga0105245_10016574
570 Ga0105245_10032043
571 Ga0105245_10050507
572 Ga0114129_10189589
573 Ga0105241_10413724
574 Ga0105242_10029946
575 Ga0105242_10253995
576 Ga0105248_10132469
577 Ga0105248_10213382
578 Ga0105248_10283516
579 Ga0105237_10093151
580 Ga0105237_10390898
581 Ga0105238_11703780
582 Ga0105249_10168877
583 Ga0105249_10191255
584 Ga0105239_10610225
585 Ga0105246_10623494
586 Ga0157373_10286314
587 Ga0157370_10448830
588 Ga0157369_10577709
589 Ga0157369_10800500
590 Ga0157374_10333099
591 Ga0163162_10137544
592 Ga0157372_11064543
593 Ga0157375_10364183
594 Ga0157380_10222591
595 Ga0157379_10153910
596 Ga0157376_10117787
597 Ga0207697_10473996
598 Ga0207692_10009257
599 Ga0207685_10012299
600 Ga0207699_10045561
601 Ga0207699_10106959
602 Ga0207695_10085052
603 Ga0207693_10001250
604 Ga0207693_10003465
605 Ga0207693_10148869
606 Ga0207663_10105005
607 Ga0207646_10612044
608 Ga0207687_10049312
609 Ga0207687_10232466
610 Ga0207687_11396189
611 Ga0207700_10091867
612 Ga0207700_10129421
613 Ga0207664_10024936
614 Ga0207664_10039088
615 Ga0207664_10056377
616 Ga0207664_10061618
617 Ga0207664_10168423
618 Ga0207664_10458628
619 Ga0207644_10789109
620 Ga0207669_10224663
621 Ga0207665_10000620
622 Ga0207665_10319932
623 Ga0207711_10179451
624 Ga0207711_10276677
625 Ga0207711_10382215
626 Ga0207677_10355401
627 Ga0207708_10674218
628 Ga0207702_10062722
629 Ga0207675_100582758
630 Ga0207683_10082987
631 Ga0207683_10725796
632 Ga0207428_10003447
633 Ga0265319_1062147
634 Ga0265336_10001393
635 Ga0265338_10002351
636 Ga0265338_10009388
637 Ga0265338_10276883
638 Ga0265324_10049812
639 Ga0307408_100787324
640 Ga0265313_10023412
641 Ga0307409_100208630
642 Ga0307409_100480232
643 Ga0307416_100501523
644 Ga0307415_100060650
645 Ga0373959_0074738
646 Ga0373926_0005984
647 Ga0373926_0067772
648 Ga0373934_0446241
649 Ga0373944_0001747
650 Ga0373944_0082333
651 Ga0373949_0082716
652 Ga0373936_0078267
653 Ga0373939_0044466
654 Ga0373945_0001152
655 Ga0373945_0275919
656 Ga0373943_0000484
657 Ga0373943_0008950
658 Ga0373946_0024384
659 Ga0373955_0134431
660 Ga0373955_0563882
661 Ga0373931_0265230
662 Ga0373931_0561686
663 Ga0373935_0043557
664 Ga0373935_0331139
665 Ga0373927_0135087
666 Ga0373927_0347106
667 Ga0373947_0000968
668 Ga0373947_0013258
669 Ga0373947_0157155
670 Ga0373947_0253633
671 Ga0373937_0387255
672 Ga0373925_0003980
673 Ga0373925_0105513
674 Ga0395899_0124090
675 Ga0395900_0823283
676 Ga0395898_0039691
677 Ga0395898_0410631
678 Ga0395901_0034132
679 Ga0436360_1309095
680 Ga0436363_0006142
681 Ga0436363_1367952
682 Ga0451807_0875620
683 Ga0451839_0436633
684 Ga0439448_0044191
685 Ga0439463_053701
686 Ga0439458_0066912
687 Ga0439458_0126519
688 Ga0466969_0011692
689 Ga0466969_0396723
690 Ga0466965_0066615
691 Ga0466965_0089403
692 Ga0466966_0034137
693 Ga0466966_0057743
694 Ga0466966_0602581
695 Ga0466961_0039784
696 Ga0466961_0048560
697 Ga0466961_0086341
698 Ga0466961_0181340
699 Ga0466963_0000324
700 Ga0466963_0017377
701 Ga0466963_0060556
702 Ga0466963_0063590
703 Ga0466963_0111699
704 Ga0466963_0138572
705 Ga0466963_0361040
706 Ga0466963_0941316
707 Ga0466963_1221542
708 Ga0466963_1258257
709 Ga0466964_0000706
710 Ga0466964_0003986
711 Ga0466964_0123884
712 Ga0466971_0052153
713 Ga0466971_0052761
714 Ga0466971_0111376
715 Ga0466968_0001306
716 Ga0466968_0025195
717 Ga0466968_0028157
718 Ga0466968_0048598
719 Ga0466968_0115716
720 Ga0466970_0009035
721 Ga0466957_0001047
722 Ga0466957_0110650
723 Ga0466957_0226551
724 Ga0466957_0666345
725 Ga0466959_0000319
726 Ga0466959_0031345
727 Ga0466959_0245524
728 Ga0451576_2051388
729 Ga0466958_0001642
730 Ga0466958_0007911
731 Ga0466958_0076807
732 Ga0466967_0000427
733 Ga0466967_0005935
734 Ga0466967_0015356
735 Ga0466967_0023400
736 Ga0466967_0248266
737 Ga0466967_0311625
738 Ga0466967_0461532
739 Ga0466967_0657642
740 Ga0466967_1000198
741 Ga0495592_0054955
742 Ga0495592_0133602
743 Ga0495592_0727416
744 Ga0495603_0006799
745 Ga0495603_0062320
746 Ga0495629_0001312
747 Ga0495629_0013957
748 Ga0495629_0059981
749 Ga0495629_0130275
750 Ga0495629_0180596
751 Ga0495629_0181786
752 Ga0495641_0000109
753 Ga0495641_0020780
754 Ga0495641_0031947
755 Ga0495641_0502962
756 Ga0495651_0060772
757 Ga0495651_0098162
758 Ga0495651_0138591
759 Ga0495651_0398313
760 Ga0495651_0781141
761 Ga0495653_0164318
762 Ga0495653_0174551
763 Ga0495653_0199663
764 Ga0495653_0351067
765 Ga0495653_0752764
766 Ga0495580_0199124
767 Ga0495582_0000708
768 Ga0495582_0022165
769 Ga0495582_0141314
770 Ga0495582_0196573
771 Ga0495605_0151369
772 Ga0495639_0000937
773 Ga0495662_0003189
774 Ga0495662_0109278
775 Ga0495662_0234018
776 Ga0495662_0266859
777 Ga0495664_0009584
778 Ga0495664_0389369
779 Ga0495584_0136366
780 Ga0495584_0244548
781 Ga0495585_0142393
782 Ga0495594_0099821
783 Ga0495594_0136515
784 Ga0495594_0236281
785 Ga0495594_0565587
786 Ga0495596_0094391
787 Ga0495608_0009437
788 Ga0495608_0079886
789 Ga0495608_0310035
790 Ga0495608_0410988
791 Ga0495608_0731424
792 Ga0495618_0047789
793 Ga0495618_0190231
794 Ga0495618_0217583
795 Ga0495618_0229829
796 Ga0495618_0300910
797 Ga0495628_0014092
798 Ga0495628_0348624
799 Ga0495628_0585306
800 Ga0495630_0020464
801 Ga0495630_0082597
802 Ga0495630_0090966
803 Ga0495630_0132324
804 Ga0495630_0289145
805 Ga0495630_0298344
806 Ga0495630_0536619
807 Ga0495630_0666542
808 Ga0495630_0767694
809 Ga0495631_0407516
810 Ga0495666_0026205
811 Ga0495666_0053585
812 Ga0495666_0086942
813 Ga0495642_0307806
814 Ga0495652_0076262
815 Ga0495652_0133100
816 Ga0495665_0000595
817 Ga0495665_0231878
818 Ga0495640_0010945
819 Ga0495640_0111177
820 Ga0495640_0263018
821 Ga0495640_0370091
822 Ga0495640_0432380
823 Ga0495640_0599872
824 Ga0495586_0219239
825 Ga0495586_0494639
826 Ga0495587_0063587
827 Ga0495587_0344166
828 Ga0495645_0087649
829 Ga0495645_0188967
830 Ga0495645_0833854
831 Ga0495667_0003948
832 Ga0495667_0032225
833 Ga0495667_0198777
834 Ga0495667_0205011
835 Ga0495634_0006807
836 Ga0495634_0027797
837 Ga0495634_0036200
838 Ga0495634_0054052
839 Ga0495634_0134528
840 Ga0495634_0316534
841 Ga0495611_0031288
842 Ga0495635_0012715
843 Ga0495635_0083831
844 Ga0495635_0111726
845 Ga0495635_0147353
846 Ga0495635_0192691
847 Ga0495659_0087409
848 Ga0495659_0244566
849 Ga0495661_0096998
850 Ga0495588_0566327
851 Ga0495657_0027685
852 Ga0495657_0242140
853 Ga0495657_0379815
854 Ga0495599_0095099
855 Ga0495599_0503979
856 Ga0495623_0020727
857 Ga0495646_0117123
858 Ga0495646_0164881
859 Ga0495646_0168623
860 Ga0495647_0034450
861 Ga0495647_0045251
862 Ga0495647_0054259
863 Ga0495647_0640058
864 Ga0495658_0000408
865 Ga0495658_0002069
866 Ga0495658_0048836
867 Ga0495613_0001195
868 Ga0495613_0015868
869 Ga0495613_0066040
870 Ga0495613_0265535
871 Ga0495613_0300794
872 Ga0495624_0006896
873 Ga0495624_0011644
874 Ga0495624_0017323
875 Ga0495600_0015018
876 Ga0495600_0029810
877 Ga0495600_0235103
878 Ga0495581_0000833
879 Ga0495581_0061588
880 Ga0495604_0042874
881 Ga0495604_0115537
882 Ga0495604_0353793
883 Ga0495674_0007068
884 Ga0495674_0084322
885 Ga0495674_0088363
886 Ga0495674_0091913
887 Ga0495674_0470189
888 Ga0495674_0617490
889 Ga0495676_0000262
890 Ga0495676_0388636
891 Ga0495676_0487418
892 Ga0495676_0737053
893 Ga0495680_0002800
894 Ga0495680_0051127
895 Ga0495680_0065842
896 Ga0495680_0158923
897 Ga0495675_0350704
898 Ga0495679_025332
899 Ga0495684_0001745
900 Ga0495684_0004256
901 Ga0495684_0085381
902 Ga0495684_0096253
903 Ga0495684_0102229
904 Ga0495593_0002225
905 Ga0495593_0040576
906 Ga0495602_0029837
907 Ga0495602_0150053
908 Ga0495602_0326753
909 Ga0495614_0053738
910 Ga0495614_0067641
911 Ga0496100_0007667
912 Ga0496101_0048189
913 Ga0496101_0158032
914 Ga0496102_0009250
915 Ga0496102_0109409
916 Ga0496102_0455662
917 Ga0496103_0018309
918 Ga0496103_0558182
919 Ga0496104_0089588
920 Ga0496104_0196603
921 Ga0496104_1454466
922 Ga0496105_0032617
923 Ga0496105_0087181
924 Ga0496105_0254608
925 Ga0496106_0002913
926 Ga0496107_0006420
927 Ga0496108_0011997
928 Ga0496108_0553430
929 Ga0496109_0072291
930 Ga0496110_0044117
931 Ga0496110_0472870
932 Ga0496111_0003164
933 Ga0496111_0132802
934 Ga0496112_0157379
935 Ga0496112_0548796
936 Ga0496112_0849270
937 Ga0496113_1150255
938 Ga0496113_1268598
939 Ga0496114_0005660
940 Ga0496114_0073351
941 Ga0496114_0148167
942 Ga0496115_0007918
943 Ga0496115_0071716
944 Ga0496115_0073531
945 Ga0496115_1383940
946 Ga0501067_0164348
947 Ga0501067_0229427
948 Ga0501069_0003948
949 Ga0501071_0229855
950 Ga0501071_0779847
951 Ga0501045_1181119
952 nmdc:mga05p37_221290_c1
953 nmdc:mga06r32_34811_c1
954 nmdc:mga08y16_1644088_c1
955 nmdc:mga08y16_17548_c1
956 nmdc:mga0n895_13217_c1
957 nmdc:mga0n895_27552_c1
958 nmdc:mga0n895_769887_c1
959 nmdc:mga0rr50_195118_c1
960 nmdc:mga0rr50_28668_c1
961 nmdc:mga08x19_12941_c1
962 nmdc:mga0a205_2605_c1
963 nmdc:mga0a205_264348_c1
964 nmdc:mga0a205_911780_c1
965 Ga0495601_0109843
966 Ga0495601_0188693
967 Ga0495601_0193422
968 Ga0495601_0220240
969 Ga0495601_0263635
970 Ga0495601_0264945
971 Ga0495601_0329870
972 Ga0495601_0935707
973 Ga0495612_0028719
974 Ga0495612_0340345
975 Ga0495612_0391727
976 Ga0495595_0001011
977 Ga0495595_0005512
978 Ga0495595_0100232
979 Ga0495619_0018279
980 Ga0495619_0029827
981 Ga0495619_0051390
982 Ga0466962_0029222
983 Ga0466962_0029387
984 Ga0466962_0062564
985 Ga0466962_0064443
986 Ga0466962_0278502

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04237

YjbR

YjbR

9

113

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
6kpd-assembly1.cif.gz_C-2 the crystal structure of the baldibis/idd9 bound to the homodimeric scl3 0.6755 10 31
1r9c-assembly1.cif.gz_B crystal structure of fosfomycin resistance protein fosx from mesorhizobium loti 0.6733 2 31
6kpb-assembly1.cif.gz_C-2 the crystal structure of the jackdaw/idd10 bound to the homodimeric scl3 0.6699 12 31
6jp2-assembly2.cif.gz_D crystal structure of pyrrolysyl-trna synthetase from methanomethylophilus alvus 0.6618 14 34
2fki-assembly1.cif.gz_A nmr structure of protein yjbr from escherichia coli; northeast structural genomics consortium target er226 0.6374 2 125
ID Description Score Start End Superfamily
af_P9WL91_4_123_3.30.70.1230 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleotide cyclase, GGDEF domain 0.8248 1 121 3.30.70.1230
af_P9WL91_4_123_3.30.70.1230 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleotide cyclase, GGDEF domain 0.8122 1 121 3.30.70.1230
3swgA02 Alpha Beta;Alpha-beta prism;UDP-n-acetylglucosamine1-carboxyvinyl-transferase; Chain;Enolpyruvate transferase domain 0.7016 2 37 3.65.10.10
af_P0AAT2_2_121_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7 2 122 3.90.1150.30
af_P0AF50_1_117_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.6977 1 124 3.90.1150.30
ID Description Score Start End GO Terms
AF-A0A538G618-F1-model_v4 MmcQ/YjbR family DNA-binding protein 0.9889 1 127
AF-A0A538IJE1-F1-model_v4 MmcQ/YjbR family DNA-binding protein 0.9852 31 126
AF-A0A538G618-F1-model_v4 MmcQ/YjbR family DNA-binding protein 0.9737 1 127
AF-A0A849HHD2-F1-model_v4 MmcQ/YjbR family DNA-binding protein 0.9718 23 130
AF-A0A4Q2SDX4-F1-model_v4 MmcQ/YjbR family DNA-binding protein 0.9691 11 127

Map