F454456

General Info

Members Datasets Scaffolds Average Seq Length
493 257 986 182

Family's Representative Sequence

Representative Sequence 3300035083|Ga0373926_0000911|Ga0373926_0000911_5650_6264
Length 204
Sequence VVAFVCRITAPSANAYHPAMADLMDRERAHAFAHEHCLKETTYRHLISVEGVMRSLARRFDEDQELWGLTGLFHDLDQDHTGDDGAQHARLAAEWLREAQVDERVVNGVLAHAYEEYRTDLMSKAVVNADAVAGLLVASALVRPEKSAGMKVSSMKKKLKEKSFAPGVSREEVTDVEANIGLPLDEFIAVSIEGLQEVAPDIEL

Samples

Sample ID Description Type Environment
1 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
2 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
51 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
116 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
118 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
119 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
120 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
121 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
122 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
123 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
124 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
125 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
126 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
127 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
128 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
129 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
130 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
131 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
132 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
133 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
134 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
135 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
136 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
137 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
138 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
139 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
140 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
141 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
144 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
145 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
146 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
147 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
148 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
149 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
150 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
151 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
152 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
153 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
154 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
155 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
156 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
157 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
158 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
159 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
160 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
161 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
162 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
163 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
164 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
165 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
166 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
167 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
168 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
169 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
170 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
171 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
172 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
173 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
174 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
175 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
176 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
177 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
178 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
179 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
180 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
181 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
182 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
183 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
184 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
185 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
186 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
187 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
188 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
189 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
190 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
191 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
192 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
193 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
194 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
195 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
196 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
197 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
198 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
199 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
200 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
201 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
202 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
203 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
204 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
205 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
206 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
207 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
208 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
209 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
210 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
211 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
212 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
213 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
214 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
215 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
228 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
229 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
230 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
231 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
232 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
233 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
234 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
235 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
236 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
237 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
238 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
239 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
240 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
241 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
243 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
244 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
245 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
246 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
247 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
248 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
249 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
250 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
251 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
252 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
253 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
254 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
255 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
256 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
257 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.46
Rhizosphere 95.54
Stem 0
Stem Tuber 0
Unclassified 10.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373926_0000911 3300035083 Bacteria 8514
2 JGI24033J26618_1000518 3300002155 Bacteria 3751
3 JGI24751J29686_10000162 3300002459 Bacteria 31660
4 JGI24751J29686_10023696 3300002459 Unclassified 1273
5 JGI25407J50210_10000116 3300003373 Bacteria 11448
6 JGI25407J50210_10024180 3300003373 Unclassified 1575
7 JGI25407J50210_10038163 3300003373 Unclassified 1233
8 JGI25407J50210_10038512 3300003373 Bacteria 1227
9 JGI25407J50210_10060764 3300003373 Bacteria 950
10 Ga0070676_10454078 3300005328 Bacteria 902
11 Ga0070683_100686415 3300005329 Bacteria 980
12 Ga0070690_100179039 3300005330 Bacteria 1464
13 Ga0070670_100001202 3300005331 Bacteria 20554
14 Ga0068869_100506342 3300005334 Bacteria 1009
15 Ga0068868_100095874 3300005338 Bacteria 2395
16 Ga0070661_100046203 3300005344 Bacteria 3185
17 Ga0070692_10184365 3300005345 Bacteria 1212
18 Ga0070668_100518531 3300005347 Bacteria 1034
19 Ga0070675_100116671 3300005354 Bacteria 2265
20 Ga0070671_100158041 3300005355 Bacteria 1916
21 Ga0070674_100010363 3300005356 Bacteria 5631
22 Ga0070674_100358816 3300005356 Bacteria 1179
23 Ga0070688_100796070 3300005365 Bacteria 739
24 Ga0070703_10247150 3300005406 Bacteria 722
25 Ga0070710_10604276 3300005437 Bacteria 764
26 Ga0070701_10125307 3300005438 Bacteria 1453
27 Ga0070701_10280001 3300005438 Bacteria 1018
28 Ga0070711_100005731 3300005439 Bacteria 7451
29 Ga0070700_100004977 3300005441 Bacteria 6996
30 Ga0070700_100071512 3300005441 Bacteria 2215
31 Ga0070694_100022115 3300005444 Bacteria 4072
32 Ga0070708_100033153 3300005445 Bacteria 4486
33 Ga0070708_100144570 3300005445 Bacteria 2208
34 Ga0070708_100269573 3300005445 Bacteria 1601
35 Ga0070708_100477134 3300005445 Unclassified 1177
36 Ga0070708_101115280 3300005445 Unclassified 739
37 Ga0070663_100107885 3300005455 Bacteria 2088
38 Ga0070663_100367672 3300005455 Bacteria 1168
39 Ga0068867_100070364 3300005459 Bacteria 2615
40 Ga0070685_10655625 3300005466 Bacteria 761
41 Ga0070706_100881042 3300005467 Unclassified 827
42 Ga0070707_100796950 3300005468 Unclassified 908
43 Ga0070698_100093565 3300005471 Bacteria 2985
44 Ga0070698_100144175 3300005471 Bacteria 2332
45 Ga0070698_100336069 3300005471 Bacteria 1442
46 Ga0070699_100096464 3300005518 Bacteria 2590
47 Ga0070684_100037115 3300005535 Bacteria 4177
48 Ga0070686_100020292 3300005544 Bacteria 3929
49 Ga0070696_100007238 3300005546 Bacteria 7409
50 Ga0070696_100018991 3300005546 Bacteria 4653
51 Ga0070693_100474139 3300005547 Bacteria 883
52 Ga0070704_100078892 3300005549 Bacteria 2417
53 Ga0070704_100372254 3300005549 Bacteria 1211
54 Ga0070704_100538881 3300005549 Bacteria 1018
55 Ga0068855_100528535 3300005563 Bacteria 1279
56 Ga0070664_100000383 3300005564 Bacteria 32934
57 Ga0068857_100066977 3300005577 Bacteria 3195
58 Ga0068857_100073481 3300005577 Bacteria 3047
59 Ga0068854_100420874 3300005578 Bacteria 1109
60 Ga0068864_100018829 3300005618 Bacteria 5771
61 Ga0068864_100158381 3300005618 Bacteria 2057
62 Ga0068866_10030420 3300005718 Bacteria 2592
63 Ga0068861_100012284 3300005719 Bacteria 5973
64 Ga0068870_10013467 3300005840 Bacteria 3843
65 Ga0068863_100096589 3300005841 Bacteria 2805
66 Ga0068860_100042884 3300005843 Bacteria 4318
67 Ga0068860_100176663 3300005843 Bacteria 2064
68 Ga0081455_10007612 3300005937 Bacteria 11383
69 Ga0081455_10013745 3300005937 Bacteria 7969
70 Ga0081455_10297365 3300005937 Bacteria 1160
71 Ga0081538_10000840 3300005981 Bacteria 33310
72 Ga0081538_10001113 3300005981 Bacteria 28482
73 Ga0081538_10003831 3300005981 Bacteria 14049
74 Ga0081538_10031902 3300005981 Bacteria 3543
75 Ga0081538_10089955 3300005981 Bacteria 1591
76 Ga0081538_10110538 3300005981 Bacteria 1350
77 Ga0081539_10274221 3300005985 Bacteria 737
78 Ga0075432_10005132 3300006058 Bacteria 4462
79 Ga0070715_10013629 3300006163 Bacteria 2991
80 Ga0070712_100039590 3300006175 Bacteria 3226
81 Ga0075427_10003714 3300006194 Bacteria 2122
82 Ga0075427_10009479 3300006194 Bacteria 1451
83 Ga0075428_100006067 3300006844 Bacteria 13432
84 Ga0075428_100139393 3300006844 Bacteria 2636
85 Ga0075428_100189773 3300006844 Bacteria 2223
86 Ga0075428_100402271 3300006844 Bacteria 1467
87 Ga0075428_100570963 3300006844 Bacteria 1209
88 Ga0075428_100854879 3300006844 Unclassified 966
89 Ga0075428_101425865 3300006844 Unclassified 726
90 Ga0075430_100000412 3300006846 Bacteria 31776
91 Ga0075430_100021831 3300006846 Bacteria 5440
92 Ga0075430_100031698 3300006846 Bacteria 4486
93 Ga0075430_100138852 3300006846 Bacteria 2024
94 Ga0075431_100015926 3300006847 Bacteria 7628
95 Ga0075431_100095357 3300006847 Bacteria 3071
96 Ga0075431_100478981 3300006847 Bacteria 1238
97 Ga0075431_100629730 3300006847 Bacteria 1054
98 Ga0075433_10002046 3300006852 Bacteria 15231
99 Ga0075433_10004866 3300006852 Bacteria 10504
100 Ga0075434_100017776 3300006871 Bacteria 6857
101 Ga0075429_100000031 3300006880 Bacteria 65247
102 Ga0075429_100109908 3300006880 Bacteria 2410
103 Ga0075429_100217350 3300006880 Bacteria 1674
104 Ga0068865_100023394 3300006881 Bacteria 4044
105 Ga0068865_100219460 3300006881 Bacteria 1486
106 Ga0075435_100077362 3300007076 Bacteria 2728
107 Ga0075435_100399211 3300007076 Bacteria 1182
108 Ga0075435_101235480 3300007076 Bacteria 654
109 Ga0111539_10008184 3300009094 Bacteria 13315
110 Ga0111539_10083941 3300009094 Bacteria 3745
111 Ga0111539_10289005 3300009094 Bacteria 1908
112 Ga0105245_10051449 3300009098 Bacteria 3692
113 Ga0105245_10367087 3300009098 Bacteria 1430
114 Ga0105245_10626364 3300009098 Bacteria 1104
115 Ga0105245_11247326 3300009098 Unclassified 792
116 Ga0105247_10565831 3300009101 Bacteria 838
117 Ga0114129_10003067 3300009147 Bacteria 23433
118 Ga0114129_10003648 3300009147 Bacteria 21654
119 Ga0114129_10046665 3300009147 Bacteria 6088
120 Ga0114129_10404308 3300009147 Bacteria 1799
121 Ga0114129_10817437 3300009147 Bacteria 1187
122 Ga0114129_10978851 3300009147 Bacteria 1067
123 Ga0114129_11708788 3300009147 Bacteria 768
124 Ga0114129_11732825 3300009147 Bacteria 762
125 Ga0105243_10003705 3300009148 Bacteria 12277
126 Ga0105243_10006788 3300009148 Bacteria 8827
127 Ga0105243_10115081 3300009148 Bacteria 2258
128 Ga0105243_10124030 3300009148 Bacteria 2182
129 Ga0105242_10010710 3300009176 Bacteria 7041
130 Ga0105242_10033664 3300009176 Bacteria 4105
131 Ga0105248_10229319 3300009177 Bacteria 2091
132 Ga0105249_10157731 3300009553 Bacteria 2190
133 Ga0105249_10203719 3300009553 Bacteria 1937
134 Ga0105249_10341499 3300009553 Bacteria 1514
135 Ga0105249_11247219 3300009553 Unclassified 815
136 Ga0105239_10452636 3300010375 Unclassified 1456
137 Ga0105246_10024975 3300011119 Bacteria 3891
138 Ga0157378_10114095 3300013297 Bacteria 2482
139 Ga0157378_10412187 3300013297 Bacteria 1334
140 Ga0157378_10754265 3300013297 Bacteria 996
141 Ga0163162_10065138 3300013306 Bacteria 3690
142 Ga0163162_10085177 3300013306 Bacteria 3237
143 Ga0163162_10381471 3300013306 Bacteria 1543
144 Ga0163162_10716761 3300013306 Bacteria 1121
145 Ga0157375_10209692 3300013308 Bacteria 2105
146 Ga0157375_12463249 3300013308 Unclassified 621
147 Ga0163163_10059793 3300014325 Bacteria 3771
148 Ga0163163_10287995 3300014325 Bacteria 1694
149 Ga0157380_10055114 3300014326 Bacteria 3156
150 Ga0157380_10194324 3300014326 Bacteria 1794
151 Ga0157377_10352902 3300014745 Bacteria 987
152 Ga0157376_10042446 3300014969 Bacteria 3727
153 Ga0163161_10181790 3300017792 Bacteria 1613
154 Ga0163161_10255806 3300017792 Bacteria 1366
155 Ga0207692_10267519 3300025898 Bacteria 1030
156 Ga0207688_10031401 3300025901 Bacteria 2932
157 Ga0207647_10365250 3300025904 Unclassified 816
158 Ga0207685_10000364 3300025905 Bacteria 7410
159 Ga0207645_10027021 3300025907 Bacteria 3708
160 Ga0207643_10000165 3300025908 Bacteria 45606
161 Ga0207643_10248882 3300025908 Bacteria 1094
162 Ga0207684_10560875 3300025910 Bacteria 977
163 Ga0207693_10002563 3300025915 Bacteria 15801
164 Ga0207693_10303894 3300025915 Bacteria 1249
165 Ga0207663_10024490 3300025916 Bacteria 3476
166 Ga0207660_10426452 3300025917 Unclassified 1070
167 Ga0207659_10336653 3300025926 Bacteria 1249
168 Ga0207659_10453555 3300025926 Bacteria 1080
169 Ga0207687_10291413 3300025927 Unclassified 1312
170 Ga0207687_11025637 3300025927 Bacteria 708
171 Ga0207700_10317016 3300025928 Bacteria 1350
172 Ga0207664_10330231 3300025929 Unclassified 1347
173 Ga0207706_10088257 3300025933 Bacteria 2727
174 Ga0207686_10066478 3300025934 Bacteria 2302
175 Ga0207686_10339065 3300025934 Unclassified 1128
176 Ga0207709_10012276 3300025935 Bacteria 4722
177 Ga0207709_10069305 3300025935 Bacteria 2232
178 Ga0207709_10142491 3300025935 Bacteria 1649
179 Ga0207709_10594164 3300025935 Bacteria 876
180 Ga0207669_10012784 3300025937 Bacteria 4141
181 Ga0207669_10194568 3300025937 Bacteria 1466
182 Ga0207704_10218246 3300025938 Bacteria 1409
183 Ga0207704_11123264 3300025938 Bacteria 668
184 Ga0207665_10034954 3300025939 Bacteria 3335
185 Ga0207691_10856634 3300025940 Bacteria 762
186 Ga0207711_10134422 3300025941 Bacteria 2220
187 Ga0207689_10013252 3300025942 Bacteria 7034
188 Ga0207661_10762564 3300025944 Bacteria 891
189 Ga0207712_10032164 3300025961 Bacteria 3539
190 Ga0207712_10137592 3300025961 Bacteria 1870
191 Ga0207668_10395012 3300025972 Bacteria 1168
192 Ga0207677_10262991 3300026023 Bacteria 1407
193 Ga0207678_10093621 3300026067 Bacteria 2567
194 Ga0207678_10216243 3300026067 Bacteria 1640
195 Ga0207678_10412364 3300026067 Bacteria 1171
196 Ga0207708_10040006 3300026075 Bacteria 3573
197 Ga0207708_10043455 3300026075 Bacteria 3424
198 Ga0207708_10054084 3300026075 Bacteria 3060
199 Ga0207641_10125240 3300026088 Bacteria 2299
200 Ga0207648_10082847 3300026089 Bacteria 2797
201 Ga0207648_10742495 3300026089 Bacteria 911
202 Ga0207676_10000396 3300026095 Bacteria 37006
203 Ga0207676_10706034 3300026095 Bacteria 977
204 Ga0207675_100025282 3300026118 Bacteria 5527
205 Ga0207675_100081757 3300026118 Bacteria 3029
206 Ga0207683_10115812 3300026121 Bacteria 2403
207 Ga0207698_10557604 3300026142 Bacteria 1124
208 Ga0207428_10001364 3300027907 Bacteria 25917
209 Ga0207428_10001651 3300027907 Bacteria 23203
210 Ga0207428_10028704 3300027907 Bacteria 4620
211 Ga0268265_10238539 3300028380 Bacteria 1603
212 Ga0268265_10685999 3300028380 Bacteria 988
213 Ga0307408_100263788 3300031548 Bacteria 1427
214 Ga0307408_100413782 3300031548 Bacteria 1161
215 Ga0307405_10014594 3300031731 Bacteria 4229
216 Ga0307405_10034931 3300031731 Bacteria 2997
217 Ga0307405_10244309 3300031731 Bacteria 1332
218 Ga0307413_10143308 3300031824 Bacteria 1654
219 Ga0307410_10019396 3300031852 Bacteria 4137
220 Ga0307410_10034367 3300031852 Bacteria 3283
221 Ga0307406_10001599 3300031901 Bacteria 12454
222 Ga0307406_10340102 3300031901 Bacteria 1168
223 Ga0307407_10004234 3300031903 Bacteria 6055
224 Ga0307407_10921548 3300031903 Bacteria 671
225 Ga0307412_10013072 3300031911 Bacteria 4856
226 Ga0307412_10045627 3300031911 Bacteria 2866
227 Ga0307409_100005958 3300031995 Bacteria 7097
228 Ga0307409_100009277 3300031995 Bacteria 6035
229 Ga0307416_100011403 3300032002 Bacteria 5925
230 Ga0307416_100089442 3300032002 Bacteria 2636
231 Ga0307416_100351692 3300032002 Unclassified 1491
232 Ga0307416_100688317 3300032002 Bacteria 1110
233 Ga0307416_100708269 3300032002 Bacteria 1096
234 Ga0307416_100865607 3300032002 Unclassified 1002
235 Ga0307416_101126843 3300032002 Bacteria 889
236 Ga0307414_10010248 3300032004 Bacteria 5428
237 Ga0307414_10041427 3300032004 Bacteria 3120
238 Ga0307411_10027617 3300032005 Bacteria 3437
239 Ga0307411_10098796 3300032005 Bacteria 2058
240 Ga0307415_100024266 3300032126 Bacteria 3782
241 Ga0307415_100070105 3300032126 Bacteria 2460
242 Ga0307415_100216471 3300032126 Bacteria 1532
243 Ga0307415_100259861 3300032126 Bacteria 1416
244 Ga0307415_100278778 3300032126 Unclassified 1373
245 Ga0307415_100320407 3300032126 Bacteria 1292
246 Ga0373929_0129956 3300035085 Unclassified 660
247 Ga0373944_0000825 3300035089 Bacteria 7609
248 Ga0373951_0028807 3300035091 Bacteria 1303
249 Ga0373923_0001925 3300035111 Bacteria 6213
250 Ga0373945_0004707 3300035116 Bacteria 4346
251 Ga0373943_0051841 3300035170 Bacteria 2021
252 Ga0373946_0006663 3300035171 Bacteria 4195
253 Ga0373961_0027499 3300035241 Bacteria 1562
254 Ga0373931_0074033 3300035691 Bacteria 1865
255 Ga0373935_0009333 3300035692 Bacteria 5875
256 Ga0373927_0006026 3300035695 Bacteria 8305
257 Ga0373947_0003167 3300035725 Bacteria 9791
258 Ga0373947_0202692 3300035725 Unclassified 1298
259 Ga0373947_0307459 3300035725 Bacteria 1058
260 Ga0373937_0765419 3300036401 Unclassified 913
261 Ga0373925_0025812 3300037068 Bacteria 4295
262 Ga0373925_0434161 3300037068 Unclassified 1074
263 Ga0395899_0088452 3300037312 Bacteria 2247
264 Ga0395899_0498044 3300037312 Archaea 791
265 Ga0395899_0660187 3300037312 Bacteria 660
266 Ga0395900_0015921 3300037418 Bacteria 7662
267 Ga0395900_0035535 3300037418 Bacteria 5132
268 Ga0395900_0074805 3300037418 Bacteria 3482
269 Ga0395900_0136730 3300037418 Bacteria 2511
270 Ga0395900_0199883 3300037418 Bacteria 2023
271 Ga0395900_0523328 3300037418 Bacteria 1133
272 Ga0395898_0023601 3300037466 Bacteria 6213
273 Ga0395905_0027547 3300037471 Bacteria 5359
274 Ga0395905_0270750 3300037471 Bacteria 1584
275 Ga0395905_0461229 3300037471 Bacteria 1169
276 Ga0395905_0584759 3300037471 Bacteria 1018
277 Ga0395905_0869452 3300037471 Bacteria 805
278 Ga0395901_0020232 3300038443 Bacteria 6813
279 Ga0395901_0054964 3300038443 Bacteria 4139
280 Ga0395901_0082494 3300038443 Bacteria 3359
281 Ga0395901_0096459 3300038443 Bacteria 3099
282 Ga0395901_0137515 3300038443 Bacteria 2567
283 Ga0395901_0182646 3300038443 Bacteria 2200
284 Ga0395901_0294310 3300038443 Bacteria 1684
285 Ga0395901_0443526 3300038443 Bacteria 1328
286 Ga0395901_0458151 3300038443 Unclassified 1303
287 Ga0439443_003586 3300042003 Bacteria 1970
288 Ga0439448_0089381 3300042005 Unclassified 1040
289 Ga0439448_0092753 3300042005 Bacteria 1021
290 Ga0439450_054247 3300042008 Unclassified 958
291 Ga0439455_0020319 3300042012 Bacteria 1574
292 Ga0439456_029877 3300042013 Unclassified 1165
293 Ga0439463_002445 3300042016 Bacteria 4734
294 Ga0439463_054751 3300042016 Bacteria 1018
295 Ga0439463_076242 3300042016 Unclassified 860
296 Ga0439444_0004546 3300042437 Bacteria 2022
297 Ga0439464_0048912 3300042439 Unclassified 1219
298 Ga0439440_0100940 3300042993 Bacteria 785
299 Ga0495627_147210 3300046453 Bacteria 658
300 Ga0495603_0003676 3300046455 Bacteria 9131
301 Ga0495603_0096901 3300046455 Bacteria 1723
302 Ga0495603_0150326 3300046455 Bacteria 1353
303 Ga0495603_0150985 3300046455 Bacteria 1349
304 Ga0495591_027446 3300046458 Bacteria 1756
305 Ga0495629_0011910 3300046459 Bacteria 6307
306 Ga0495629_0328720 3300046459 Unclassified 1044
307 Ga0495653_0159675 3300046463 Bacteria 1566
308 Ga0495580_0023460 3300046472 Bacteria 4530
309 Ga0495580_0222291 3300046472 Bacteria 1297
310 Ga0495582_0000946 3300046473 Bacteria 16216
311 Ga0495582_0010287 3300046473 Bacteria 5146
312 Ga0495582_0388140 3300046473 Bacteria 805
313 Ga0495639_0003761 3300046475 Bacteria 6528
314 Ga0495639_0026239 3300046475 Bacteria 2574
315 Ga0495639_0035442 3300046475 Bacteria 2233
316 Ga0495662_0001801 3300046476 Bacteria 10728
317 Ga0495584_0022100 3300046491 Bacteria 3228
318 Ga0495584_0024924 3300046491 Bacteria 3033
319 Ga0495585_0098142 3300046492 Bacteria 1570
320 Ga0495594_0021827 3300046499 Bacteria 3419
321 Ga0495594_0131070 3300046499 Unclassified 1420
322 Ga0495594_0190603 3300046499 Bacteria 1168
323 Ga0495594_0219492 3300046499 Bacteria 1084
324 Ga0495616_0147845 3300046513 Unclassified 1065
325 Ga0495618_0104225 3300046514 Bacteria 1816
326 Ga0495630_0015105 3300046517 Bacteria 5634
327 Ga0495630_0224865 3300046517 Bacteria 1433
328 Ga0495644_0020548 3300046523 Bacteria 2519
329 Ga0495666_0002078 3300046526 Bacteria 9920
330 Ga0495666_0023434 3300046526 Bacteria 3053
331 Ga0495666_0118281 3300046526 Bacteria 1242
332 Ga0495642_0023754 3300046528 Bacteria 2422
333 Ga0495642_0219598 3300046528 Bacteria 830
334 Ga0495665_0002519 3300046531 Bacteria 9896
335 Ga0495665_0094946 3300046531 Bacteria 1566
336 Ga0495640_0009394 3300046533 Bacteria 7616
337 Ga0495640_0647531 3300046533 Bacteria 636
338 Ga0495586_0010623 3300046535 Bacteria 4898
339 Ga0495586_0115457 3300046535 Bacteria 1497
340 Ga0495586_0160619 3300046535 Unclassified 1267
341 Ga0495598_0000333 3300046537 Bacteria 8405
342 Ga0495598_0153135 3300046537 Unclassified 806
343 Ga0495656_0002915 3300046615 Bacteria 5732
344 Ga0495656_0026988 3300046615 Bacteria 2290
345 Ga0495656_0109271 3300046615 Bacteria 1291
346 Ga0495634_0009039 3300046642 Bacteria 7369
347 Ga0495634_0445906 3300046642 Bacteria 764
348 Ga0495611_0144940 3300046648 Unclassified 1109
349 Ga0495635_0002047 3300046663 Bacteria 13658
350 Ga0495659_0003281 3300046664 Bacteria 5191
351 Ga0495588_0000766 3300046674 Bacteria 14586
352 Ga0495588_0035854 3300046674 Bacteria 2515
353 Ga0495588_0093722 3300046674 Bacteria 1574
354 Ga0495588_0161771 3300046674 Bacteria 1184
355 Ga0495588_0227947 3300046674 Bacteria 983
356 Ga0495588_0430681 3300046674 Bacteria 692
357 Ga0495647_0000825 3300046681 Bacteria 9267
358 Ga0495647_0034448 3300046681 Bacteria 1896
359 Ga0495658_0000117 3300046683 Bacteria 42835
360 Ga0495613_0000510 3300046689 Bacteria 32600
361 Ga0495613_0553584 3300046689 Bacteria 769
362 Ga0495624_0017716 3300046690 Bacteria 4776
363 Ga0495624_0094526 3300046690 Bacteria 1843
364 Ga0495624_0133642 3300046690 Bacteria 1521
365 Ga0495624_0625401 3300046690 Bacteria 641
366 Ga0495670_0013365 3300046691 Unclassified 4039
367 Ga0495670_0274268 3300046691 Unclassified 901
368 Ga0495589_0036734 3300046794 Bacteria 2455
369 Ga0495600_0616760 3300046809 Bacteria 658
370 Ga0495581_0000668 3300047315 Bacteria 18020
371 Ga0495636_0090497 3300047318 Unclassified 1328
372 Ga0495674_0003835 3300047319 Bacteria 14604
373 Ga0495676_0030526 3300047321 Bacteria 4572
374 Ga0495676_0054345 3300047321 Bacteria 3185
375 Ga0495680_0013976 3300047322 Bacteria 6979
376 Ga0495679_067221 3300047446 Bacteria 1039
377 Ga0495685_098540 3300047447 Unclassified 966
378 Ga0495681_0158121 3300047470 Unclassified 946
379 Ga0495593_0002954 3300047673 Bacteria 10229
380 Ga0495614_0019412 3300048089 Bacteria 2940
381 Ga0495614_0100383 3300048089 Bacteria 1264
382 Ga0496100_0012884 3300048903 Bacteria 4807
383 Ga0496101_0800064 3300048904 Bacteria 743
384 Ga0496102_0091732 3300048905 Bacteria 2812
385 Ga0496102_0197656 3300048905 Bacteria 1895
386 Ga0496102_0398290 3300048905 Bacteria 1294
387 Ga0496104_0741228 3300048907 Bacteria 890
388 Ga0496106_0004269 3300048909 Bacteria 10631
389 Ga0496107_0018399 3300048910 Bacteria 4919
390 Ga0496107_0206382 3300048910 Bacteria 1461
391 Ga0496108_0128957 3300048911 Bacteria 2173
392 Ga0496108_0158233 3300048911 Bacteria 1957
393 Ga0496109_0082323 3300048912 Bacteria 2966
394 Ga0496109_0793499 3300048912 Bacteria 885
395 Ga0496111_0245535 3300048914 Bacteria 1329
396 Ga0496111_0731615 3300048914 Bacteria 718
397 Ga0496111_0788016 3300048914 Bacteria 688
398 Ga0496112_0096596 3300048915 Bacteria 2925
399 Ga0496112_0931420 3300048915 Bacteria 790
400 Ga0496113_0454496 3300048916 Bacteria 1029
401 Ga0496114_0172982 3300048917 Bacteria 1883
402 Ga0496114_0363991 3300048917 Bacteria 1279
403 Ga0496115_0176393 3300048918 Bacteria 1767
404 Ga0501031_0161121 3300049568 Bacteria 1466
405 Ga0501032_0309425 3300049569 Bacteria 1020
406 Ga0501033_0127182 3300049570 Bacteria 1847
407 Ga0501036_0362261 3300049572 Bacteria 1210
408 Ga0501037_0035029 3300049573 Bacteria 3703
409 Ga0501037_0876950 3300049573 Bacteria 589
410 Ga0501038_0136463 3300049574 Bacteria 2009
411 Ga0501039_0049338 3300049575 Bacteria 3254
412 Ga0501039_0501030 3300049575 Bacteria 953
413 Ga0501040_0035135 3300049576 Bacteria 3398
414 Ga0501041_0523152 3300049577 Bacteria 755
415 Ga0501042_0090006 3300049578 Bacteria 2202
416 Ga0501042_0543172 3300049578 Bacteria 844
417 Ga0501046_0126343 3300049580 Bacteria 1942
418 Ga0501048_0005957 3300049582 Bacteria 9279
419 Ga0501048_0531551 3300049582 Bacteria 843
420 Ga0501048_0770706 3300049582 Bacteria 691
421 Ga0501048_0774394 3300049582 Bacteria 689
422 Ga0501067_0130292 3300049583 Bacteria 1400
423 Ga0501069_0012383 3300049585 Bacteria 4533
424 Ga0501070_0081864 3300049586 Bacteria 2671
425 Ga0501071_0028178 3300049587 Bacteria 3956
426 Ga0501071_0214295 3300049587 Unclassified 1448
427 Ga0501071_0627533 3300049587 Bacteria 827
428 Ga0501072_0124417 3300049588 Bacteria 2054
429 Ga0501072_0436948 3300049588 Bacteria 1037
430 Ga0501072_0837396 3300049588 Bacteria 719
431 Ga0501073_0029148 3300049589 Bacteria 3944
432 Ga0501074_0028763 3300049590 Bacteria 4026
433 Ga0501074_0402299 3300049590 Unclassified 971
434 Ga0501075_0022731 3300049591 Bacteria 4583
435 Ga0501076_0044862 3300049592 Bacteria 3488
436 Ga0501076_1546112 3300049592 Bacteria 545
437 Ga0501077_0014847 3300049593 Bacteria 4895
438 Ga0501079_0064247 3300049741 Bacteria 2831
439 Ga0501079_0111323 3300049741 Bacteria 2127
440 Ga0501080_0010438 3300049742 Bacteria 8501
441 Ga0501080_0224691 3300049742 Bacteria 1717
442 Ga0501081_0012923 3300049743 Bacteria 5493
443 Ga0501081_0255457 3300049743 Unclassified 1280
444 Ga0501081_0313776 3300049743 Bacteria 1151
445 Ga0501083_0091088 3300049744 Bacteria 2013
446 Ga0501035_0162064 3300049822 Bacteria 1935
447 Ga0501035_0252064 3300049822 Bacteria 1498
448 Ga0501045_0111318 3300049824 Bacteria 2030
449 Ga0501045_0158962 3300049824 Unclassified 1682
450 Ga0501045_0681890 3300049824 Unclassified 759
451 nmdc:mga05p37_10074_c1 3300050507 Bacteria 11220
452 nmdc:mga05p37_152053_c1 3300050507 Bacteria 2830
453 nmdc:mga05p37_16743_c1 3300050507 Bacteria 8837
454 nmdc:mga05p37_231374_c1 3300050507 Bacteria 2227
455 nmdc:mga05p37_391427_c1 3300050507 Unclassified 1625
456 nmdc:mga05p37_43476_c1 3300050507 Bacteria 5527
457 nmdc:mga09592_25113_c1 3300050508 Bacteria 4930
458 nmdc:mga09592_44913_c1 3300050508 Bacteria 3721
459 nmdc:mga09592_77450_c1 3300050508 Bacteria 2828
460 nmdc:mga09592_8110_c1 3300050508 Bacteria 8540
461 nmdc:mga0qj67_21520_c1 3300050509 Bacteria 4948
462 nmdc:mga0qj67_7756_c1 3300050509 Bacteria 7933
463 nmdc:mga0qj67_9117_c1 3300050509 Bacteria 7363
464 nmdc:mga06r32_226761_c1 3300050510 Bacteria 1857
465 nmdc:mga06r32_5133_c1 3300050510 Bacteria 11778
466 nmdc:mga08y16_303091_c1 3300050511 Bacteria 1647
467 nmdc:mga08y16_48480_c1 3300050511 Bacteria 4446
468 nmdc:mga08y16_92005_c1 3300050511 Bacteria 3161
469 nmdc:mga0n895_16496_c1 3300050512 Bacteria 6780
470 nmdc:mga0n895_238107_c1 3300050512 Bacteria 1847
471 nmdc:mga0n895_605570_c1 3300050512 Unclassified 1097
472 nmdc:mga0n895_632070_c1 3300050512 Bacteria 1071
473 nmdc:mga0rr50_207317_c1 3300050513 Bacteria 1613
474 nmdc:mga0rr50_398611_c1 3300050513 Bacteria 1162
475 nmdc:mga08x19_121343_c1 3300050514 Bacteria 1752
476 nmdc:mga0a205_32733_c1 3300050515 Bacteria 4984
477 nmdc:mga0a205_3284_c1 3300050515 Bacteria 14387
478 nmdc:mga0a205_382032_c1 3300050515 Unclassified 1273
479 nmdc:mga0a205_5107_c1 3300050515 Bacteria 11810
480 nmdc:mga0a205_581136_c1 3300050515 Bacteria 974
481 nmdc:mga0a205_754472_c1 3300050515 Bacteria 822
482 nmdc:mga0a205_8040_c1 3300050515 Bacteria 9589
483 Ga0495655_0224137 3300053083 Bacteria 623
484 Ga0495619_0003399 3300053085 Bacteria 10283
485 Ga0501084_0069869 3300054114 Bacteria 2940
486 Ga0501084_0403569 3300054114 Bacteria 1155
487 Ga0590075_042070 3300059424 Bacteria 1168
488 Ga0501082_0066719 3300060353 Bacteria 3099
489 Ga0501082_0242189 3300060353 Bacteria 1569
490 Ga0530510_0134436 3300061734 Bacteria 1820
491 Ga0530510_0241214 3300061734 Bacteria 1346
492 Ga0530510_0388861 3300061734 Bacteria 1050
493 Ga0530510_1004176 3300061734 Bacteria 638
494 Ga0373926_0000911
495 JGI24033J26618_1000518
496 JGI24751J29686_10000162
497 JGI24751J29686_10023696
498 JGI25407J50210_10000116
499 JGI25407J50210_10024180
500 JGI25407J50210_10038163
501 JGI25407J50210_10038512
502 JGI25407J50210_10060764
503 Ga0070676_10454078
504 Ga0070683_100686415
505 Ga0070690_100179039
506 Ga0070670_100001202
507 Ga0068869_100506342
508 Ga0068868_100095874
509 Ga0070661_100046203
510 Ga0070692_10184365
511 Ga0070668_100518531
512 Ga0070675_100116671
513 Ga0070671_100158041
514 Ga0070674_100010363
515 Ga0070674_100358816
516 Ga0070688_100796070
517 Ga0070703_10247150
518 Ga0070710_10604276
519 Ga0070701_10125307
520 Ga0070701_10280001
521 Ga0070711_100005731
522 Ga0070700_100004977
523 Ga0070700_100071512
524 Ga0070694_100022115
525 Ga0070708_100033153
526 Ga0070708_100144570
527 Ga0070708_100269573
528 Ga0070708_100477134
529 Ga0070708_101115280
530 Ga0070663_100107885
531 Ga0070663_100367672
532 Ga0068867_100070364
533 Ga0070685_10655625
534 Ga0070706_100881042
535 Ga0070707_100796950
536 Ga0070698_100093565
537 Ga0070698_100144175
538 Ga0070698_100336069
539 Ga0070699_100096464
540 Ga0070684_100037115
541 Ga0070686_100020292
542 Ga0070696_100007238
543 Ga0070696_100018991
544 Ga0070693_100474139
545 Ga0070704_100078892
546 Ga0070704_100372254
547 Ga0070704_100538881
548 Ga0068855_100528535
549 Ga0070664_100000383
550 Ga0068857_100066977
551 Ga0068857_100073481
552 Ga0068854_100420874
553 Ga0068864_100018829
554 Ga0068864_100158381
555 Ga0068866_10030420
556 Ga0068861_100012284
557 Ga0068870_10013467
558 Ga0068863_100096589
559 Ga0068860_100042884
560 Ga0068860_100176663
561 Ga0081455_10007612
562 Ga0081455_10013745
563 Ga0081455_10297365
564 Ga0081538_10000840
565 Ga0081538_10001113
566 Ga0081538_10003831
567 Ga0081538_10031902
568 Ga0081538_10089955
569 Ga0081538_10110538
570 Ga0081539_10274221
571 Ga0075432_10005132
572 Ga0070715_10013629
573 Ga0070712_100039590
574 Ga0075427_10003714
575 Ga0075427_10009479
576 Ga0075428_100006067
577 Ga0075428_100139393
578 Ga0075428_100189773
579 Ga0075428_100402271
580 Ga0075428_100570963
581 Ga0075428_100854879
582 Ga0075428_101425865
583 Ga0075430_100000412
584 Ga0075430_100021831
585 Ga0075430_100031698
586 Ga0075430_100138852
587 Ga0075431_100015926
588 Ga0075431_100095357
589 Ga0075431_100478981
590 Ga0075431_100629730
591 Ga0075433_10002046
592 Ga0075433_10004866
593 Ga0075434_100017776
594 Ga0075429_100000031
595 Ga0075429_100109908
596 Ga0075429_100217350
597 Ga0068865_100023394
598 Ga0068865_100219460
599 Ga0075435_100077362
600 Ga0075435_100399211
601 Ga0075435_101235480
602 Ga0111539_10008184
603 Ga0111539_10083941
604 Ga0111539_10289005
605 Ga0105245_10051449
606 Ga0105245_10367087
607 Ga0105245_10626364
608 Ga0105245_11247326
609 Ga0105247_10565831
610 Ga0114129_10003067
611 Ga0114129_10003648
612 Ga0114129_10046665
613 Ga0114129_10404308
614 Ga0114129_10817437
615 Ga0114129_10978851
616 Ga0114129_11708788
617 Ga0114129_11732825
618 Ga0105243_10003705
619 Ga0105243_10006788
620 Ga0105243_10115081
621 Ga0105243_10124030
622 Ga0105242_10010710
623 Ga0105242_10033664
624 Ga0105248_10229319
625 Ga0105249_10157731
626 Ga0105249_10203719
627 Ga0105249_10341499
628 Ga0105249_11247219
629 Ga0105239_10452636
630 Ga0105246_10024975
631 Ga0157378_10114095
632 Ga0157378_10412187
633 Ga0157378_10754265
634 Ga0163162_10065138
635 Ga0163162_10085177
636 Ga0163162_10381471
637 Ga0163162_10716761
638 Ga0157375_10209692
639 Ga0157375_12463249
640 Ga0163163_10059793
641 Ga0163163_10287995
642 Ga0157380_10055114
643 Ga0157380_10194324
644 Ga0157377_10352902
645 Ga0157376_10042446
646 Ga0163161_10181790
647 Ga0163161_10255806
648 Ga0207692_10267519
649 Ga0207688_10031401
650 Ga0207647_10365250
651 Ga0207685_10000364
652 Ga0207645_10027021
653 Ga0207643_10000165
654 Ga0207643_10248882
655 Ga0207684_10560875
656 Ga0207693_10002563
657 Ga0207693_10303894
658 Ga0207663_10024490
659 Ga0207660_10426452
660 Ga0207659_10336653
661 Ga0207659_10453555
662 Ga0207687_10291413
663 Ga0207687_11025637
664 Ga0207700_10317016
665 Ga0207664_10330231
666 Ga0207706_10088257
667 Ga0207686_10066478
668 Ga0207686_10339065
669 Ga0207709_10012276
670 Ga0207709_10069305
671 Ga0207709_10142491
672 Ga0207709_10594164
673 Ga0207669_10012784
674 Ga0207669_10194568
675 Ga0207704_10218246
676 Ga0207704_11123264
677 Ga0207665_10034954
678 Ga0207691_10856634
679 Ga0207711_10134422
680 Ga0207689_10013252
681 Ga0207661_10762564
682 Ga0207712_10032164
683 Ga0207712_10137592
684 Ga0207668_10395012
685 Ga0207677_10262991
686 Ga0207678_10093621
687 Ga0207678_10216243
688 Ga0207678_10412364
689 Ga0207708_10040006
690 Ga0207708_10043455
691 Ga0207708_10054084
692 Ga0207641_10125240
693 Ga0207648_10082847
694 Ga0207648_10742495
695 Ga0207676_10000396
696 Ga0207676_10706034
697 Ga0207675_100025282
698 Ga0207675_100081757
699 Ga0207683_10115812
700 Ga0207698_10557604
701 Ga0207428_10001364
702 Ga0207428_10001651
703 Ga0207428_10028704
704 Ga0268265_10238539
705 Ga0268265_10685999
706 Ga0307408_100263788
707 Ga0307408_100413782
708 Ga0307405_10014594
709 Ga0307405_10034931
710 Ga0307405_10244309
711 Ga0307413_10143308
712 Ga0307410_10019396
713 Ga0307410_10034367
714 Ga0307406_10001599
715 Ga0307406_10340102
716 Ga0307407_10004234
717 Ga0307407_10921548
718 Ga0307412_10013072
719 Ga0307412_10045627
720 Ga0307409_100005958
721 Ga0307409_100009277
722 Ga0307416_100011403
723 Ga0307416_100089442
724 Ga0307416_100351692
725 Ga0307416_100688317
726 Ga0307416_100708269
727 Ga0307416_100865607
728 Ga0307416_101126843
729 Ga0307414_10010248
730 Ga0307414_10041427
731 Ga0307411_10027617
732 Ga0307411_10098796
733 Ga0307415_100024266
734 Ga0307415_100070105
735 Ga0307415_100216471
736 Ga0307415_100259861
737 Ga0307415_100278778
738 Ga0307415_100320407
739 Ga0373929_0129956
740 Ga0373944_0000825
741 Ga0373951_0028807
742 Ga0373923_0001925
743 Ga0373945_0004707
744 Ga0373943_0051841
745 Ga0373946_0006663
746 Ga0373961_0027499
747 Ga0373931_0074033
748 Ga0373935_0009333
749 Ga0373927_0006026
750 Ga0373947_0003167
751 Ga0373947_0202692
752 Ga0373947_0307459
753 Ga0373937_0765419
754 Ga0373925_0025812
755 Ga0373925_0434161
756 Ga0395899_0088452
757 Ga0395899_0498044
758 Ga0395899_0660187
759 Ga0395900_0015921
760 Ga0395900_0035535
761 Ga0395900_0074805
762 Ga0395900_0136730
763 Ga0395900_0199883
764 Ga0395900_0523328
765 Ga0395898_0023601
766 Ga0395905_0027547
767 Ga0395905_0270750
768 Ga0395905_0461229
769 Ga0395905_0584759
770 Ga0395905_0869452
771 Ga0395901_0020232
772 Ga0395901_0054964
773 Ga0395901_0082494
774 Ga0395901_0096459
775 Ga0395901_0137515
776 Ga0395901_0182646
777 Ga0395901_0294310
778 Ga0395901_0443526
779 Ga0395901_0458151
780 Ga0439443_003586
781 Ga0439448_0089381
782 Ga0439448_0092753
783 Ga0439450_054247
784 Ga0439455_0020319
785 Ga0439456_029877
786 Ga0439463_002445
787 Ga0439463_054751
788 Ga0439463_076242
789 Ga0439444_0004546
790 Ga0439464_0048912
791 Ga0439440_0100940
792 Ga0495627_147210
793 Ga0495603_0003676
794 Ga0495603_0096901
795 Ga0495603_0150326
796 Ga0495603_0150985
797 Ga0495591_027446
798 Ga0495629_0011910
799 Ga0495629_0328720
800 Ga0495653_0159675
801 Ga0495580_0023460
802 Ga0495580_0222291
803 Ga0495582_0000946
804 Ga0495582_0010287
805 Ga0495582_0388140
806 Ga0495639_0003761
807 Ga0495639_0026239
808 Ga0495639_0035442
809 Ga0495662_0001801
810 Ga0495584_0022100
811 Ga0495584_0024924
812 Ga0495585_0098142
813 Ga0495594_0021827
814 Ga0495594_0131070
815 Ga0495594_0190603
816 Ga0495594_0219492
817 Ga0495616_0147845
818 Ga0495618_0104225
819 Ga0495630_0015105
820 Ga0495630_0224865
821 Ga0495644_0020548
822 Ga0495666_0002078
823 Ga0495666_0023434
824 Ga0495666_0118281
825 Ga0495642_0023754
826 Ga0495642_0219598
827 Ga0495665_0002519
828 Ga0495665_0094946
829 Ga0495640_0009394
830 Ga0495640_0647531
831 Ga0495586_0010623
832 Ga0495586_0115457
833 Ga0495586_0160619
834 Ga0495598_0000333
835 Ga0495598_0153135
836 Ga0495656_0002915
837 Ga0495656_0026988
838 Ga0495656_0109271
839 Ga0495634_0009039
840 Ga0495634_0445906
841 Ga0495611_0144940
842 Ga0495635_0002047
843 Ga0495659_0003281
844 Ga0495588_0000766
845 Ga0495588_0035854
846 Ga0495588_0093722
847 Ga0495588_0161771
848 Ga0495588_0227947
849 Ga0495588_0430681
850 Ga0495647_0000825
851 Ga0495647_0034448
852 Ga0495658_0000117
853 Ga0495613_0000510
854 Ga0495613_0553584
855 Ga0495624_0017716
856 Ga0495624_0094526
857 Ga0495624_0133642
858 Ga0495624_0625401
859 Ga0495670_0013365
860 Ga0495670_0274268
861 Ga0495589_0036734
862 Ga0495600_0616760
863 Ga0495581_0000668
864 Ga0495636_0090497
865 Ga0495674_0003835
866 Ga0495676_0030526
867 Ga0495676_0054345
868 Ga0495680_0013976
869 Ga0495679_067221
870 Ga0495685_098540
871 Ga0495681_0158121
872 Ga0495593_0002954
873 Ga0495614_0019412
874 Ga0495614_0100383
875 Ga0496100_0012884
876 Ga0496101_0800064
877 Ga0496102_0091732
878 Ga0496102_0197656
879 Ga0496102_0398290
880 Ga0496104_0741228
881 Ga0496106_0004269
882 Ga0496107_0018399
883 Ga0496107_0206382
884 Ga0496108_0128957
885 Ga0496108_0158233
886 Ga0496109_0082323
887 Ga0496109_0793499
888 Ga0496111_0245535
889 Ga0496111_0731615
890 Ga0496111_0788016
891 Ga0496112_0096596
892 Ga0496112_0931420
893 Ga0496113_0454496
894 Ga0496114_0172982
895 Ga0496114_0363991
896 Ga0496115_0176393
897 Ga0501031_0161121
898 Ga0501032_0309425
899 Ga0501033_0127182
900 Ga0501036_0362261
901 Ga0501037_0035029
902 Ga0501037_0876950
903 Ga0501038_0136463
904 Ga0501039_0049338
905 Ga0501039_0501030
906 Ga0501040_0035135
907 Ga0501041_0523152
908 Ga0501042_0090006
909 Ga0501042_0543172
910 Ga0501046_0126343
911 Ga0501048_0005957
912 Ga0501048_0531551
913 Ga0501048_0770706
914 Ga0501048_0774394
915 Ga0501067_0130292
916 Ga0501069_0012383
917 Ga0501070_0081864
918 Ga0501071_0028178
919 Ga0501071_0214295
920 Ga0501071_0627533
921 Ga0501072_0124417
922 Ga0501072_0436948
923 Ga0501072_0837396
924 Ga0501073_0029148
925 Ga0501074_0028763
926 Ga0501074_0402299
927 Ga0501075_0022731
928 Ga0501076_0044862
929 Ga0501076_1546112
930 Ga0501077_0014847
931 Ga0501079_0064247
932 Ga0501079_0111323
933 Ga0501080_0010438
934 Ga0501080_0224691
935 Ga0501081_0012923
936 Ga0501081_0255457
937 Ga0501081_0313776
938 Ga0501083_0091088
939 Ga0501035_0162064
940 Ga0501035_0252064
941 Ga0501045_0111318
942 Ga0501045_0158962
943 Ga0501045_0681890
944 nmdc:mga05p37_10074_c1
945 nmdc:mga05p37_152053_c1
946 nmdc:mga05p37_16743_c1
947 nmdc:mga05p37_231374_c1
948 nmdc:mga05p37_391427_c1
949 nmdc:mga05p37_43476_c1
950 nmdc:mga09592_25113_c1
951 nmdc:mga09592_44913_c1
952 nmdc:mga09592_77450_c1
953 nmdc:mga09592_8110_c1
954 nmdc:mga0qj67_21520_c1
955 nmdc:mga0qj67_7756_c1
956 nmdc:mga0qj67_9117_c1
957 nmdc:mga06r32_226761_c1
958 nmdc:mga06r32_5133_c1
959 nmdc:mga08y16_303091_c1
960 nmdc:mga08y16_48480_c1
961 nmdc:mga08y16_92005_c1
962 nmdc:mga0n895_16496_c1
963 nmdc:mga0n895_238107_c1
964 nmdc:mga0n895_605570_c1
965 nmdc:mga0n895_632070_c1
966 nmdc:mga0rr50_207317_c1
967 nmdc:mga0rr50_398611_c1
968 nmdc:mga08x19_121343_c1
969 nmdc:mga0a205_32733_c1
970 nmdc:mga0a205_3284_c1
971 nmdc:mga0a205_382032_c1
972 nmdc:mga0a205_5107_c1
973 nmdc:mga0a205_581136_c1
974 nmdc:mga0a205_754472_c1
975 nmdc:mga0a205_8040_c1
976 Ga0495655_0224137
977 Ga0495619_0003399
978 Ga0501084_0069869
979 Ga0501084_0403569
980 Ga0590075_042070
981 Ga0501082_0066719
982 Ga0501082_0242189
983 Ga0530510_0134436
984 Ga0530510_0241214
985 Ga0530510_0388861
986 Ga0530510_1004176

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01966

HD

HD domain

42

140

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
6pbz-assembly1.cif.gz_C crystal structure of escherichia coli gppa 0.6054 3 113
7yse-assembly1.cif.gz_C crystal structure of e. coli heterotetrameric glyrs in complex with trna 0.5919 1 172
4s1b-assembly3.cif.gz_A crystal structure of l. monocytogenes phosphodiesterase pgph hd domain in complex with cyclic-di-amp 0.5843 5 178
8wmy-assembly1.cif.gz_B-2 crystal structure of yqek in complex with mg and adp. 0.5803 1 168
7eiv-assembly1.cif.gz_C heterotetrameric glycyl-trna synthetase from escherichia coli 0.5785 4 172
ID Description Score Start End Superfamily
af_Q2G2T1_122_299_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.7075 22 110 1.10.3210.10
af_Q2FZ08_320_474_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.6906 6 140 1.10.3210.10
af_Q58188_1_153_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.6583 4 142 1.10.3210.10
2pjqA01 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;HD-domain/PDEase-like 0.629 4 86 1.10.472.50
af_Q58188_1_153_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.5977 4 142 1.10.3210.10
ID Description Score Start End GO Terms
AF-A0A7V3BVI4-F1-model_v4 HDIG domain-containing protein 1.001 1 181
AF-A0A538AIR8-F1-model_v4 HD domain-containing protein 0.9908 25 181
AF-A0A3D3Q4R5-F1-model_v4 Phosphohydrolase 0.981 1 121 GO:0016787
AF-A0A538AIR8-F1-model_v4 HD domain-containing protein 0.9784 25 181
AF-A0A538AUP7-F1-model_v4 Uncharacterized protein 0.9775 78 181

Map