F454451

General Info

Members Datasets Scaffolds Average Seq Length
493 190 986 297

Family's Representative Sequence

Representative Sequence 3300031824|Ga0307413_10005898|Ga0307413_100058982
Length 303
Sequence VKPIRIAIIGFGKIAADQHVPAIAANPRLDLVATSSRSGQGAGQQFTDWRELIRSVDGLEAVAITTPPAPRYEIARECVLAGLHCLLEKPPTATLAEVHDLACLAEAEQVTLQATWHARHHPAVDAAAQALAGKRIASEDVRKWHPGQKWIWDPAGFGVFDPGINAFSIATRIFPGSLFVRDARLSIPQNSQTPVAADITFASPEADGPLNASLDWRKSEGEEWTIAVTAADGLQLRLEGGGRTLILNGEARELPELGEYPGIYADFVDLIDERRSDVDVTPFRLVADCLMIGERHAVEAVVN

Samples

Sample ID Description Type Environment
1 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
8 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
9 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
87 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
133 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
134 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
135 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
136 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
137 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
138 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
139 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
140 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
141 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
142 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
143 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
144 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
145 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
146 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
147 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
148 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
149 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
150 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
151 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
152 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
153 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
154 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
155 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
156 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
157 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
158 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
159 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
160 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
161 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
162 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
163 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
164 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
165 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
166 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
167 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
168 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
169 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
170 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
171 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
172 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
173 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
174 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
175 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
176 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
177 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
178 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
179 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
180 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
181 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
182 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
183 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
184 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
185 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
186 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
187 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
188 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
189 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
190 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.2
Nodule 0
Rhizoplane 6.29
Rhizosphere 93.1
Stem 0
Stem Tuber 0
Unclassified 1.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307413_10005898 3300031824 Bacteria 5531
2 JGI24741J21665_1000732 3300001915 Bacteria 9848
3 JGI24740J21852_10002640 3300001979 Bacteria 8074
4 JGI24739J22299_10018634 3300001989 Bacteria 2492
5 JGI24737J22298_10037868 3300001990 Unclassified 1485
6 JGI24735J21928_10003057 3300002067 Bacteria 5740
7 JGI24735J21928_10032620 3300002067 Bacteria 1541
8 JGI24745J21846_1004531 3300002073 Unclassified 1489
9 JGI24744J21845_10000452 3300002077 Bacteria 7246
10 JGI24034J26672_10014102 3300002239 Bacteria 1217
11 Ga0070658_10016280 3300005327 Bacteria 5950
12 Ga0070658_10025479 3300005327 Bacteria 4741
13 Ga0070658_10111875 3300005327 Bacteria 2263
14 Ga0070658_10153953 3300005327 Bacteria 1926
15 Ga0070658_10165863 3300005327 Bacteria 1854
16 Ga0070658_10211491 3300005327 Bacteria 1638
17 Ga0070658_10228727 3300005327 Bacteria 1574
18 Ga0070658_10328401 3300005327 Bacteria 1307
19 Ga0070676_10056783 3300005328 Bacteria 2314
20 Ga0070676_10137565 3300005328 Bacteria 1551
21 Ga0070683_100045956 3300005329 Bacteria 4032
22 Ga0070683_100136101 3300005329 Bacteria 2326
23 Ga0070670_100000265 3300005331 Bacteria 46560
24 Ga0070670_100024187 3300005331 Bacteria 5226
25 Ga0070670_100047219 3300005331 Bacteria 3704
26 Ga0070670_100063327 3300005331 Bacteria 3174
27 Ga0070670_100316858 3300005331 Bacteria 1366
28 Ga0070677_10017924 3300005333 Bacteria 2543
29 Ga0070677_10091106 3300005333 Bacteria 1326
30 Ga0070677_10128046 3300005333 Bacteria 1155
31 Ga0070666_10000822 3300005335 Bacteria 18838
32 Ga0070680_100010873 3300005336 Bacteria 7032
33 Ga0070682_100006572 3300005337 Bacteria 6522
34 Ga0070682_100025495 3300005337 Bacteria 3529
35 Ga0068868_100002559 3300005338 Bacteria 12640
36 Ga0068868_100012563 3300005338 Bacteria 6193
37 Ga0068868_100022035 3300005338 Bacteria 4804
38 Ga0068868_100022300 3300005338 Bacteria 4776
39 Ga0070660_100113523 3300005339 Bacteria 2157
40 Ga0070660_100129138 3300005339 Bacteria 2021
41 Ga0070660_100276902 3300005339 Bacteria 1372
42 Ga0070661_100035035 3300005344 Bacteria 3643
43 Ga0070661_100056465 3300005344 Bacteria 2877
44 Ga0070661_100221730 3300005344 Bacteria 1451
45 Ga0070661_100326382 3300005344 Bacteria 1200
46 Ga0070692_10004073 3300005345 Bacteria 6043
47 Ga0070668_100152308 3300005347 Bacteria 1871
48 Ga0070669_100135326 3300005353 Bacteria 1895
49 Ga0070675_100024135 3300005354 Bacteria 4869
50 Ga0070675_100111948 3300005354 Bacteria 2311
51 Ga0070671_100002678 3300005355 Bacteria 13804
52 Ga0070671_100003224 3300005355 Bacteria 12714
53 Ga0070671_100008552 3300005355 Bacteria 8206
54 Ga0070671_100077911 3300005355 Bacteria 2770
55 Ga0070671_100116769 3300005355 Bacteria 2244
56 Ga0070671_100122567 3300005355 Bacteria 2188
57 Ga0070671_100285521 3300005355 Bacteria 1404
58 Ga0070674_100004496 3300005356 Bacteria 7955
59 Ga0070674_100010796 3300005356 Bacteria 5537
60 Ga0070674_100123999 3300005356 Bacteria 1916
61 Ga0070673_100003351 3300005364 Bacteria 9957
62 Ga0070673_100004605 3300005364 Bacteria 8744
63 Ga0070673_100035220 3300005364 Bacteria 3794
64 Ga0070673_100406991 3300005364 Bacteria 1218
65 Ga0070659_100136313 3300005366 Bacteria 1996
66 Ga0070667_100001996 3300005367 Bacteria 18084
67 Ga0070667_100005936 3300005367 Bacteria 10165
68 Ga0070667_100006388 3300005367 Bacteria 9794
69 Ga0070667_100043255 3300005367 Bacteria 3780
70 Ga0070667_100072047 3300005367 Bacteria 2943
71 Ga0070667_100118092 3300005367 Bacteria 2305
72 Ga0070667_100157232 3300005367 Bacteria 2000
73 Ga0070667_100220087 3300005367 Bacteria 1690
74 Ga0070709_10033457 3300005434 Bacteria 3109
75 Ga0070714_100019248 3300005435 Bacteria 5556
76 Ga0070714_100030257 3300005435 Bacteria 4505
77 Ga0070714_100042960 3300005435 Bacteria 3820
78 Ga0070663_100020110 3300005455 Bacteria 4415
79 Ga0070663_100022642 3300005455 Bacteria 4203
80 Ga0070663_100032460 3300005455 Bacteria 3599
81 Ga0070678_100002527 3300005456 Bacteria 10025
82 Ga0070678_100007934 3300005456 Bacteria 6323
83 Ga0070678_100009509 3300005456 Bacteria 5895
84 Ga0070678_100015186 3300005456 Bacteria 4887
85 Ga0070662_100001186 3300005457 Bacteria 15980
86 Ga0070662_100021283 3300005457 Bacteria 4427
87 Ga0070662_100040571 3300005457 Bacteria 3315
88 Ga0070662_100055380 3300005457 Bacteria 2877
89 Ga0070662_100083063 3300005457 Bacteria 2390
90 Ga0070662_100106640 3300005457 Bacteria 2129
91 Ga0070681_10232268 3300005458 Bacteria 1759
92 Ga0070681_10388720 3300005458 Bacteria 1306
93 Ga0068867_100187033 3300005459 Bacteria 1650
94 Ga0070679_100236278 3300005530 Bacteria 1786
95 Ga0070679_100236829 3300005530 Bacteria 1784
96 Ga0070679_100253313 3300005530 Bacteria 1716
97 Ga0070679_100286289 3300005530 Bacteria 1600
98 Ga0070684_100003211 3300005535 Bacteria 12228
99 Ga0070684_100031940 3300005535 Bacteria 4485
100 Ga0068853_100015391 3300005539 Bacteria 6283
101 Ga0068853_100155943 3300005539 Bacteria 2058
102 Ga0070672_100013891 3300005543 Bacteria 5698
103 Ga0070672_100026169 3300005543 Bacteria 4337
104 Ga0070672_100029291 3300005543 Bacteria 4128
105 Ga0070672_100039165 3300005543 Bacteria 3628
106 Ga0070696_100117337 3300005546 Bacteria 1923
107 Ga0070693_100025955 3300005547 Bacteria 3157
108 Ga0070693_100034128 3300005547 Bacteria 2814
109 Ga0070665_100014720 3300005548 Bacteria 7849
110 Ga0070665_100360676 3300005548 Bacteria 1459
111 Ga0068855_100019592 3300005563 Bacteria 8127
112 Ga0068855_100036388 3300005563 Bacteria 5859
113 Ga0068855_100528219 3300005563 Bacteria 1279
114 Ga0070664_100001299 3300005564 Bacteria 19974
115 Ga0070664_100002185 3300005564 Bacteria 15712
116 Ga0070664_100028991 3300005564 Bacteria 4611
117 Ga0070664_100031827 3300005564 Bacteria 4410
118 Ga0070664_100041230 3300005564 Bacteria 3895
119 Ga0070664_100171751 3300005564 Bacteria 1923
120 Ga0070664_100364973 3300005564 Bacteria 1316
121 Ga0070664_100542943 3300005564 Bacteria 1074
122 Ga0068857_100047538 3300005577 Bacteria 3809
123 Ga0068857_100113128 3300005577 Bacteria 2440
124 Ga0068854_100007835 3300005578 Bacteria 6834
125 Ga0068854_100077111 3300005578 Bacteria 2451
126 Ga0068854_100079363 3300005578 Bacteria 2419
127 Ga0068854_100122484 3300005578 Bacteria 1976
128 Ga0068856_100138008 3300005614 Bacteria 2444
129 Ga0068856_100237744 3300005614 Bacteria 1837
130 Ga0068856_100405360 3300005614 Bacteria 1383
131 Ga0068852_100005039 3300005616 Bacteria 9392
132 Ga0068852_100034853 3300005616 Bacteria 4192
133 Ga0068852_100060201 3300005616 Bacteria 3296
134 Ga0068852_100104246 3300005616 Bacteria 2567
135 Ga0068852_100211371 3300005616 Bacteria 1840
136 Ga0068852_100241834 3300005616 Bacteria 1725
137 Ga0068852_100274542 3300005616 Bacteria 1623
138 Ga0068859_100037017 3300005617 Bacteria 4897
139 Ga0068864_100005333 3300005618 Bacteria 10533
140 Ga0068864_100020365 3300005618 Bacteria 5549
141 Ga0068864_100035520 3300005618 Bacteria 4243
142 Ga0068866_10234382 3300005718 Bacteria 1115
143 Ga0068861_100171284 3300005719 Bacteria 1800
144 Ga0068851_10117714 3300005834 Bacteria 1425
145 Ga0068863_100000921 3300005841 Bacteria 29492
146 Ga0068863_100089482 3300005841 Bacteria 2919
147 Ga0068858_100003884 3300005842 Bacteria 14758
148 Ga0068858_100044690 3300005842 Bacteria 4105
149 Ga0068858_100244696 3300005842 Bacteria 1702
150 Ga0068860_100109110 3300005843 Bacteria 2645
151 Ga0068862_100016468 3300005844 Bacteria 6153
152 Ga0068862_100149682 3300005844 Bacteria 2077
153 Ga0081539_10004604 3300005985 Bacteria 15046
154 Ga0070716_100123256 3300006173 Bacteria 1626
155 Ga0070712_100018571 3300006175 Bacteria 4520
156 Ga0097621_100082482 3300006237 Bacteria 2677
157 Ga0068871_100259963 3300006358 Bacteria 1514
158 Ga0075429_100417575 3300006880 Bacteria 1175
159 Ga0068865_100005327 3300006881 Bacteria 7788
160 Ga0068865_100143505 3300006881 Bacteria 1803
161 Ga0097620_100037017 3300006931 Bacteria 4897
162 Ga0105240_10285672 3300009093 Bacteria 1894
163 Ga0105245_10242887 3300009098 Bacteria 1746
164 Ga0105243_10015618 3300009148 Bacteria 5740
165 Ga0105243_10037078 3300009148 Bacteria 3787
166 Ga0105243_10188038 3300009148 Bacteria 1801
167 Ga0105241_10259837 3300009174 Bacteria 1475
168 Ga0105241_10552001 3300009174 Bacteria 1034
169 Ga0105242_10007725 3300009176 Bacteria 8273
170 Ga0105248_10003349 3300009177 Bacteria 17812
171 Ga0105248_10021410 3300009177 Bacteria 7163
172 Ga0105248_10055619 3300009177 Bacteria 4439
173 Ga0105248_10095007 3300009177 Bacteria 3356
174 Ga0105248_10199728 3300009177 Bacteria 2253
175 Ga0105248_10275104 3300009177 Bacteria 1896
176 Ga0105248_10436365 3300009177 Bacteria 1475
177 Ga0105238_10458869 3300009551 Bacteria 1272
178 Ga0105239_10091021 3300010375 Bacteria 3366
179 Ga0157373_10018314 3300013100 Bacteria 5101
180 Ga0157373_10071272 3300013100 Bacteria 2455
181 Ga0157371_10023361 3300013102 Bacteria 4521
182 Ga0157371_10029402 3300013102 Bacteria 3974
183 Ga0157371_10030679 3300013102 Bacteria 3877
184 Ga0157371_10096233 3300013102 Bacteria 2098
185 Ga0157371_10206221 3300013102 Bacteria 1410
186 Ga0157370_10025947 3300013104 Bacteria 5793
187 Ga0157370_10027228 3300013104 Bacteria 5637
188 Ga0157370_10047519 3300013104 Bacteria 4114
189 Ga0157369_10001821 3300013105 Bacteria 25788
190 Ga0157369_10015070 3300013105 Bacteria 8727
191 Ga0157369_10039985 3300013105 Bacteria 5122
192 Ga0157369_10207719 3300013105 Bacteria 2053
193 Ga0157374_10021370 3300013296 Bacteria 5757
194 Ga0157374_10360173 3300013296 Bacteria 1446
195 Ga0157378_10469447 3300013297 Bacteria 1252
196 Ga0163162_10000839 3300013306 Bacteria 28555
197 Ga0157372_10134670 3300013307 Bacteria 2844
198 Ga0157372_10503574 3300013307 Bacteria 1412
199 Ga0157375_10003764 3300013308 Bacteria 13151
200 Ga0163163_10006126 3300014325 Bacteria 10476
201 Ga0157379_10388960 3300014968 Bacteria 1281
202 Ga0213876_10022950 3300021384 Bacteria 3296
203 Ga0207697_10016538 3300025315 Bacteria 3038
204 Ga0207656_10048630 3300025321 Bacteria 1826
205 Ga0207682_10039003 3300025893 Bacteria 1929
206 Ga0207682_10120496 3300025893 Bacteria 1163
207 Ga0207642_10006853 3300025899 Bacteria 3814
208 Ga0207688_10053071 3300025901 Bacteria 2272
209 Ga0207680_10001404 3300025903 Bacteria 11397
210 Ga0207680_10021339 3300025903 Bacteria 3503
211 Ga0207680_10030322 3300025903 Bacteria 3049
212 Ga0207680_10108221 3300025903 Bacteria 1798
213 Ga0207680_10282435 3300025903 Bacteria 1153
214 Ga0207647_10007691 3300025904 Bacteria 7763
215 Ga0207647_10009208 3300025904 Bacteria 7026
216 Ga0207647_10010964 3300025904 Bacteria 6375
217 Ga0207647_10057546 3300025904 Bacteria 2383
218 Ga0207645_10027226 3300025907 Bacteria 3693
219 Ga0207645_10043301 3300025907 Bacteria 2881
220 Ga0207705_10007915 3300025909 Bacteria 7800
221 Ga0207705_10009904 3300025909 Bacteria 6940
222 Ga0207705_10016552 3300025909 Bacteria 5283
223 Ga0207705_10026895 3300025909 Bacteria 4100
224 Ga0207705_10030966 3300025909 Bacteria 3818
225 Ga0207705_10046720 3300025909 Bacteria 3112
226 Ga0207705_10070893 3300025909 Bacteria 2526
227 Ga0207705_10089288 3300025909 Bacteria 2255
228 Ga0207705_10089494 3300025909 Bacteria 2253
229 Ga0207707_10346069 3300025912 Bacteria 1281
230 Ga0207663_10186106 3300025916 Bacteria 1487
231 Ga0207660_10006428 3300025917 Bacteria 7619
232 Ga0207660_10011138 3300025917 Bacteria 5846
233 Ga0207660_10197653 3300025917 Bacteria 1569
234 Ga0207657_10000267 3300025919 Bacteria 55426
235 Ga0207657_10003334 3300025919 Bacteria 17170
236 Ga0207657_10003760 3300025919 Bacteria 16129
237 Ga0207657_10005591 3300025919 Bacteria 13126
238 Ga0207657_10021440 3300025919 Bacteria 6080
239 Ga0207657_10042503 3300025919 Bacteria 4009
240 Ga0207657_10125464 3300025919 Bacteria 2108
241 Ga0207649_10011588 3300025920 Bacteria 4866
242 Ga0207652_10026313 3300025921 Bacteria 4844
243 Ga0207650_10046820 3300025925 Bacteria 3185
244 Ga0207650_10159140 3300025925 Bacteria 1788
245 Ga0207650_10262532 3300025925 Bacteria 1401
246 Ga0207659_10413966 3300025926 Bacteria 1129
247 Ga0207687_10334249 3300025927 Bacteria 1230
248 Ga0207687_10473402 3300025927 Bacteria 1042
249 Ga0207700_10090242 3300025928 Bacteria 2418
250 Ga0207664_10023765 3300025929 Bacteria 4598
251 Ga0207664_10169503 3300025929 Bacteria 1867
252 Ga0207644_10000153 3300025931 Bacteria 49585
253 Ga0207644_10002867 3300025931 Bacteria 11114
254 Ga0207644_10005857 3300025931 Bacteria 8010
255 Ga0207644_10007309 3300025931 Bacteria 7188
256 Ga0207644_10064001 3300025931 Bacteria 2672
257 Ga0207644_10085827 3300025931 Bacteria 2336
258 Ga0207644_10097152 3300025931 Bacteria 2206
259 Ga0207644_10380145 3300025931 Bacteria 1151
260 Ga0207690_10005529 3300025932 Bacteria 7459
261 Ga0207690_10115433 3300025932 Bacteria 1940
262 Ga0207706_10000285 3300025933 Bacteria 55179
263 Ga0207706_10005076 3300025933 Bacteria 12297
264 Ga0207706_10010395 3300025933 Bacteria 8502
265 Ga0207706_10017326 3300025933 Bacteria 6489
266 Ga0207706_10020276 3300025933 Bacteria 5976
267 Ga0207706_10027770 3300025933 Bacteria 5059
268 Ga0207706_10059209 3300025933 Bacteria 3373
269 Ga0207709_10022024 3300025935 Bacteria 3612
270 Ga0207709_10099227 3300025935 Bacteria 1922
271 Ga0207669_10007794 3300025937 Bacteria 4983
272 Ga0207669_10008262 3300025937 Bacteria 4878
273 Ga0207669_10126452 3300025937 Bacteria 1747
274 Ga0207704_10014312 3300025938 Bacteria 4002
275 Ga0207704_10017092 3300025938 Bacteria 3750
276 Ga0207691_10003885 3300025940 Bacteria 14507
277 Ga0207691_10007857 3300025940 Bacteria 10275
278 Ga0207691_10021988 3300025940 Bacteria 6019
279 Ga0207691_10036611 3300025940 Bacteria 4547
280 Ga0207691_10038432 3300025940 Bacteria 4429
281 Ga0207691_10106398 3300025940 Bacteria 2499
282 Ga0207711_10000500 3300025941 Bacteria 40435
283 Ga0207711_10001810 3300025941 Bacteria 19532
284 Ga0207711_10058088 3300025941 Bacteria 3328
285 Ga0207711_10069237 3300025941 Bacteria 3058
286 Ga0207711_10312018 3300025941 Bacteria 1452
287 Ga0207711_10336039 3300025941 Bacteria 1397
288 Ga0207711_10458014 3300025941 Bacteria 1187
289 Ga0207661_10049068 3300025944 Bacteria 3358
290 Ga0207679_10010347 3300025945 Bacteria 6003
291 Ga0207679_10257337 3300025945 Bacteria 1487
292 Ga0207679_10385140 3300025945 Unclassified 1230
293 Ga0207667_10038495 3300025949 Bacteria 5108
294 Ga0207667_10197768 3300025949 Bacteria 2062
295 Ga0207651_10001364 3300025960 Bacteria 11061
296 Ga0207651_10003307 3300025960 Bacteria 7899
297 Ga0207651_10062659 3300025960 Bacteria 2592
298 Ga0207651_10144566 3300025960 Bacteria 1842
299 Ga0207651_10359525 3300025960 Bacteria 1228
300 Ga0207651_10517962 3300025960 Bacteria 1033
301 Ga0207668_10011413 3300025972 Bacteria 5397
302 Ga0207668_10320124 3300025972 Bacteria 1287
303 Ga0207658_10003101 3300025986 Bacteria 11895
304 Ga0207658_10003348 3300025986 Bacteria 11367
305 Ga0207658_10024502 3300025986 Bacteria 4223
306 Ga0207658_10098856 3300025986 Bacteria 2281
307 Ga0207658_10098990 3300025986 Bacteria 2280
308 Ga0207658_10129939 3300025986 Bacteria 2022
309 Ga0207677_10001622 3300026023 Bacteria 11935
310 Ga0207677_10011133 3300026023 Bacteria 5115
311 Ga0207677_10031012 3300026023 Bacteria 3420
312 Ga0207703_10000515 3300026035 Bacteria 39972
313 Ga0207703_10021645 3300026035 Bacteria 5033
314 Ga0207678_10000732 3300026067 Bacteria 30036
315 Ga0207678_10005020 3300026067 Bacteria 11873
316 Ga0207678_10019178 3300026067 Bacteria 6005
317 Ga0207678_10020554 3300026067 Bacteria 5788
318 Ga0207678_10061636 3300026067 Bacteria 3226
319 Ga0207678_10062769 3300026067 Bacteria 3193
320 Ga0207678_10093451 3300026067 Bacteria 2570
321 Ga0207678_10214394 3300026067 Bacteria 1647
322 Ga0207702_10097893 3300026078 Bacteria 2583
323 Ga0207702_10105861 3300026078 Bacteria 2492
324 Ga0207702_10146768 3300026078 Bacteria 2141
325 Ga0207702_10152891 3300026078 Bacteria 2101
326 Ga0207702_10509112 3300026078 Bacteria 1174
327 Ga0207641_10005042 3300026088 Bacteria 11314
328 Ga0207641_10185991 3300026088 Bacteria 1906
329 Ga0207641_10263736 3300026088 Bacteria 1614
330 Ga0207648_10006196 3300026089 Bacteria 11911
331 Ga0207648_10008508 3300026089 Bacteria 9929
332 Ga0207648_10239231 3300026089 Bacteria 1616
333 Ga0207648_10486939 3300026089 Bacteria 1127
334 Ga0207676_10003246 3300026095 Bacteria 11578
335 Ga0207674_10006972 3300026116 Bacteria 13225
336 Ga0207674_10012168 3300026116 Bacteria 9633
337 Ga0207674_10040693 3300026116 Bacteria 4813
338 Ga0207674_10062411 3300026116 Bacteria 3764
339 Ga0207675_100052140 3300026118 Bacteria 3818
340 Ga0207675_100086923 3300026118 Bacteria 2936
341 Ga0207683_10007755 3300026121 Bacteria 9187
342 Ga0207683_10013330 3300026121 Bacteria 7009
343 Ga0207683_10017765 3300026121 Bacteria 6066
344 Ga0207683_10021041 3300026121 Bacteria 5583
345 Ga0207683_10047658 3300026121 Bacteria 3752
346 Ga0207698_10039388 3300026142 Bacteria 3501
347 Ga0207698_10077257 3300026142 Bacteria 2669
348 Ga0207698_10379433 3300026142 Bacteria 1344
349 Ga0316182_1343181 3300030745 Bacteria 1979
350 Ga0307408_100031177 3300031548 Bacteria 3710
351 Ga0307408_100124922 3300031548 Bacteria 1999
352 Ga0307405_10083925 3300031731 Bacteria 2089
353 Ga0307405_10134747 3300031731 Bacteria 1713
354 Ga0307413_10010609 3300031824 Bacteria 4482
355 Ga0307413_10079836 3300031824 Bacteria 2093
356 Ga0307410_10001946 3300031852 Bacteria 9696
357 Ga0307410_10014749 3300031852 Bacteria 4611
358 Ga0307407_10049700 3300031903 Bacteria 2395
359 Ga0307412_10029057 3300031911 Bacteria 3466
360 Ga0307409_100016999 3300031995 Bacteria 4834
361 Ga0307409_100023898 3300031995 Bacteria 4247
362 Ga0307409_100050505 3300031995 Bacteria 3176
363 Ga0307409_100260538 3300031995 Bacteria 1591
364 Ga0307416_100001051 3300032002 Bacteria 14704
365 Ga0307416_100144537 3300032002 Bacteria 2169
366 Ga0307416_100308925 3300032002 Bacteria 1576
367 Ga0307414_10034656 3300032004 Bacteria 3350
368 Ga0307414_10165549 3300032004 Bacteria 1761
369 Ga0307411_10014921 3300032005 Bacteria 4341
370 Ga0307411_10026002 3300032005 Bacteria 3516
371 Ga0307415_100007655 3300032126 Bacteria 5926
372 Ga0307415_100068155 3300032126 Bacteria 2489
373 Ga0307415_100092021 3300032126 Bacteria 2198
374 Ga0395899_0000706 3300037312 Bacteria 33556
375 Ga0395899_0000881 3300037312 Bacteria 28514
376 Ga0395899_0005357 3300037312 Bacteria 9967
377 Ga0395899_0016076 3300037312 Bacteria 5705
378 Ga0395899_0050887 3300037312 Bacteria 3074
379 Ga0395899_0051876 3300037312 Bacteria 3042
380 Ga0395899_0089079 3300037312 Bacteria 2239
381 Ga0395899_0144713 3300037312 Bacteria 1689
382 Ga0395899_0227232 3300037312 Bacteria 1290
383 Ga0395899_0270509 3300037312 Bacteria 1159
384 Ga0395900_0000161 3300037418 Bacteria 110637
385 Ga0395900_0000447 3300037418 Bacteria 59069
386 Ga0395900_0000564 3300037418 Bacteria 51387
387 Ga0395900_0003293 3300037418 Bacteria 17476
388 Ga0395900_0006151 3300037418 Bacteria 12530
389 Ga0395900_0027740 3300037418 Bacteria 5801
390 Ga0395900_0040833 3300037418 Bacteria 4782
391 Ga0395900_0046758 3300037418 Bacteria 4456
392 Ga0395900_0064356 3300037418 Bacteria 3769
393 Ga0395900_0065638 3300037418 Bacteria 3729
394 Ga0395900_0462531 3300037418 Bacteria 1223
395 Ga0395898_0000937 3300037466 Bacteria 46531
396 Ga0395898_0000941 3300037466 Bacteria 46344
397 Ga0395898_0005900 3300037466 Bacteria 13169
398 Ga0395898_0113304 3300037466 Bacteria 2599
399 Ga0395898_0214807 3300037466 Bacteria 1835
400 Ga0395898_0252693 3300037466 Bacteria 1681
401 Ga0395898_0537531 3300037466 Bacteria 1110
402 Ga0395905_0000120 3300037471 Bacteria 130865
403 Ga0395905_0000926 3300037471 Bacteria 37874
404 Ga0395905_0001255 3300037471 Bacteria 31369
405 Ga0395905_0011304 3300037471 Bacteria 8632
406 Ga0395905_0012382 3300037471 Bacteria 8212
407 Ga0395905_0040997 3300037471 Bacteria 4344
408 Ga0395905_0098696 3300037471 Bacteria 2743
409 Ga0395905_0120366 3300037471 Bacteria 2468
410 Ga0395905_0120727 3300037471 Bacteria 2463
411 Ga0395905_0123232 3300037471 Bacteria 2437
412 Ga0395905_0165018 3300037471 Bacteria 2081
413 Ga0395905_0204656 3300037471 Bacteria 1850
414 Ga0395905_0333408 3300037471 Bacteria 1408
415 Ga0395905_0458146 3300037471 Bacteria 1173
416 Ga0395901_0000324 3300038443 Bacteria 59134
417 Ga0395901_0001094 3300038443 Bacteria 28836
418 Ga0395901_0001229 3300038443 Bacteria 27314
419 Ga0395901_0004800 3300038443 Bacteria 13639
420 Ga0395901_0040161 3300038443 Bacteria 4845
421 Ga0395901_0133741 3300038443 Bacteria 2606
422 Ga0395901_0194649 3300038443 Bacteria 2126
423 Ga0395901_0474900 3300038443 Unclassified 1276
424 Ga0436365_0788426 3300039437 Bacteria 5946
425 Ga0439432_012008 3300042006 Bacteria 2975
426 Ga0450912_000227 3300042116 Bacteria 2406
427 Ga0466969_0084353 3300044656 Bacteria 1512
428 Ga0466972_0039194 3300044658 Bacteria 2313
429 Ga0466965_0014312 3300044683 Bacteria 3753
430 Ga0466966_0002814 3300044684 Bacteria 11446
431 Ga0466966_0073982 3300044684 Unclassified 2130
432 Ga0466961_0001787 3300044693 Bacteria 13319
433 Ga0466961_0095736 3300044693 Bacteria 1872
434 Ga0466961_0114041 3300044693 Unclassified 1699
435 Ga0466963_0042663 3300044694 Bacteria 2979
436 Ga0466968_0045396 3300044735 Bacteria 1864
437 Ga0466970_0046503 3300044765 Bacteria 2311
438 Ga0466960_0013669 3300044901 Bacteria 3456
439 Ga0466959_0012973 3300045049 Bacteria 6034
440 Ga0466959_0087936 3300045049 Bacteria 2234
441 Ga0466958_0078849 3300045836 Bacteria 2024
442 Ga0466967_0027661 3300045976 Bacteria 4720
443 Ga0466967_0047831 3300045976 Bacteria 3731
444 Ga0466967_0066016 3300045976 Bacteria 3223
445 Ga0495580_0191157 3300046472 Bacteria 1412
446 Ga0495663_0006139 3300046525 Bacteria 3321
447 Ga0495621_0000207 3300046539 Bacteria 13689
448 Ga0495668_0007381 3300046616 Bacteria 7038
449 Ga0495623_0031826 3300046679 Bacteria 3391
450 Ga0495669_0002246 3300046684 Bacteria 7922
451 Ga0495669_0004237 3300046684 Bacteria 5907
452 Ga0495669_0004574 3300046684 Bacteria 5727
453 Ga0495669_0080860 3300046684 Bacteria 1491
454 Ga0495670_0000467 3300046691 Bacteria 19301
455 Ga0496100_0003792 3300048903 Bacteria 7913
456 Ga0496101_0001530 3300048904 Bacteria 13854
457 Ga0496101_0030275 3300048904 Bacteria 3793
458 Ga0496101_0051886 3300048904 Bacteria 2956
459 Ga0496103_0048841 3300048906 Bacteria 2616
460 Ga0496106_0050826 3300048909 Bacteria 3124
461 Ga0496106_0063495 3300048909 Bacteria 2807
462 Ga0496107_0002535 3300048910 Bacteria 11898
463 Ga0496107_0011089 3300048910 Bacteria 6270
464 Ga0496107_0112610 3300048910 Bacteria 2001
465 Ga0496108_0004255 3300048911 Bacteria 11525
466 Ga0496108_0506202 3300048911 Bacteria 1054
467 Ga0496109_0081821 3300048912 Bacteria 2975
468 Ga0496109_0088738 3300048912 Bacteria 2858
469 Ga0496109_0266292 3300048912 Bacteria 1614
470 Ga0496110_0000847 3300048913 Bacteria 21521
471 Ga0496110_0012913 3300048913 Bacteria 6887
472 Ga0496111_0003138 3300048914 Bacteria 10164
473 Ga0496111_0034650 3300048914 Bacteria 3605
474 Ga0496111_0070902 3300048914 Unclassified 2536
475 Ga0496111_0124037 3300048914 Bacteria 1909
476 Ga0496112_0005760 3300048915 Bacteria 10774
477 Ga0496112_0005909 3300048915 Bacteria 10673
478 Ga0496112_0108778 3300048915 Bacteria 2742
479 Ga0496112_0140430 3300048915 Bacteria 2385
480 Ga0496112_0272076 3300048915 Bacteria 1642
481 Ga0496112_0513679 3300048915 Bacteria 1133
482 Ga0496113_0020778 3300048916 Bacteria 4623
483 Ga0496113_0025623 3300048916 Bacteria 4206
484 Ga0496114_0000109 3300048917 Bacteria 59733
485 Ga0496115_0011486 3300048918 Bacteria 6641
486 Ga0501067_0032165 3300049583 Bacteria 2912
487 Ga0501074_0065000 3300049590 Bacteria 2626
488 Ga0501233_002993 3300049668 Bacteria 3020
489 Ga0501234_015610 3300049707 Bacteria 1196
490 Ga0501080_0056533 3300049742 Bacteria 3654
491 Ga0501268_011570 3300049765 Bacteria 1395
492 nmdc:mga09592_366217_c1 3300050508 Bacteria 1247
493 Ga0500658_0000173 3300053134 Bacteria 30720
494 Ga0307413_10005898
495 JGI24741J21665_1000732
496 JGI24740J21852_10002640
497 JGI24739J22299_10018634
498 JGI24737J22298_10037868
499 JGI24735J21928_10003057
500 JGI24735J21928_10032620
501 JGI24745J21846_1004531
502 JGI24744J21845_10000452
503 JGI24034J26672_10014102
504 Ga0070658_10016280
505 Ga0070658_10025479
506 Ga0070658_10111875
507 Ga0070658_10153953
508 Ga0070658_10165863
509 Ga0070658_10211491
510 Ga0070658_10228727
511 Ga0070658_10328401
512 Ga0070676_10056783
513 Ga0070676_10137565
514 Ga0070683_100045956
515 Ga0070683_100136101
516 Ga0070670_100000265
517 Ga0070670_100024187
518 Ga0070670_100047219
519 Ga0070670_100063327
520 Ga0070670_100316858
521 Ga0070677_10017924
522 Ga0070677_10091106
523 Ga0070677_10128046
524 Ga0070666_10000822
525 Ga0070680_100010873
526 Ga0070682_100006572
527 Ga0070682_100025495
528 Ga0068868_100002559
529 Ga0068868_100012563
530 Ga0068868_100022035
531 Ga0068868_100022300
532 Ga0070660_100113523
533 Ga0070660_100129138
534 Ga0070660_100276902
535 Ga0070661_100035035
536 Ga0070661_100056465
537 Ga0070661_100221730
538 Ga0070661_100326382
539 Ga0070692_10004073
540 Ga0070668_100152308
541 Ga0070669_100135326
542 Ga0070675_100024135
543 Ga0070675_100111948
544 Ga0070671_100002678
545 Ga0070671_100003224
546 Ga0070671_100008552
547 Ga0070671_100077911
548 Ga0070671_100116769
549 Ga0070671_100122567
550 Ga0070671_100285521
551 Ga0070674_100004496
552 Ga0070674_100010796
553 Ga0070674_100123999
554 Ga0070673_100003351
555 Ga0070673_100004605
556 Ga0070673_100035220
557 Ga0070673_100406991
558 Ga0070659_100136313
559 Ga0070667_100001996
560 Ga0070667_100005936
561 Ga0070667_100006388
562 Ga0070667_100043255
563 Ga0070667_100072047
564 Ga0070667_100118092
565 Ga0070667_100157232
566 Ga0070667_100220087
567 Ga0070709_10033457
568 Ga0070714_100019248
569 Ga0070714_100030257
570 Ga0070714_100042960
571 Ga0070663_100020110
572 Ga0070663_100022642
573 Ga0070663_100032460
574 Ga0070678_100002527
575 Ga0070678_100007934
576 Ga0070678_100009509
577 Ga0070678_100015186
578 Ga0070662_100001186
579 Ga0070662_100021283
580 Ga0070662_100040571
581 Ga0070662_100055380
582 Ga0070662_100083063
583 Ga0070662_100106640
584 Ga0070681_10232268
585 Ga0070681_10388720
586 Ga0068867_100187033
587 Ga0070679_100236278
588 Ga0070679_100236829
589 Ga0070679_100253313
590 Ga0070679_100286289
591 Ga0070684_100003211
592 Ga0070684_100031940
593 Ga0068853_100015391
594 Ga0068853_100155943
595 Ga0070672_100013891
596 Ga0070672_100026169
597 Ga0070672_100029291
598 Ga0070672_100039165
599 Ga0070696_100117337
600 Ga0070693_100025955
601 Ga0070693_100034128
602 Ga0070665_100014720
603 Ga0070665_100360676
604 Ga0068855_100019592
605 Ga0068855_100036388
606 Ga0068855_100528219
607 Ga0070664_100001299
608 Ga0070664_100002185
609 Ga0070664_100028991
610 Ga0070664_100031827
611 Ga0070664_100041230
612 Ga0070664_100171751
613 Ga0070664_100364973
614 Ga0070664_100542943
615 Ga0068857_100047538
616 Ga0068857_100113128
617 Ga0068854_100007835
618 Ga0068854_100077111
619 Ga0068854_100079363
620 Ga0068854_100122484
621 Ga0068856_100138008
622 Ga0068856_100237744
623 Ga0068856_100405360
624 Ga0068852_100005039
625 Ga0068852_100034853
626 Ga0068852_100060201
627 Ga0068852_100104246
628 Ga0068852_100211371
629 Ga0068852_100241834
630 Ga0068852_100274542
631 Ga0068859_100037017
632 Ga0068864_100005333
633 Ga0068864_100020365
634 Ga0068864_100035520
635 Ga0068866_10234382
636 Ga0068861_100171284
637 Ga0068851_10117714
638 Ga0068863_100000921
639 Ga0068863_100089482
640 Ga0068858_100003884
641 Ga0068858_100044690
642 Ga0068858_100244696
643 Ga0068860_100109110
644 Ga0068862_100016468
645 Ga0068862_100149682
646 Ga0081539_10004604
647 Ga0070716_100123256
648 Ga0070712_100018571
649 Ga0097621_100082482
650 Ga0068871_100259963
651 Ga0075429_100417575
652 Ga0068865_100005327
653 Ga0068865_100143505
654 Ga0097620_100037017
655 Ga0105240_10285672
656 Ga0105245_10242887
657 Ga0105243_10015618
658 Ga0105243_10037078
659 Ga0105243_10188038
660 Ga0105241_10259837
661 Ga0105241_10552001
662 Ga0105242_10007725
663 Ga0105248_10003349
664 Ga0105248_10021410
665 Ga0105248_10055619
666 Ga0105248_10095007
667 Ga0105248_10199728
668 Ga0105248_10275104
669 Ga0105248_10436365
670 Ga0105238_10458869
671 Ga0105239_10091021
672 Ga0157373_10018314
673 Ga0157373_10071272
674 Ga0157371_10023361
675 Ga0157371_10029402
676 Ga0157371_10030679
677 Ga0157371_10096233
678 Ga0157371_10206221
679 Ga0157370_10025947
680 Ga0157370_10027228
681 Ga0157370_10047519
682 Ga0157369_10001821
683 Ga0157369_10015070
684 Ga0157369_10039985
685 Ga0157369_10207719
686 Ga0157374_10021370
687 Ga0157374_10360173
688 Ga0157378_10469447
689 Ga0163162_10000839
690 Ga0157372_10134670
691 Ga0157372_10503574
692 Ga0157375_10003764
693 Ga0163163_10006126
694 Ga0157379_10388960
695 Ga0213876_10022950
696 Ga0207697_10016538
697 Ga0207656_10048630
698 Ga0207682_10039003
699 Ga0207682_10120496
700 Ga0207642_10006853
701 Ga0207688_10053071
702 Ga0207680_10001404
703 Ga0207680_10021339
704 Ga0207680_10030322
705 Ga0207680_10108221
706 Ga0207680_10282435
707 Ga0207647_10007691
708 Ga0207647_10009208
709 Ga0207647_10010964
710 Ga0207647_10057546
711 Ga0207645_10027226
712 Ga0207645_10043301
713 Ga0207705_10007915
714 Ga0207705_10009904
715 Ga0207705_10016552
716 Ga0207705_10026895
717 Ga0207705_10030966
718 Ga0207705_10046720
719 Ga0207705_10070893
720 Ga0207705_10089288
721 Ga0207705_10089494
722 Ga0207707_10346069
723 Ga0207663_10186106
724 Ga0207660_10006428
725 Ga0207660_10011138
726 Ga0207660_10197653
727 Ga0207657_10000267
728 Ga0207657_10003334
729 Ga0207657_10003760
730 Ga0207657_10005591
731 Ga0207657_10021440
732 Ga0207657_10042503
733 Ga0207657_10125464
734 Ga0207649_10011588
735 Ga0207652_10026313
736 Ga0207650_10046820
737 Ga0207650_10159140
738 Ga0207650_10262532
739 Ga0207659_10413966
740 Ga0207687_10334249
741 Ga0207687_10473402
742 Ga0207700_10090242
743 Ga0207664_10023765
744 Ga0207664_10169503
745 Ga0207644_10000153
746 Ga0207644_10002867
747 Ga0207644_10005857
748 Ga0207644_10007309
749 Ga0207644_10064001
750 Ga0207644_10085827
751 Ga0207644_10097152
752 Ga0207644_10380145
753 Ga0207690_10005529
754 Ga0207690_10115433
755 Ga0207706_10000285
756 Ga0207706_10005076
757 Ga0207706_10010395
758 Ga0207706_10017326
759 Ga0207706_10020276
760 Ga0207706_10027770
761 Ga0207706_10059209
762 Ga0207709_10022024
763 Ga0207709_10099227
764 Ga0207669_10007794
765 Ga0207669_10008262
766 Ga0207669_10126452
767 Ga0207704_10014312
768 Ga0207704_10017092
769 Ga0207691_10003885
770 Ga0207691_10007857
771 Ga0207691_10021988
772 Ga0207691_10036611
773 Ga0207691_10038432
774 Ga0207691_10106398
775 Ga0207711_10000500
776 Ga0207711_10001810
777 Ga0207711_10058088
778 Ga0207711_10069237
779 Ga0207711_10312018
780 Ga0207711_10336039
781 Ga0207711_10458014
782 Ga0207661_10049068
783 Ga0207679_10010347
784 Ga0207679_10257337
785 Ga0207679_10385140
786 Ga0207667_10038495
787 Ga0207667_10197768
788 Ga0207651_10001364
789 Ga0207651_10003307
790 Ga0207651_10062659
791 Ga0207651_10144566
792 Ga0207651_10359525
793 Ga0207651_10517962
794 Ga0207668_10011413
795 Ga0207668_10320124
796 Ga0207658_10003101
797 Ga0207658_10003348
798 Ga0207658_10024502
799 Ga0207658_10098856
800 Ga0207658_10098990
801 Ga0207658_10129939
802 Ga0207677_10001622
803 Ga0207677_10011133
804 Ga0207677_10031012
805 Ga0207703_10000515
806 Ga0207703_10021645
807 Ga0207678_10000732
808 Ga0207678_10005020
809 Ga0207678_10019178
810 Ga0207678_10020554
811 Ga0207678_10061636
812 Ga0207678_10062769
813 Ga0207678_10093451
814 Ga0207678_10214394
815 Ga0207702_10097893
816 Ga0207702_10105861
817 Ga0207702_10146768
818 Ga0207702_10152891
819 Ga0207702_10509112
820 Ga0207641_10005042
821 Ga0207641_10185991
822 Ga0207641_10263736
823 Ga0207648_10006196
824 Ga0207648_10008508
825 Ga0207648_10239231
826 Ga0207648_10486939
827 Ga0207676_10003246
828 Ga0207674_10006972
829 Ga0207674_10012168
830 Ga0207674_10040693
831 Ga0207674_10062411
832 Ga0207675_100052140
833 Ga0207675_100086923
834 Ga0207683_10007755
835 Ga0207683_10013330
836 Ga0207683_10017765
837 Ga0207683_10021041
838 Ga0207683_10047658
839 Ga0207698_10039388
840 Ga0207698_10077257
841 Ga0207698_10379433
842 Ga0316182_1343181
843 Ga0307408_100031177
844 Ga0307408_100124922
845 Ga0307405_10083925
846 Ga0307405_10134747
847 Ga0307413_10010609
848 Ga0307413_10079836
849 Ga0307410_10001946
850 Ga0307410_10014749
851 Ga0307407_10049700
852 Ga0307412_10029057
853 Ga0307409_100016999
854 Ga0307409_100023898
855 Ga0307409_100050505
856 Ga0307409_100260538
857 Ga0307416_100001051
858 Ga0307416_100144537
859 Ga0307416_100308925
860 Ga0307414_10034656
861 Ga0307414_10165549
862 Ga0307411_10014921
863 Ga0307411_10026002
864 Ga0307415_100007655
865 Ga0307415_100068155
866 Ga0307415_100092021
867 Ga0395899_0000706
868 Ga0395899_0000881
869 Ga0395899_0005357
870 Ga0395899_0016076
871 Ga0395899_0050887
872 Ga0395899_0051876
873 Ga0395899_0089079
874 Ga0395899_0144713
875 Ga0395899_0227232
876 Ga0395899_0270509
877 Ga0395900_0000161
878 Ga0395900_0000447
879 Ga0395900_0000564
880 Ga0395900_0003293
881 Ga0395900_0006151
882 Ga0395900_0027740
883 Ga0395900_0040833
884 Ga0395900_0046758
885 Ga0395900_0064356
886 Ga0395900_0065638
887 Ga0395900_0462531
888 Ga0395898_0000937
889 Ga0395898_0000941
890 Ga0395898_0005900
891 Ga0395898_0113304
892 Ga0395898_0214807
893 Ga0395898_0252693
894 Ga0395898_0537531
895 Ga0395905_0000120
896 Ga0395905_0000926
897 Ga0395905_0001255
898 Ga0395905_0011304
899 Ga0395905_0012382
900 Ga0395905_0040997
901 Ga0395905_0098696
902 Ga0395905_0120366
903 Ga0395905_0120727
904 Ga0395905_0123232
905 Ga0395905_0165018
906 Ga0395905_0204656
907 Ga0395905_0333408
908 Ga0395905_0458146
909 Ga0395901_0000324
910 Ga0395901_0001094
911 Ga0395901_0001229
912 Ga0395901_0004800
913 Ga0395901_0040161
914 Ga0395901_0133741
915 Ga0395901_0194649
916 Ga0395901_0474900
917 Ga0436365_0788426
918 Ga0439432_012008
919 Ga0450912_000227
920 Ga0466969_0084353
921 Ga0466972_0039194
922 Ga0466965_0014312
923 Ga0466966_0002814
924 Ga0466966_0073982
925 Ga0466961_0001787
926 Ga0466961_0095736
927 Ga0466961_0114041
928 Ga0466963_0042663
929 Ga0466968_0045396
930 Ga0466970_0046503
931 Ga0466960_0013669
932 Ga0466959_0012973
933 Ga0466959_0087936
934 Ga0466958_0078849
935 Ga0466967_0027661
936 Ga0466967_0047831
937 Ga0466967_0066016
938 Ga0495580_0191157
939 Ga0495663_0006139
940 Ga0495621_0000207
941 Ga0495668_0007381
942 Ga0495623_0031826
943 Ga0495669_0002246
944 Ga0495669_0004237
945 Ga0495669_0004574
946 Ga0495669_0080860
947 Ga0495670_0000467
948 Ga0496100_0003792
949 Ga0496101_0001530
950 Ga0496101_0030275
951 Ga0496101_0051886
952 Ga0496103_0048841
953 Ga0496106_0050826
954 Ga0496106_0063495
955 Ga0496107_0002535
956 Ga0496107_0011089
957 Ga0496107_0112610
958 Ga0496108_0004255
959 Ga0496108_0506202
960 Ga0496109_0081821
961 Ga0496109_0088738
962 Ga0496109_0266292
963 Ga0496110_0000847
964 Ga0496110_0012913
965 Ga0496111_0003138
966 Ga0496111_0034650
967 Ga0496111_0070902
968 Ga0496111_0124037
969 Ga0496112_0005760
970 Ga0496112_0005909
971 Ga0496112_0108778
972 Ga0496112_0140430
973 Ga0496112_0272076
974 Ga0496112_0513679
975 Ga0496113_0020778
976 Ga0496113_0025623
977 Ga0496114_0000109
978 Ga0496115_0011486
979 Ga0501067_0032165
980 Ga0501074_0065000
981 Ga0501233_002993
982 Ga0501234_015610
983 Ga0501080_0056533
984 Ga0501268_011570
985 nmdc:mga09592_366217_c1
986 Ga0500658_0000173

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01408

GFO_IDH_MocA

Oxidoreductase family, NAD-binding Rossmann fold

4

116

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cgr-assembly1.cif.gz_B crystal structure of azospirillum brasilense l-arabinose 1-dehydrogenase e147a mutant (nadp and glycerol bound form) 0.9426 4 295
7cgq-assembly1.cif.gz_B crystal structure of azospirillum brasilense l-arabinose 1-dehydrogenase e147a mutant (nadp and l-arabinose bound form) 0.9411 4 295
7cgr-assembly1.cif.gz_B crystal structure of azospirillum brasilense l-arabinose 1-dehydrogenase e147a mutant (nadp and glycerol bound form) 0.9241 4 295
7cgq-assembly2.cif.gz_D crystal structure of azospirillum brasilense l-arabinose 1-dehydrogenase e147a mutant (nadp and l-arabinose bound form) 0.9229 4 296
7cgq-assembly1.cif.gz_B crystal structure of azospirillum brasilense l-arabinose 1-dehydrogenase e147a mutant (nadp and l-arabinose bound form) 0.9227 4 295
ID Description Score Start End Superfamily
6jnkA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9646 4 115 3.40.50.720
6jnkA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9401 4 115 3.40.50.720
3rbvA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9162 2 120 3.40.50.720
3fhlA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9119 1 115 3.40.50.720
af_P77376_2_121_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9118 1 115 3.90.1150.10
ID Description Score Start End GO Terms
AF-A0A435AKU1-F1-model_v4 deleted 0.9695 1 147
AF-A0A660MGQ2-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9528 2 115 GO:0000166
AF-A0A435AKU1-F1-model_v4 deleted 0.9506 1 147
AF-A0A3M2WWX8-F1-model_v4 D-galactose 1-dehydrogenase 0.9326 1 297 GO:0000166
AF-A0A7T7X795-F1-model_v4 deleted 0.9324 1 297

Map