F454462

General Info

Members Datasets Scaffolds Average Seq Length
493 206 986 182

Family's Representative Sequence

Representative Sequence 3300042157|Ga0439458_0011074|Ga0439458_0011074_439_1092
Length 217
Sequence MILCHPRGFVVIICGASKVDRLEGMFHMKRFLPLLMIALVLSLSVSAQEHTRRPPATPSXXXXPSKIDNGGWAMFTSEEGRFSVLMPEIPTDKTETTDSSHGPYTTHLFVVRDTTSVYLIGWVDYDPSFNFNRQAELEANRDNFVKGINARLLTTRPTIIDGYSAIEFTAETDDRIFKSRVYMVGRRPYQIVIGSPKDMDDSAIAKRFFSSFKVSLP

Samples

Sample ID Description Type Environment
1 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
145 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
146 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
147 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
148 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
149 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
150 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
151 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
152 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
153 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
154 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
155 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
156 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
157 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
158 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
159 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
160 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
161 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
162 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
163 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
164 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
165 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
166 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
167 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
168 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
169 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
170 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
171 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
172 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
173 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
174 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
175 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
176 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
177 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
178 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
179 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
180 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
181 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
182 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
183 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
184 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
185 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
186 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
187 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
188 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
189 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
190 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
191 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
192 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
193 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
194 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
195 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
196 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
197 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
198 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
199 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
200 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
201 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
202 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
203 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
204 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
205 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
206 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.81
Rhizosphere 99.19
Stem 0
Stem Tuber 0
Unclassified 18.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439458_0011074 3300042157 Bacteria 2014
2 CNAas_1000832 3300000532 Bacteria 2928
3 JGI24751J29686_10000372 3300002459 Bacteria 15230
4 Ga0065712_10115135 3300005290 Bacteria 1756
5 Ga0065715_10006853 3300005293 Bacteria 3400
6 Ga0065715_10101004 3300005293 Bacteria 3233
7 Ga0065715_10297078 3300005293 Bacteria 1050
8 Ga0065707_10002870 3300005295 Bacteria 4655
9 Ga0065707_10224812 3300005295 Bacteria 1211
10 Ga0070676_10193877 3300005328 Unclassified 1328
11 Ga0070690_100002501 3300005330 Bacteria 9887
12 Ga0070690_100043799 3300005330 Bacteria 2839
13 Ga0070670_100032204 3300005331 Bacteria 4515
14 Ga0070670_100354013 3300005331 Bacteria 1290
15 Ga0070670_100666565 3300005331 Bacteria 934
16 Ga0070670_101427454 3300005331 Unclassified 635
17 Ga0068869_100020618 3300005334 Bacteria 4522
18 Ga0068869_100078502 3300005334 Unclassified 2459
19 Ga0068869_100111452 3300005334 Bacteria 2082
20 Ga0068869_100229638 3300005334 Bacteria 1474
21 Ga0070680_100000838 3300005336 Bacteria 21751
22 Ga0070680_100196161 3300005336 Unclassified 1702
23 Ga0070682_100000491 3300005337 Bacteria 24828
24 Ga0070682_100010746 3300005337 Bacteria 5206
25 Ga0068868_100016651 3300005338 Bacteria 5466
26 Ga0068868_100297013 3300005338 Bacteria 1371
27 Ga0070689_100170119 3300005340 Bacteria 1765
28 Ga0070689_100545626 3300005340 Bacteria 998
29 Ga0070687_100130393 3300005343 Bacteria 1451
30 Ga0070687_100564883 3300005343 Unclassified 776
31 Ga0070661_100801015 3300005344 Bacteria 773
32 Ga0070692_10015400 3300005345 Bacteria 3617
33 Ga0070692_10072657 3300005345 Bacteria 1836
34 Ga0070692_10088581 3300005345 Bacteria 1679
35 Ga0070692_10275476 3300005345 Bacteria 1017
36 Ga0070692_10279300 3300005345 Bacteria 1011
37 Ga0070692_10366283 3300005345 Bacteria 900
38 Ga0070669_100038717 3300005353 Bacteria 3462
39 Ga0070669_100455344 3300005353 Unclassified 1055
40 Ga0070669_101009622 3300005353 Unclassified 714
41 Ga0070675_100072097 3300005354 Bacteria 2867
42 Ga0070675_100229893 3300005354 Bacteria 1618
43 Ga0070675_100953546 3300005354 Unclassified 787
44 Ga0070671_100033984 3300005355 Bacteria 4220
45 Ga0070671_100524889 3300005355 Bacteria 1020
46 Ga0070673_100094268 3300005364 Bacteria 2453
47 Ga0070673_100120578 3300005364 Bacteria 2187
48 Ga0070673_100194921 3300005364 Unclassified 1742
49 Ga0070659_100085864 3300005366 Bacteria 2517
50 Ga0070659_100441579 3300005366 Bacteria 1102
51 Ga0070667_100202288 3300005367 Bacteria 1763
52 Ga0070709_10336223 3300005434 Bacteria 1112
53 Ga0070701_10034077 3300005438 Bacteria 2549
54 Ga0070701_10262774 3300005438 Bacteria 1047
55 Ga0070705_100178613 3300005440 Bacteria 1436
56 Ga0070700_100034229 3300005441 Bacteria 3067
57 Ga0070700_100243318 3300005441 Bacteria 1287
58 Ga0070694_100054979 3300005444 Bacteria 2698
59 Ga0070694_100110325 3300005444 Bacteria 1959
60 Ga0070694_100198102 3300005444 Bacteria 1495
61 Ga0070694_100247224 3300005444 Bacteria 1348
62 Ga0070694_100428808 3300005444 Bacteria 1040
63 Ga0070708_100465209 3300005445 Bacteria 1193
64 Ga0070678_100567483 3300005456 Bacteria 1009
65 Ga0070681_10000210 3300005458 Bacteria 45431
66 Ga0068867_100011979 3300005459 Bacteria 6127
67 Ga0068867_100085659 3300005459 Bacteria 2382
68 Ga0068867_100119953 3300005459 Bacteria 2031
69 Ga0070707_100046331 3300005468 Bacteria 4161
70 Ga0070707_100473409 3300005468 Bacteria 1214
71 Ga0070698_100024514 3300005471 Bacteria 6294
72 Ga0070699_100089915 3300005518 Bacteria 2683
73 Ga0070699_100252787 3300005518 Bacteria 1575
74 Ga0070699_100272922 3300005518 Bacteria 1514
75 Ga0070679_100000055 3300005530 Bacteria 84504
76 Ga0070679_100489443 3300005530 Unclassified 1174
77 Ga0070697_100028483 3300005536 Unclassified 4473
78 Ga0070697_100062961 3300005536 Bacteria 3029
79 Ga0068853_100108363 3300005539 Bacteria 2464
80 Ga0068853_100361401 3300005539 Bacteria 1352
81 Ga0068853_100367068 3300005539 Bacteria 1342
82 Ga0068853_100384076 3300005539 Bacteria 1312
83 Ga0070672_100072695 3300005543 Bacteria 2739
84 Ga0070672_100505381 3300005543 Unclassified 1046
85 Ga0070686_100009198 3300005544 Bacteria 5543
86 Ga0070686_100199426 3300005544 Bacteria 1433
87 Ga0070686_100835266 3300005544 Unclassified 745
88 Ga0070695_100029618 3300005545 Bacteria 3402
89 Ga0070695_100073465 3300005545 Bacteria 2245
90 Ga0070695_100239530 3300005545 Bacteria 1315
91 Ga0070695_100487854 3300005545 Unclassified 951
92 Ga0070695_100735394 3300005545 Unclassified 786
93 Ga0070695_100855239 3300005545 Bacteria 732
94 Ga0070696_100124500 3300005546 Bacteria 1869
95 Ga0070696_100147942 3300005546 Bacteria 1722
96 Ga0070696_100321388 3300005546 Bacteria 1191
97 Ga0070696_100444971 3300005546 Bacteria 1021
98 Ga0070696_100705036 3300005546 Bacteria 823
99 Ga0070693_100059494 3300005547 Bacteria 2215
100 Ga0070693_100073064 3300005547 Bacteria 2025
101 Ga0070693_100201257 3300005547 Bacteria 1294
102 Ga0070693_100354099 3300005547 Bacteria 1006
103 Ga0070704_100006637 3300005549 Bacteria 6832
104 Ga0070704_100031263 3300005549 Bacteria 3579
105 Ga0070704_100463184 3300005549 Bacteria 1094
106 Ga0070664_100273905 3300005564 Bacteria 1521
107 Ga0070664_100538820 3300005564 Bacteria 1079
108 Ga0068857_100303743 3300005577 Unclassified 1471
109 Ga0068857_100504781 3300005577 Bacteria 1135
110 Ga0068857_101067916 3300005577 Unclassified 779
111 Ga0068857_101474435 3300005577 Unclassified 663
112 Ga0068854_100313578 3300005578 Bacteria 1273
113 Ga0068854_100374261 3300005578 Bacteria 1172
114 Ga0068854_100729387 3300005578 Bacteria 858
115 Ga0068854_101190397 3300005578 Unclassified 682
116 Ga0068856_100007846 3300005614 Bacteria 10424
117 Ga0070702_100019854 3300005615 Bacteria 3512
118 Ga0070702_100049388 3300005615 Bacteria 2399
119 Ga0068852_100138082 3300005616 Bacteria 2253
120 Ga0068859_100004376 3300005617 Bacteria 14406
121 Ga0068859_100055776 3300005617 Bacteria 3975
122 Ga0068859_100062657 3300005617 Bacteria 3749
123 Ga0068859_100067877 3300005617 Bacteria 3601
124 Ga0068859_100088359 3300005617 Bacteria 3148
125 Ga0068859_100136690 3300005617 Bacteria 2524
126 Ga0068859_100378836 3300005617 Bacteria 1510
127 Ga0068859_100505392 3300005617 Bacteria 1304
128 Ga0068859_100582143 3300005617 Bacteria 1213
129 Ga0068859_100647637 3300005617 Bacteria 1149
130 Ga0068864_100021330 3300005618 Bacteria 5427
131 Ga0068864_100159652 3300005618 Bacteria 2049
132 Ga0068864_100237238 3300005618 Bacteria 1688
133 Ga0068864_100445401 3300005618 Bacteria 1238
134 Ga0068864_100673780 3300005618 Unclassified 1008
135 Ga0068864_100866224 3300005618 Bacteria 891
136 Ga0068866_10016058 3300005718 Bacteria 3340
137 Ga0068861_100032793 3300005719 Unclassified 3827
138 Ga0068861_100076494 3300005719 Bacteria 2608
139 Ga0068861_100587922 3300005719 Unclassified 1020
140 Ga0068870_10036607 3300005840 Bacteria 2526
141 Ga0068870_10094437 3300005840 Bacteria 1679
142 Ga0068870_10105274 3300005840 Bacteria 1602
143 Ga0068870_10169248 3300005840 Unclassified 1302
144 Ga0068863_100118714 3300005841 Bacteria 2521
145 Ga0068863_100122183 3300005841 Bacteria 2484
146 Ga0068863_100207764 3300005841 Bacteria 1885
147 Ga0068863_100780217 3300005841 Bacteria 952
148 Ga0068863_101238264 3300005841 Unclassified 752
149 Ga0068858_100104268 3300005842 Bacteria 2646
150 Ga0068858_100163667 3300005842 Bacteria 2095
151 Ga0068860_100033396 3300005843 Bacteria 4937
152 Ga0068860_100099474 3300005843 Bacteria 2774
153 Ga0068860_100129749 3300005843 Bacteria 2418
154 Ga0068860_100167942 3300005843 Bacteria 2119
155 Ga0068860_100350442 3300005843 Unclassified 1453
156 Ga0068860_100442218 3300005843 Bacteria 1292
157 Ga0068860_100552506 3300005843 Bacteria 1154
158 Ga0068860_100748187 3300005843 Bacteria 989
159 Ga0068862_100046786 3300005844 Bacteria 3690
160 Ga0068862_100542857 3300005844 Bacteria 1109
161 Ga0068862_100869325 3300005844 Unclassified 885
162 Ga0081539_10000752 3300005985 Bacteria 64385
163 Ga0070716_100064301 3300006173 Bacteria 2133
164 Ga0097621_100005126 3300006237 Bacteria 9204
165 Ga0097621_100156899 3300006237 Unclassified 1954
166 Ga0068871_100010458 3300006358 Bacteria 6773
167 Ga0068871_100158377 3300006358 Bacteria 1935
168 Ga0068871_100177437 3300006358 Bacteria 1829
169 Ga0075428_100089670 3300006844 Unclassified 3354
170 Ga0075431_100088665 3300006847 Bacteria 3193
171 Ga0075431_101061225 3300006847 Unclassified 776
172 Ga0075433_10097872 3300006852 Bacteria 2597
173 Ga0075433_10108134 3300006852 Bacteria 2466
174 Ga0075433_10316710 3300006852 Bacteria 1380
175 Ga0075433_10325427 3300006852 Bacteria 1360
176 Ga0075433_10559729 3300006852 Bacteria 1005
177 Ga0075433_10583847 3300006852 Bacteria 981
178 Ga0075433_11162091 3300006852 Unclassified 670
179 Ga0075434_100326545 3300006871 Bacteria 1555
180 Ga0075434_100477023 3300006871 Bacteria 1269
181 Ga0075434_100642247 3300006871 Unclassified 1080
182 Ga0075434_100884203 3300006871 Unclassified 908
183 Ga0075434_101466590 3300006871 Unclassified 692
184 Ga0068865_100002957 3300006881 Bacteria 10128
185 Ga0097620_100004376 3300006931 Bacteria 14406
186 Ga0097620_100055776 3300006931 Bacteria 3975
187 Ga0097620_100062657 3300006931 Bacteria 3749
188 Ga0097620_100067877 3300006931 Bacteria 3601
189 Ga0097620_100088362 3300006931 Bacteria 3148
190 Ga0097620_100136691 3300006931 Bacteria 2524
191 Ga0097620_100378815 3300006931 Bacteria 1510
192 Ga0097620_100505389 3300006931 Bacteria 1304
193 Ga0097620_100582131 3300006931 Bacteria 1213
194 Ga0097620_100647545 3300006931 Bacteria 1149
195 Ga0097620_100774510 3300006931 Bacteria 1048
196 Ga0075435_100423402 3300007076 Bacteria 1147
197 Ga0105240_10179979 3300009093 Bacteria 2496
198 Ga0111539_10002867 3300009094 Bacteria 22888
199 Ga0111539_10832800 3300009094 Bacteria 1074
200 Ga0105245_10810438 3300009098 Bacteria 975
201 Ga0105247_10002781 3300009101 Bacteria 11713
202 Ga0105247_10757154 3300009101 Unclassified 737
203 Ga0114129_10005568 3300009147 Bacteria 17817
204 Ga0114129_10192410 3300009147 Bacteria 2769
205 Ga0114129_10766140 3300009147 Bacteria 1234
206 Ga0105243_10002466 3300009148 Bacteria 15447
207 Ga0105243_10238803 3300009148 Bacteria 1616
208 Ga0105243_10268260 3300009148 Unclassified 1531
209 Ga0105243_10415479 3300009148 Bacteria 1253
210 Ga0105243_10435051 3300009148 Bacteria 1227
211 Ga0105243_10512552 3300009148 Bacteria 1139
212 Ga0105243_10818104 3300009148 Unclassified 920
213 Ga0105241_10206847 3300009174 Bacteria 1642
214 Ga0105241_10259055 3300009174 Bacteria 1478
215 Ga0105241_10305957 3300009174 Bacteria 1366
216 Ga0105241_10315085 3300009174 Bacteria 1347
217 Ga0105241_10374383 3300009174 Bacteria 1242
218 Ga0105241_10507277 3300009174 Bacteria 1077
219 Ga0105242_10056136 3300009176 Bacteria 3222
220 Ga0105248_10029278 3300009177 Bacteria 6143
221 Ga0105248_10109638 3300009177 Bacteria 3113
222 Ga0105248_10162222 3300009177 Bacteria 2521
223 Ga0105248_10593995 3300009177 Bacteria 1249
224 Ga0105248_10757997 3300009177 Unclassified 1095
225 Ga0105237_10083537 3300009545 Bacteria 3185
226 Ga0105238_10025491 3300009551 Bacteria 6028
227 Ga0105238_10028954 3300009551 Bacteria 5641
228 Ga0105238_10334361 3300009551 Bacteria 1502
229 Ga0105238_10458829 3300009551 Bacteria 1272
230 Ga0105238_11192950 3300009551 Bacteria 785
231 Ga0105249_10004074 3300009553 Bacteria 12607
232 Ga0105249_10102647 3300009553 Bacteria 2692
233 Ga0105249_10312628 3300009553 Bacteria 1580
234 Ga0105249_10387072 3300009553 Bacteria 1426
235 Ga0105246_10084504 3300011119 Bacteria 2271
236 Ga0105246_10166175 3300011119 Bacteria 1685
237 Ga0105246_10613862 3300011119 Bacteria 942
238 Ga0157373_10008931 3300013100 Bacteria 7414
239 Ga0157373_10091133 3300013100 Bacteria 2147
240 Ga0157373_10123813 3300013100 Bacteria 1818
241 Ga0157373_10342456 3300013100 Unclassified 1066
242 Ga0157373_10615461 3300013100 Unclassified 791
243 Ga0157378_10106537 3300013297 Bacteria 2564
244 Ga0157378_10272643 3300013297 Bacteria 1628
245 Ga0157378_10942170 3300013297 Bacteria 896
246 Ga0163162_10069221 3300013306 Bacteria 3581
247 Ga0163162_10364706 3300013306 Bacteria 1577
248 Ga0163162_10516558 3300013306 Bacteria 1324
249 Ga0163162_10525555 3300013306 Bacteria 1312
250 Ga0163162_11419808 3300013306 Unclassified 790
251 Ga0157372_10018977 3300013307 Bacteria 7400
252 Ga0157372_10743340 3300013307 Bacteria 1141
253 Ga0157372_10968785 3300013307 Bacteria 986
254 Ga0157375_10027368 3300013308 Bacteria 5329
255 Ga0157375_10420335 3300013308 Bacteria 1503
256 Ga0163163_10000568 3300014325 Bacteria 32437
257 Ga0163163_10005674 3300014325 Bacteria 10820
258 Ga0163163_10072482 3300014325 Bacteria 3434
259 Ga0163163_11109751 3300014325 Bacteria 854
260 Ga0157380_10043585 3300014326 Bacteria 3513
261 Ga0182008_10270471 3300014497 Bacteria 881
262 Ga0157379_10194537 3300014968 Bacteria 1833
263 Ga0163161_10020606 3300017792 Bacteria 4629
264 Ga0207697_10076060 3300025315 Bacteria 1411
265 Ga0207642_10098602 3300025899 Bacteria 1461
266 Ga0207710_10001436 3300025900 Bacteria 11895
267 Ga0207688_10487264 3300025901 Unclassified 771
268 Ga0207647_10025301 3300025904 Bacteria 3903
269 Ga0207645_10039880 3300025907 Bacteria 3008
270 Ga0207645_10059474 3300025907 Unclassified 2440
271 Ga0207643_10001161 3300025908 Bacteria 15657
272 Ga0207643_10145404 3300025908 Unclassified 1418
273 Ga0207654_10144514 3300025911 Bacteria 1521
274 Ga0207654_10197819 3300025911 Bacteria 1321
275 Ga0207654_10299357 3300025911 Bacteria 1093
276 Ga0207654_10306001 3300025911 Bacteria 1082
277 Ga0207654_10326332 3300025911 Bacteria 1051
278 Ga0207707_10000003 3300025912 Bacteria 642592
279 Ga0207707_10059828 3300025912 Bacteria 3315
280 Ga0207671_10058030 3300025914 Bacteria 2869
281 Ga0207660_10001940 3300025917 Bacteria 13810
282 Ga0207660_10104860 3300025917 Bacteria 2117
283 Ga0207660_10122548 3300025917 Unclassified 1970
284 Ga0207649_10454233 3300025920 Unclassified 967
285 Ga0207652_10000111 3300025921 Bacteria 88571
286 Ga0207646_10078987 3300025922 Bacteria 2942
287 Ga0207646_10110746 3300025922 Bacteria 2463
288 Ga0207681_10240289 3300025923 Bacteria 1409
289 Ga0207681_10256218 3300025923 Bacteria 1368
290 Ga0207681_10354710 3300025923 Unclassified 1175
291 Ga0207694_10000987 3300025924 Bacteria 24924
292 Ga0207694_10028862 3300025924 Bacteria 4232
293 Ga0207694_10213602 3300025924 Unclassified 1572
294 Ga0207650_10000103 3300025925 Bacteria 111316
295 Ga0207650_10356939 3300025925 Bacteria 1203
296 Ga0207659_10075700 3300025926 Bacteria 2471
297 Ga0207687_10050388 3300025927 Bacteria 2898
298 Ga0207644_10097143 3300025931 Bacteria 2206
299 Ga0207644_10578447 3300025931 Bacteria 931
300 Ga0207690_10067094 3300025932 Bacteria 2460
301 Ga0207690_10227926 3300025932 Bacteria 1429
302 Ga0207706_10194936 3300025933 Bacteria 1777
303 Ga0207686_10042681 3300025934 Bacteria 2774
304 Ga0207686_10246429 3300025934 Unclassified 1303
305 Ga0207709_10021528 3300025935 Bacteria 3651
306 Ga0207709_10083487 3300025935 Bacteria 2066
307 Ga0207670_10001579 3300025936 Bacteria 11929
308 Ga0207670_10177842 3300025936 Bacteria 1601
309 Ga0207670_10596789 3300025936 Bacteria 906
310 Ga0207670_11002905 3300025936 Unclassified 703
311 Ga0207669_10022886 3300025937 Bacteria 3327
312 Ga0207704_10035147 3300025938 Bacteria 2868
313 Ga0207704_10145309 3300025938 Bacteria 1665
314 Ga0207665_10086305 3300025939 Bacteria 2167
315 Ga0207691_10000477 3300025940 Bacteria 39677
316 Ga0207691_10280624 3300025940 Bacteria 1433
317 Ga0207711_10003785 3300025941 Bacteria 13020
318 Ga0207711_10060837 3300025941 Bacteria 3255
319 Ga0207711_10081204 3300025941 Bacteria 2833
320 Ga0207711_10231398 3300025941 Bacteria 1693
321 Ga0207689_10008844 3300025942 Bacteria 8746
322 Ga0207689_10289462 3300025942 Bacteria 1357
323 Ga0207689_10324320 3300025942 Bacteria 1278
324 Ga0207689_10405157 3300025942 Bacteria 1137
325 Ga0207689_10426822 3300025942 Bacteria 1106
326 Ga0207689_10497347 3300025942 Bacteria 1021
327 Ga0207679_10183557 3300025945 Bacteria 1733
328 Ga0207679_10943495 3300025945 Unclassified 790
329 Ga0207651_10081068 3300025960 Bacteria 2338
330 Ga0207651_10414966 3300025960 Unclassified 1148
331 Ga0207651_10803062 3300025960 Bacteria 834
332 Ga0207712_10003132 3300025961 Bacteria 10544
333 Ga0207712_10409572 3300025961 Bacteria 1141
334 Ga0207712_10587345 3300025961 Bacteria 962
335 Ga0207640_10053359 3300025981 Bacteria 2639
336 Ga0207640_10233356 3300025981 Bacteria 1417
337 Ga0207640_10462769 3300025981 Bacteria 1048
338 Ga0207640_10781620 3300025981 Unclassified 825
339 Ga0207640_11023356 3300025981 Bacteria 728
340 Ga0207640_11083960 3300025981 Unclassified 708
341 Ga0207658_10034981 3300025986 Bacteria 3595
342 Ga0207677_10122728 3300026023 Bacteria 1957
343 Ga0207677_10441745 3300026023 Unclassified 1113
344 Ga0207703_10070854 3300026035 Bacteria 2878
345 Ga0207703_10839743 3300026035 Unclassified 878
346 Ga0207703_10908150 3300026035 Bacteria 843
347 Ga0207639_10018209 3300026041 Bacteria 4988
348 Ga0207639_10109422 3300026041 Bacteria 2248
349 Ga0207639_10209842 3300026041 Unclassified 1676
350 Ga0207639_10505668 3300026041 Unclassified 1105
351 Ga0207639_10683541 3300026041 Unclassified 951
352 Ga0207708_10002842 3300026075 Bacteria 12736
353 Ga0207708_10008376 3300026075 Bacteria 7653
354 Ga0207708_10110376 3300026075 Bacteria 2134
355 Ga0207708_10221223 3300026075 Unclassified 1517
356 Ga0207702_10027602 3300026078 Bacteria 4715
357 Ga0207641_10114380 3300026088 Bacteria 2398
358 Ga0207641_10143730 3300026088 Unclassified 2155
359 Ga0207641_10263040 3300026088 Bacteria 1616
360 Ga0207641_10394603 3300026088 Bacteria 1327
361 Ga0207641_11428361 3300026088 Unclassified 693
362 Ga0207648_10088008 3300026089 Bacteria 2711
363 Ga0207648_10234940 3300026089 Bacteria 1631
364 Ga0207648_10299344 3300026089 Bacteria 1442
365 Ga0207648_10390015 3300026089 Bacteria 1260
366 Ga0207648_10491065 3300026089 Bacteria 1122
367 Ga0207648_10728192 3300026089 Bacteria 920
368 Ga0207676_10085475 3300026095 Bacteria 2574
369 Ga0207676_10571706 3300026095 Unclassified 1082
370 Ga0207674_10037348 3300026116 Bacteria 5053
371 Ga0207674_10050527 3300026116 Bacteria 4247
372 Ga0207674_10267353 3300026116 Bacteria 1657
373 Ga0207675_100002631 3300026118 Bacteria 17750
374 Ga0207675_100033777 3300026118 Unclassified 4766
375 Ga0207675_100088561 3300026118 Bacteria 2908
376 Ga0207675_100441879 3300026118 Unclassified 1288
377 Ga0207683_10044798 3300026121 Bacteria 3868
378 Ga0207428_10023225 3300027907 Bacteria 5217
379 Ga0207428_10048036 3300027907 Bacteria 3426
380 Ga0268265_10878707 3300028380 Bacteria 879
381 Ga0268264_10098699 3300028381 Bacteria 2533
382 Ga0268264_10148255 3300028381 Bacteria 2100
383 Ga0268264_10170227 3300028381 Bacteria 1969
384 Ga0268264_10227757 3300028381 Bacteria 1719
385 Ga0268264_10739021 3300028381 Bacteria 980
386 Ga0307408_100098538 3300031548 Bacteria 2222
387 Ga0307408_100228595 3300031548 Bacteria 1522
388 Ga0307405_10222971 3300031731 Unclassified 1384
389 Ga0307405_10282215 3300031731 Bacteria 1251
390 Ga0307413_10162414 3300031824 Bacteria 1571
391 Ga0307410_10125225 3300031852 Bacteria 1880
392 Ga0307406_10009659 3300031901 Bacteria 5422
393 Ga0307406_10555283 3300031901 Bacteria 940
394 Ga0307406_10765431 3300031901 Unclassified 812
395 Ga0307412_10241059 3300031911 Bacteria 1398
396 Ga0307409_100030062 3300031995 Unclassified 3898
397 Ga0307409_100079260 3300031995 Bacteria 2646
398 Ga0307416_100017247 3300032002 Bacteria 5045
399 Ga0307416_100070266 3300032002 Bacteria 2902
400 Ga0307414_10008117 3300032004 Bacteria 5931
401 Ga0307411_10131417 3300032005 Bacteria 1830
402 Ga0307415_100003684 3300032126 Bacteria 7844
403 Ga0307415_100644897 3300032126 Bacteria 948
404 Ga0373951_0002833 3300035091 Bacteria 4315
405 Ga0373932_0129324 3300035112 Unclassified 850
406 Ga0373941_0015810 3300035115 Bacteria 2041
407 Ga0242422_02379 3300038699 Bacteria 1274
408 Ga0496106_0019562 3300048909 Bacteria 5024
409 Ga0496110_0316440 3300048913 Bacteria 1422
410 Ga0496113_0216781 3300048916 Bacteria 1525
411 Ga0496113_0719760 3300048916 Bacteria 796
412 Ga0501290_006220 3300049513 Bacteria 1494
413 Ga0501291_010847 3300049514 Bacteria 1304
414 Ga0501297_014763 3300049520 Unclassified 929
415 Ga0501298_000774 3300049521 Bacteria 4490
416 Ga0501298_008287 3300049521 Bacteria 1743
417 Ga0501299_000455 3300049522 Bacteria 4842
418 Ga0501299_019605 3300049522 Bacteria 1225
419 Ga0501300_020460 3300049523 Unclassified 966
420 Ga0501072_0973493 3300049588 Unclassified 662
421 Ga0501199_007626 3300049650 Bacteria 1121
422 Ga0501207_002407 3300049654 Bacteria 2414
423 Ga0501207_007475 3300049654 Bacteria 1559
424 Ga0501207_083724 3300049654 Unclassified 617
425 Ga0501209_072160 3300049656 Bacteria 983
426 Ga0501214_003801 3300049659 Bacteria 1362
427 Ga0501216_011992 3300049660 Bacteria 1416
428 Ga0501216_036657 3300049660 Bacteria 925
429 Ga0501217_003095 3300049661 Bacteria 3329
430 Ga0501217_014031 3300049661 Bacteria 1805
431 Ga0501217_031727 3300049661 Bacteria 1303
432 Ga0501217_037946 3300049661 Unclassified 1215
433 Ga0501223_003928 3300049663 Bacteria 3209
434 Ga0501223_062212 3300049663 Unclassified 730
435 Ga0501224_010171 3300049664 Bacteria 1378
436 Ga0501224_033631 3300049664 Unclassified 769
437 Ga0501227_000961 3300049665 Bacteria 6341
438 Ga0501233_006776 3300049668 Bacteria 2162
439 Ga0501233_020786 3300049668 Bacteria 1404
440 Ga0501233_080833 3300049668 Unclassified 836
441 Ga0501235_005295 3300049669 Bacteria 2806
442 Ga0501235_027809 3300049669 Unclassified 1269
443 Ga0501235_043516 3300049669 Bacteria 1031
444 Ga0501235_077139 3300049669 Unclassified 793
445 Ga0501236_006067 3300049670 Bacteria 1477
446 Ga0501239_063452 3300049672 Bacteria 561
447 Ga0501243_021976 3300049675 Bacteria 1055
448 Ga0501249_012560 3300049679 Bacteria 1791
449 Ga0501249_022588 3300049679 Bacteria 1378
450 Ga0501253_037496 3300049683 Unclassified 960
451 Ga0501253_039718 3300049683 Bacteria 942
452 Ga0501257_023476 3300049686 Bacteria 1463
453 Ga0501259_067047 3300049688 Unclassified 762
454 Ga0501259_082770 3300049688 Unclassified 708
455 Ga0501260_012716 3300049689 Unclassified 863
456 Ga0501225_0002805 3300049705 Bacteria 5353
457 Ga0501225_0040117 3300049705 Bacteria 1290
458 Ga0501225_0112535 3300049705 Unclassified 803
459 Ga0501225_0129747 3300049705 Unclassified 754
460 Ga0501234_027621 3300049707 Unclassified 913
461 Ga0501245_018789 3300049708 Unclassified 1065
462 Ga0501241_015317 3300049758 Bacteria 1394
463 Ga0501241_033182 3300049758 Bacteria 981
464 Ga0501266_045262 3300049763 Unclassified 666
465 Ga0501268_005745 3300049765 Bacteria 1794
466 Ga0501268_016618 3300049765 Bacteria 1219
467 Ga0501268_028070 3300049765 Bacteria 1004
468 Ga0501272_003019 3300049769 Bacteria 1691
469 Ga0501272_042542 3300049769 Bacteria 610
470 Ga0501279_023845 3300049775 Bacteria 883
471 Ga0501280_051137 3300049776 Unclassified 696
472 Ga0501282_015998 3300049778 Bacteria 816
473 Ga0501283_017141 3300049779 Unclassified 1130
474 Ga0501226_008004 3300049853 Bacteria 1182
475 nmdc:mga05p37_115172_c1 3300050507 Bacteria 3305
476 nmdc:mga05p37_1222415_c1 3300050507 Unclassified 774
477 nmdc:mga05p37_1415454_c1 3300050507 Bacteria 699
478 nmdc:mga05p37_721915_c1 3300050507 Bacteria 1103
479 nmdc:mga09592_257289_c1 3300050508 Bacteria 1513
480 nmdc:mga06r32_151280_c1 3300050510 Bacteria 2299
481 nmdc:mga06r32_284374_c1 3300050510 Bacteria 1641
482 nmdc:mga08y16_3253_c1 3300050511 Bacteria 16814
483 nmdc:mga08y16_64457_c1 3300050511 Bacteria 3826
484 nmdc:mga08y16_828877_c1 3300050511 Bacteria 916
485 nmdc:mga08y16_881393_c1 3300050511 Unclassified 882
486 nmdc:mga0n895_260098_c1 3300050512 Bacteria 1761
487 nmdc:mga0n895_317100_c1 3300050512 Bacteria 1580
488 nmdc:mga0a205_127242_c1 3300050515 Bacteria 2447
489 nmdc:mga0a205_167977_c1 3300050515 Unclassified 2089
490 nmdc:mga0a205_207477_c1 3300050515 Bacteria 1848
491 nmdc:mga0a205_252222_c1 3300050515 Bacteria 1644
492 nmdc:mga0a205_501518_c1 3300050515 Bacteria 1071
493 Ga0501084_0197647 3300054114 Bacteria 1697
494 Ga0439458_0011074
495 CNAas_1000832
496 JGI24751J29686_10000372
497 Ga0065712_10115135
498 Ga0065715_10006853
499 Ga0065715_10101004
500 Ga0065715_10297078
501 Ga0065707_10002870
502 Ga0065707_10224812
503 Ga0070676_10193877
504 Ga0070690_100002501
505 Ga0070690_100043799
506 Ga0070670_100032204
507 Ga0070670_100354013
508 Ga0070670_100666565
509 Ga0070670_101427454
510 Ga0068869_100020618
511 Ga0068869_100078502
512 Ga0068869_100111452
513 Ga0068869_100229638
514 Ga0070680_100000838
515 Ga0070680_100196161
516 Ga0070682_100000491
517 Ga0070682_100010746
518 Ga0068868_100016651
519 Ga0068868_100297013
520 Ga0070689_100170119
521 Ga0070689_100545626
522 Ga0070687_100130393
523 Ga0070687_100564883
524 Ga0070661_100801015
525 Ga0070692_10015400
526 Ga0070692_10072657
527 Ga0070692_10088581
528 Ga0070692_10275476
529 Ga0070692_10279300
530 Ga0070692_10366283
531 Ga0070669_100038717
532 Ga0070669_100455344
533 Ga0070669_101009622
534 Ga0070675_100072097
535 Ga0070675_100229893
536 Ga0070675_100953546
537 Ga0070671_100033984
538 Ga0070671_100524889
539 Ga0070673_100094268
540 Ga0070673_100120578
541 Ga0070673_100194921
542 Ga0070659_100085864
543 Ga0070659_100441579
544 Ga0070667_100202288
545 Ga0070709_10336223
546 Ga0070701_10034077
547 Ga0070701_10262774
548 Ga0070705_100178613
549 Ga0070700_100034229
550 Ga0070700_100243318
551 Ga0070694_100054979
552 Ga0070694_100110325
553 Ga0070694_100198102
554 Ga0070694_100247224
555 Ga0070694_100428808
556 Ga0070708_100465209
557 Ga0070678_100567483
558 Ga0070681_10000210
559 Ga0068867_100011979
560 Ga0068867_100085659
561 Ga0068867_100119953
562 Ga0070707_100046331
563 Ga0070707_100473409
564 Ga0070698_100024514
565 Ga0070699_100089915
566 Ga0070699_100252787
567 Ga0070699_100272922
568 Ga0070679_100000055
569 Ga0070679_100489443
570 Ga0070697_100028483
571 Ga0070697_100062961
572 Ga0068853_100108363
573 Ga0068853_100361401
574 Ga0068853_100367068
575 Ga0068853_100384076
576 Ga0070672_100072695
577 Ga0070672_100505381
578 Ga0070686_100009198
579 Ga0070686_100199426
580 Ga0070686_100835266
581 Ga0070695_100029618
582 Ga0070695_100073465
583 Ga0070695_100239530
584 Ga0070695_100487854
585 Ga0070695_100735394
586 Ga0070695_100855239
587 Ga0070696_100124500
588 Ga0070696_100147942
589 Ga0070696_100321388
590 Ga0070696_100444971
591 Ga0070696_100705036
592 Ga0070693_100059494
593 Ga0070693_100073064
594 Ga0070693_100201257
595 Ga0070693_100354099
596 Ga0070704_100006637
597 Ga0070704_100031263
598 Ga0070704_100463184
599 Ga0070664_100273905
600 Ga0070664_100538820
601 Ga0068857_100303743
602 Ga0068857_100504781
603 Ga0068857_101067916
604 Ga0068857_101474435
605 Ga0068854_100313578
606 Ga0068854_100374261
607 Ga0068854_100729387
608 Ga0068854_101190397
609 Ga0068856_100007846
610 Ga0070702_100019854
611 Ga0070702_100049388
612 Ga0068852_100138082
613 Ga0068859_100004376
614 Ga0068859_100055776
615 Ga0068859_100062657
616 Ga0068859_100067877
617 Ga0068859_100088359
618 Ga0068859_100136690
619 Ga0068859_100378836
620 Ga0068859_100505392
621 Ga0068859_100582143
622 Ga0068859_100647637
623 Ga0068864_100021330
624 Ga0068864_100159652
625 Ga0068864_100237238
626 Ga0068864_100445401
627 Ga0068864_100673780
628 Ga0068864_100866224
629 Ga0068866_10016058
630 Ga0068861_100032793
631 Ga0068861_100076494
632 Ga0068861_100587922
633 Ga0068870_10036607
634 Ga0068870_10094437
635 Ga0068870_10105274
636 Ga0068870_10169248
637 Ga0068863_100118714
638 Ga0068863_100122183
639 Ga0068863_100207764
640 Ga0068863_100780217
641 Ga0068863_101238264
642 Ga0068858_100104268
643 Ga0068858_100163667
644 Ga0068860_100033396
645 Ga0068860_100099474
646 Ga0068860_100129749
647 Ga0068860_100167942
648 Ga0068860_100350442
649 Ga0068860_100442218
650 Ga0068860_100552506
651 Ga0068860_100748187
652 Ga0068862_100046786
653 Ga0068862_100542857
654 Ga0068862_100869325
655 Ga0081539_10000752
656 Ga0070716_100064301
657 Ga0097621_100005126
658 Ga0097621_100156899
659 Ga0068871_100010458
660 Ga0068871_100158377
661 Ga0068871_100177437
662 Ga0075428_100089670
663 Ga0075431_100088665
664 Ga0075431_101061225
665 Ga0075433_10097872
666 Ga0075433_10108134
667 Ga0075433_10316710
668 Ga0075433_10325427
669 Ga0075433_10559729
670 Ga0075433_10583847
671 Ga0075433_11162091
672 Ga0075434_100326545
673 Ga0075434_100477023
674 Ga0075434_100642247
675 Ga0075434_100884203
676 Ga0075434_101466590
677 Ga0068865_100002957
678 Ga0097620_100004376
679 Ga0097620_100055776
680 Ga0097620_100062657
681 Ga0097620_100067877
682 Ga0097620_100088362
683 Ga0097620_100136691
684 Ga0097620_100378815
685 Ga0097620_100505389
686 Ga0097620_100582131
687 Ga0097620_100647545
688 Ga0097620_100774510
689 Ga0075435_100423402
690 Ga0105240_10179979
691 Ga0111539_10002867
692 Ga0111539_10832800
693 Ga0105245_10810438
694 Ga0105247_10002781
695 Ga0105247_10757154
696 Ga0114129_10005568
697 Ga0114129_10192410
698 Ga0114129_10766140
699 Ga0105243_10002466
700 Ga0105243_10238803
701 Ga0105243_10268260
702 Ga0105243_10415479
703 Ga0105243_10435051
704 Ga0105243_10512552
705 Ga0105243_10818104
706 Ga0105241_10206847
707 Ga0105241_10259055
708 Ga0105241_10305957
709 Ga0105241_10315085
710 Ga0105241_10374383
711 Ga0105241_10507277
712 Ga0105242_10056136
713 Ga0105248_10029278
714 Ga0105248_10109638
715 Ga0105248_10162222
716 Ga0105248_10593995
717 Ga0105248_10757997
718 Ga0105237_10083537
719 Ga0105238_10025491
720 Ga0105238_10028954
721 Ga0105238_10334361
722 Ga0105238_10458829
723 Ga0105238_11192950
724 Ga0105249_10004074
725 Ga0105249_10102647
726 Ga0105249_10312628
727 Ga0105249_10387072
728 Ga0105246_10084504
729 Ga0105246_10166175
730 Ga0105246_10613862
731 Ga0157373_10008931
732 Ga0157373_10091133
733 Ga0157373_10123813
734 Ga0157373_10342456
735 Ga0157373_10615461
736 Ga0157378_10106537
737 Ga0157378_10272643
738 Ga0157378_10942170
739 Ga0163162_10069221
740 Ga0163162_10364706
741 Ga0163162_10516558
742 Ga0163162_10525555
743 Ga0163162_11419808
744 Ga0157372_10018977
745 Ga0157372_10743340
746 Ga0157372_10968785
747 Ga0157375_10027368
748 Ga0157375_10420335
749 Ga0163163_10000568
750 Ga0163163_10005674
751 Ga0163163_10072482
752 Ga0163163_11109751
753 Ga0157380_10043585
754 Ga0182008_10270471
755 Ga0157379_10194537
756 Ga0163161_10020606
757 Ga0207697_10076060
758 Ga0207642_10098602
759 Ga0207710_10001436
760 Ga0207688_10487264
761 Ga0207647_10025301
762 Ga0207645_10039880
763 Ga0207645_10059474
764 Ga0207643_10001161
765 Ga0207643_10145404
766 Ga0207654_10144514
767 Ga0207654_10197819
768 Ga0207654_10299357
769 Ga0207654_10306001
770 Ga0207654_10326332
771 Ga0207707_10000003
772 Ga0207707_10059828
773 Ga0207671_10058030
774 Ga0207660_10001940
775 Ga0207660_10104860
776 Ga0207660_10122548
777 Ga0207649_10454233
778 Ga0207652_10000111
779 Ga0207646_10078987
780 Ga0207646_10110746
781 Ga0207681_10240289
782 Ga0207681_10256218
783 Ga0207681_10354710
784 Ga0207694_10000987
785 Ga0207694_10028862
786 Ga0207694_10213602
787 Ga0207650_10000103
788 Ga0207650_10356939
789 Ga0207659_10075700
790 Ga0207687_10050388
791 Ga0207644_10097143
792 Ga0207644_10578447
793 Ga0207690_10067094
794 Ga0207690_10227926
795 Ga0207706_10194936
796 Ga0207686_10042681
797 Ga0207686_10246429
798 Ga0207709_10021528
799 Ga0207709_10083487
800 Ga0207670_10001579
801 Ga0207670_10177842
802 Ga0207670_10596789
803 Ga0207670_11002905
804 Ga0207669_10022886
805 Ga0207704_10035147
806 Ga0207704_10145309
807 Ga0207665_10086305
808 Ga0207691_10000477
809 Ga0207691_10280624
810 Ga0207711_10003785
811 Ga0207711_10060837
812 Ga0207711_10081204
813 Ga0207711_10231398
814 Ga0207689_10008844
815 Ga0207689_10289462
816 Ga0207689_10324320
817 Ga0207689_10405157
818 Ga0207689_10426822
819 Ga0207689_10497347
820 Ga0207679_10183557
821 Ga0207679_10943495
822 Ga0207651_10081068
823 Ga0207651_10414966
824 Ga0207651_10803062
825 Ga0207712_10003132
826 Ga0207712_10409572
827 Ga0207712_10587345
828 Ga0207640_10053359
829 Ga0207640_10233356
830 Ga0207640_10462769
831 Ga0207640_10781620
832 Ga0207640_11023356
833 Ga0207640_11083960
834 Ga0207658_10034981
835 Ga0207677_10122728
836 Ga0207677_10441745
837 Ga0207703_10070854
838 Ga0207703_10839743
839 Ga0207703_10908150
840 Ga0207639_10018209
841 Ga0207639_10109422
842 Ga0207639_10209842
843 Ga0207639_10505668
844 Ga0207639_10683541
845 Ga0207708_10002842
846 Ga0207708_10008376
847 Ga0207708_10110376
848 Ga0207708_10221223
849 Ga0207702_10027602
850 Ga0207641_10114380
851 Ga0207641_10143730
852 Ga0207641_10263040
853 Ga0207641_10394603
854 Ga0207641_11428361
855 Ga0207648_10088008
856 Ga0207648_10234940
857 Ga0207648_10299344
858 Ga0207648_10390015
859 Ga0207648_10491065
860 Ga0207648_10728192
861 Ga0207676_10085475
862 Ga0207676_10571706
863 Ga0207674_10037348
864 Ga0207674_10050527
865 Ga0207674_10267353
866 Ga0207675_100002631
867 Ga0207675_100033777
868 Ga0207675_100088561
869 Ga0207675_100441879
870 Ga0207683_10044798
871 Ga0207428_10023225
872 Ga0207428_10048036
873 Ga0268265_10878707
874 Ga0268264_10098699
875 Ga0268264_10148255
876 Ga0268264_10170227
877 Ga0268264_10227757
878 Ga0268264_10739021
879 Ga0307408_100098538
880 Ga0307408_100228595
881 Ga0307405_10222971
882 Ga0307405_10282215
883 Ga0307413_10162414
884 Ga0307410_10125225
885 Ga0307406_10009659
886 Ga0307406_10555283
887 Ga0307406_10765431
888 Ga0307412_10241059
889 Ga0307409_100030062
890 Ga0307409_100079260
891 Ga0307416_100017247
892 Ga0307416_100070266
893 Ga0307414_10008117
894 Ga0307411_10131417
895 Ga0307415_100003684
896 Ga0307415_100644897
897 Ga0373951_0002833
898 Ga0373932_0129324
899 Ga0373941_0015810
900 Ga0242422_02379
901 Ga0496106_0019562
902 Ga0496110_0316440
903 Ga0496113_0216781
904 Ga0496113_0719760
905 Ga0501290_006220
906 Ga0501291_010847
907 Ga0501297_014763
908 Ga0501298_000774
909 Ga0501298_008287
910 Ga0501299_000455
911 Ga0501299_019605
912 Ga0501300_020460
913 Ga0501072_0973493
914 Ga0501199_007626
915 Ga0501207_002407
916 Ga0501207_007475
917 Ga0501207_083724
918 Ga0501209_072160
919 Ga0501214_003801
920 Ga0501216_011992
921 Ga0501216_036657
922 Ga0501217_003095
923 Ga0501217_014031
924 Ga0501217_031727
925 Ga0501217_037946
926 Ga0501223_003928
927 Ga0501223_062212
928 Ga0501224_010171
929 Ga0501224_033631
930 Ga0501227_000961
931 Ga0501233_006776
932 Ga0501233_020786
933 Ga0501233_080833
934 Ga0501235_005295
935 Ga0501235_027809
936 Ga0501235_043516
937 Ga0501235_077139
938 Ga0501236_006067
939 Ga0501239_063452
940 Ga0501243_021976
941 Ga0501249_012560
942 Ga0501249_022588
943 Ga0501253_037496
944 Ga0501253_039718
945 Ga0501257_023476
946 Ga0501259_067047
947 Ga0501259_082770
948 Ga0501260_012716
949 Ga0501225_0002805
950 Ga0501225_0040117
951 Ga0501225_0112535
952 Ga0501225_0129747
953 Ga0501234_027621
954 Ga0501245_018789
955 Ga0501241_015317
956 Ga0501241_033182
957 Ga0501266_045262
958 Ga0501268_005745
959 Ga0501268_016618
960 Ga0501268_028070
961 Ga0501272_003019
962 Ga0501272_042542
963 Ga0501279_023845
964 Ga0501280_051137
965 Ga0501282_015998
966 Ga0501283_017141
967 Ga0501226_008004
968 nmdc:mga05p37_115172_c1
969 nmdc:mga05p37_1222415_c1
970 nmdc:mga05p37_1415454_c1
971 nmdc:mga05p37_721915_c1
972 nmdc:mga09592_257289_c1
973 nmdc:mga06r32_151280_c1
974 nmdc:mga06r32_284374_c1
975 nmdc:mga08y16_3253_c1
976 nmdc:mga08y16_64457_c1
977 nmdc:mga08y16_828877_c1
978 nmdc:mga08y16_881393_c1
979 nmdc:mga0n895_260098_c1
980 nmdc:mga0n895_317100_c1
981 nmdc:mga0a205_127242_c1
982 nmdc:mga0a205_167977_c1
983 nmdc:mga0a205_207477_c1
984 nmdc:mga0a205_252222_c1
985 nmdc:mga0a205_501518_c1
986 Ga0501084_0197647

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6anw-assembly3.cif.gz_C crystal structure of anti-crispr protein acrf10 0.8628 115 149
2xep-assembly1.cif.gz_A structural and mechanistic studies on a cephalosporin esterase from the clavulanic acid biosynthesis pathway 0.6894 129 161
2xep-assembly2.cif.gz_B structural and mechanistic studies on a cephalosporin esterase from the clavulanic acid biosynthesis pathway 0.6881 130 161
6e8a-assembly2.cif.gz_B-2 crystal structure of dcrb from salmonella enterica at 1.92 angstroms resolution 0.6743 73 171
2xb3-assembly1.cif.gz_A the structure of cyanobacterial psbp 0.6487 36 179
ID Description Score Start End Superfamily
4exrA01 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7748 103 151 3.10.450.40
4oqeB02 Mainly Beta;Single Sheet;S-adenosyl-L-methionine-dependent methyltransferases;CAC2371-like domains 0.7332 53 88 2.20.130.10
af_A0A1D6ETJ1_1_68_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7133 115 157 2.40.50.140
af_A0A0P0V197_32_95_3.10.450.700 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7106 115 175 3.10.450.700
af_Q9TXR7_108_213_3.10.450.320 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,;Mitochondrial import inner membrane translocase subunit Tim21 0.6714 116 164 3.10.450.320
ID Description Score Start End GO Terms
AF-A0A2V8N626-F1-model_v4 Multifunctional fusion protein [Includes: ADP-dependent (S)-NAD(P)H-hydrate dehydratase (EC 4.2.1.136) (ADP-dependent NAD(P)HX dehydratase); NAD(P)H-hydrate epimerase (EC 5.1.99.6) (NAD(P)HX epimerase)] 0.9168 37 182 GO:0005524
GO:0046496
GO:0046872
GO:0052855
GO:0052856
GO:0110051
AF-A0A2E9QMY0-F1-model_v4 TraB/GumN family protein 0.9114 35 182
AF-A0A2E3LYT6-F1-model_v4 PsbP C-terminal domain-containing protein 0.9105 37 182 GO:0016020
AF-A0A7D5MPW3-F1-model_v4 Uncharacterized protein 0.898 85 179
AF-A0A1G2RH63-F1-model_v4 Zinc-ribbon domain-containing protein 0.8943 26 179 GO:0016020

Map