F454433

General Info

Members Datasets Scaffolds Average Seq Length
493 193 986 147

Family's Representative Sequence

Representative Sequence 3300022467|Ga0224712_10041484|Ga0224712_100414842
Length 176
Sequence MSPSATPEDSAESRTVYSSKLSSTPNLTAVAQPYDGDAHAIRLTIPAKPEYITLGRLALTGLARLRAEPLSQEVLGDLKLALTEACTNSVRHAYANGEGQVEIVYVLHPDRLVVEVADEGEGFVPPADVSTPPSEDDLSEGGLGIAIIQALSDEFEIGERPQGGSRLRFVKLLPAA

Samples

Sample ID Description Type Environment
1 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
31 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
51 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
52 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
56 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
62 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
63 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
94 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
95 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
96 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
97 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
98 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
99 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
100 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
101 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
102 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
103 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
104 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
105 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
106 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
107 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
108 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
109 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
110 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
111 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
112 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
113 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
114 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
115 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
116 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
117 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
118 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
119 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
120 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
121 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
122 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
123 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
124 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
125 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
126 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
127 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
128 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
129 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
130 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
131 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
132 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
133 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
134 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
135 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
136 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
137 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
138 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
139 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
140 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
141 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
142 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
143 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
144 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
145 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
146 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
147 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
148 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
149 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
150 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
151 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
152 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
153 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
154 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
155 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
156 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
157 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
158 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
159 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
160 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
161 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
162 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
163 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
164 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
165 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
166 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
167 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
168 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
169 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
170 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
171 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
172 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
173 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
174 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
175 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
176 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
179 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
180 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
181 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
182 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
183 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
184 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
185 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
186 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
187 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
188 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300059606 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 159R_AD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
192 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
193 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.25
Metatranscriptomes 10.75
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.94
Rhizosphere 88.64
Stem 0
Stem Tuber 0
Unclassified 13.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0224712_10041484 3300022467 Bacteria 1738
2 Ga0070658_10014521 3300005327 Bacteria 6321
3 Ga0070658_10106225 3300005327 Bacteria 2323
4 Ga0070683_100050227 3300005329 Bacteria 3859
5 Ga0070683_100110331 3300005329 Bacteria 2595
6 Ga0070683_100223627 3300005329 Bacteria 1789
7 Ga0070683_100562056 3300005329 Unclassified 1091
8 Ga0070680_100001631 3300005336 Bacteria 16396
9 Ga0070680_100042657 3300005336 Bacteria 3682
10 Ga0070680_100078452 3300005336 Bacteria 2721
11 Ga0070680_100104677 3300005336 Unclassified 2352
12 Ga0070680_100148758 3300005336 Bacteria 1966
13 Ga0070680_101056228 3300005336 Bacteria 702
14 Ga0070682_100075743 3300005337 Bacteria 2165
15 Ga0070682_100357771 3300005337 Bacteria 1090
16 Ga0070682_100519650 3300005337 Bacteria 926
17 Ga0070660_100001098 3300005339 Bacteria 18183
18 Ga0070660_100001243 3300005339 Bacteria 17314
19 Ga0070660_100053414 3300005339 Bacteria 3117
20 Ga0070660_100054825 3300005339 Bacteria 3079
21 Ga0070660_100056635 3300005339 Bacteria 3033
22 Ga0070660_100079020 3300005339 Bacteria 2580
23 Ga0070660_100475709 3300005339 Bacteria 1038
24 Ga0070660_100730580 3300005339 Bacteria 831
25 Ga0070660_101585868 3300005339 Bacteria 557
26 Ga0070691_10171710 3300005341 Unclassified 1124
27 Ga0070691_10902157 3300005341 Unclassified 545
28 Ga0070661_100020928 3300005344 Bacteria 4668
29 Ga0070661_100021598 3300005344 Bacteria 4599
30 Ga0070661_100156595 3300005344 Bacteria 1724
31 Ga0070661_100278256 3300005344 Unclassified 1298
32 Ga0070674_101437990 3300005356 Bacteria 618
33 Ga0070659_100010714 3300005366 Bacteria 6756
34 Ga0070659_100144316 3300005366 Bacteria 1939
35 Ga0070659_100477264 3300005366 Unclassified 1061
36 Ga0070659_100962575 3300005366 Bacteria 748
37 Ga0070714_100070408 3300005435 Bacteria 3023
38 Ga0070714_100120334 3300005435 Bacteria 2335
39 Ga0070714_100844148 3300005435 Unclassified 888
40 Ga0070714_100888655 3300005435 Bacteria 865
41 Ga0070714_101796235 3300005435 Bacteria 599
42 Ga0070713_100439188 3300005436 Bacteria 1224
43 Ga0070713_100640636 3300005436 Bacteria 1012
44 Ga0070713_100968241 3300005436 Bacteria 820
45 Ga0070713_101129483 3300005436 Bacteria 758
46 Ga0070713_101216926 3300005436 Bacteria 729
47 Ga0070710_10415180 3300005437 Bacteria 905
48 Ga0070711_100052877 3300005439 Bacteria 2797
49 Ga0070708_101248109 3300005445 Bacteria 695
50 Ga0070663_100193915 3300005455 Bacteria 1582
51 Ga0070663_100263837 3300005455 Bacteria 1367
52 Ga0070678_100039625 3300005456 Bacteria 3326
53 Ga0070681_10002995 3300005458 Bacteria 15675
54 Ga0070681_10013548 3300005458 Bacteria 8109
55 Ga0070681_10022399 3300005458 Bacteria 6344
56 Ga0070681_10028537 3300005458 Bacteria 5611
57 Ga0070681_10043845 3300005458 Bacteria 4478
58 Ga0070681_10134531 3300005458 Bacteria 2403
59 Ga0070681_10183035 3300005458 Bacteria 2016
60 Ga0070681_10900989 3300005458 Bacteria 803
61 Ga0070707_100614979 3300005468 Bacteria 1049
62 Ga0070679_100016979 3300005530 Bacteria 7036
63 Ga0070679_100027826 3300005530 Bacteria 5569
64 Ga0070679_100032549 3300005530 Bacteria 5158
65 Ga0070679_100100353 3300005530 Bacteria 2881
66 Ga0070679_100170359 3300005530 Bacteria 2150
67 Ga0070679_101639267 3300005530 Bacteria 591
68 Ga0070684_100017683 3300005535 Bacteria 5860
69 Ga0070684_100235618 3300005535 Bacteria 1672
70 Ga0070684_100364252 3300005535 Bacteria 1330
71 Ga0070684_100387433 3300005535 Unclassified 1288
72 Ga0070684_100852972 3300005535 Unclassified 853
73 Ga0068853_100087832 3300005539 Bacteria 2728
74 Ga0068853_100272808 3300005539 Bacteria 1558
75 Ga0068853_100304496 3300005539 Bacteria 1474
76 Ga0068853_100593169 3300005539 Unclassified 1052
77 Ga0070696_100527567 3300005546 Unclassified 943
78 Ga0070693_100351451 3300005547 Bacteria 1009
79 Ga0070665_100044395 3300005548 Bacteria 4463
80 Ga0068855_100022923 3300005563 Bacteria 7483
81 Ga0068855_100036011 3300005563 Bacteria 5892
82 Ga0068855_100038449 3300005563 Bacteria 5686
83 Ga0068855_100039347 3300005563 Bacteria 5613
84 Ga0068855_100094317 3300005563 Bacteria 3451
85 Ga0068855_100175960 3300005563 Bacteria 2421
86 Ga0068855_100583796 3300005563 Bacteria 1207
87 Ga0068855_100643661 3300005563 Bacteria 1139
88 Ga0068857_100067061 3300005577 Bacteria 3194
89 Ga0068857_100360147 3300005577 Bacteria 1348
90 Ga0068856_100092280 3300005614 Bacteria 3013
91 Ga0068856_100354122 3300005614 Bacteria 1487
92 Ga0068856_100398083 3300005614 Archaea 1397
93 Ga0068856_100604105 3300005614 Bacteria 1118
94 Ga0068852_100065345 3300005616 Bacteria 3174
95 Ga0068852_100128467 3300005616 Bacteria 2331
96 Ga0068852_101224372 3300005616 Bacteria 772
97 Ga0068866_10406761 3300005718 Bacteria 879
98 Ga0068851_10224706 3300005834 Bacteria 1056
99 Ga0070717_10034227 3300006028 Bacteria 4106
100 Ga0070717_10456585 3300006028 Bacteria 1152
101 Ga0070717_10855126 3300006028 Unclassified 828
102 Ga0070716_100468810 3300006173 Bacteria 922
103 Ga0070712_100172764 3300006175 Bacteria 1678
104 Ga0097621_100561052 3300006237 Bacteria 1040
105 Ga0097621_101463005 3300006237 Bacteria 648
106 Ga0068871_100771816 3300006358 Bacteria 885
107 Ga0105240_10052559 3300009093 Bacteria 5120
108 Ga0105240_10054645 3300009093 Bacteria 5004
109 Ga0105240_10154898 3300009093 Bacteria 2726
110 Ga0105240_10479332 3300009093 Unclassified 1387
111 Ga0105240_10706499 3300009093 Bacteria 1100
112 Ga0105240_10719269 3300009093 Unclassified 1088
113 Ga0105245_10378693 3300009098 Bacteria 1409
114 Ga0105241_11775755 3300009174 Unclassified 601
115 Ga0105241_11914763 3300009174 Unclassified 581
116 Ga0105242_10425992 3300009176 Unclassified 1245
117 Ga0105237_10155978 3300009545 Bacteria 2280
118 Ga0105237_10173339 3300009545 Bacteria 2157
119 Ga0105237_10562028 3300009545 Bacteria 1148
120 Ga0105238_10074088 3300009551 Bacteria 3398
121 Ga0105238_10939131 3300009551 Unclassified 884
122 Ga0105239_10404341 3300010375 Bacteria 1545
123 Ga0105239_11237148 3300010375 Bacteria 861
124 Ga0157373_10071934 3300013100 Bacteria 2442
125 Ga0157373_10548899 3300013100 Bacteria 838
126 Ga0157370_10085190 3300013104 Bacteria 2969
127 Ga0157370_10293780 3300013104 Unclassified 1501
128 Ga0157370_10308690 3300013104 Bacteria 1460
129 Ga0157370_10858904 3300013104 Bacteria 824
130 Ga0157370_11157396 3300013104 Unclassified 698
131 Ga0157369_10025871 3300013105 Bacteria 6510
132 Ga0157369_10028307 3300013105 Bacteria 6203
133 Ga0157369_10245990 3300013105 Bacteria 1867
134 Ga0157374_10053130 3300013296 Bacteria 3776
135 Ga0157374_10421349 3300013296 Bacteria 1334
136 Ga0157374_10837782 3300013296 Bacteria 936
137 Ga0157374_11046969 3300013296 Bacteria 836
138 Ga0157372_10028720 3300013307 Bacteria 6072
139 Ga0157372_10048564 3300013307 Bacteria 4718
140 Ga0157372_10232684 3300013307 Bacteria 2136
141 Ga0157372_10884514 3300013307 Bacteria 1037
142 Ga0157372_11558608 3300013307 Bacteria 761
143 Ga0157375_10054951 3300013308 Bacteria 3924
144 Ga0182008_10237052 3300014497 Bacteria 938
145 Ga0182008_10314261 3300014497 Unclassified 823
146 Ga0157376_10171930 3300014969 Bacteria 1974
147 Ga0197907_10046359 3300020069 Bacteria 1759
148 Ga0197907_10252711 3300020069 Bacteria 851
149 Ga0197907_10360639 3300020069 Bacteria 2164
150 Ga0197907_10506232 3300020069 Bacteria 795
151 Ga0197907_11051262 3300020069 Bacteria 554
152 Ga0197907_11368674 3300020069 Bacteria 1558
153 Ga0197907_11434900 3300020069 Bacteria 4175
154 Ga0197907_11501728 3300020069 Bacteria 2554
155 Ga0206356_10163057 3300020070 Bacteria 1863
156 Ga0206356_10195885 3300020070 Bacteria 2571
157 Ga0206356_10348599 3300020070 Bacteria 832
158 Ga0206356_10678294 3300020070 Bacteria 2910
159 Ga0206356_11043998 3300020070 Bacteria 2364
160 Ga0206356_11720777 3300020070 Bacteria 1488
161 Ga0206349_1141911 3300020075 Bacteria 938
162 Ga0206349_1487305 3300020075 Bacteria 680
163 Ga0206349_1615013 3300020075 Unclassified 536
164 Ga0206349_1936673 3300020075 Bacteria 1372
165 Ga0206355_1052958 3300020076 Bacteria 717
166 Ga0206355_1149417 3300020076 Bacteria 579
167 Ga0206355_1222355 3300020076 Bacteria 530
168 Ga0206351_10165972 3300020077 Unclassified 1050
169 Ga0206351_10397212 3300020077 Bacteria 525
170 Ga0206352_10976342 3300020078 Bacteria 667
171 Ga0206352_11031653 3300020078 Bacteria 866
172 Ga0206352_11312247 3300020078 Unclassified 871
173 Ga0206350_10153128 3300020080 Bacteria 799
174 Ga0206350_11446006 3300020080 Bacteria 574
175 Ga0206354_10463961 3300020081 Unclassified 1606
176 Ga0206354_10557244 3300020081 Bacteria 1430
177 Ga0206354_11170890 3300020081 Bacteria 5662
178 Ga0206354_11273219 3300020081 Bacteria 2927
179 Ga0206353_10031605 3300020082 Bacteria 5104
180 Ga0206353_11167451 3300020082 Bacteria 2076
181 Ga0206353_11291783 3300020082 Bacteria 5090
182 Ga0206353_11755696 3300020082 Bacteria 4689
183 Ga0206353_11836612 3300020082 Bacteria 4550
184 Ga0206353_11844727 3300020082 Bacteria 9660
185 Ga0154015_1001549 3300020610 Bacteria 711
186 Ga0154015_1075419 3300020610 Bacteria 694
187 Ga0213876_10212486 3300021384 Unclassified 1028
188 Ga0224712_10006496 3300022467 Bacteria 3339
189 Ga0224712_10014224 3300022467 Bacteria 2555
190 Ga0224712_10024377 3300022467 Bacteria 2112
191 Ga0224712_10056301 3300022467 Unclassified 1550
192 Ga0224712_10065018 3300022467 Unclassified 1464
193 Ga0224712_10206604 3300022467 Bacteria 894
194 Ga0224712_10438346 3300022467 Bacteria 626
195 Ga0224712_10565137 3300022467 Bacteria 553
196 Ga0207692_10261092 3300025898 Bacteria 1041
197 Ga0207692_10414140 3300025898 Bacteria 843
198 Ga0207705_10084577 3300025909 Bacteria 2316
199 Ga0207705_10093016 3300025909 Bacteria 2210
200 Ga0207705_10135970 3300025909 Bacteria 1832
201 Ga0207705_10741899 3300025909 Bacteria 763
202 Ga0207654_10415161 3300025911 Unclassified 938
203 Ga0207707_10020888 3300025912 Bacteria 5719
204 Ga0207707_10095247 3300025912 Bacteria 2602
205 Ga0207707_10114233 3300025912 Bacteria 2360
206 Ga0207707_10170780 3300025912 Bacteria 1900
207 Ga0207707_10182404 3300025912 Unclassified 1832
208 Ga0207707_10292124 3300025912 Bacteria 1410
209 Ga0207707_10312728 3300025912 Bacteria 1357
210 Ga0207695_10158570 3300025913 Unclassified 2196
211 Ga0207695_10213377 3300025913 Unclassified 1840
212 Ga0207695_11003678 3300025913 Bacteria 714
213 Ga0207695_11058200 3300025913 Bacteria 691
214 Ga0207671_10025618 3300025914 Bacteria 4429
215 Ga0207671_10279924 3300025914 Bacteria 1315
216 Ga0207693_10172495 3300025915 Bacteria 1703
217 Ga0207663_10510699 3300025916 Unclassified 935
218 Ga0207660_10019680 3300025917 Bacteria 4517
219 Ga0207660_10029301 3300025917 Bacteria 3774
220 Ga0207660_10141514 3300025917 Unclassified 1839
221 Ga0207660_10364387 3300025917 Bacteria 1160
222 Ga0207660_10389249 3300025917 Bacteria 1121
223 Ga0207657_10000166 3300025919 Bacteria 67098
224 Ga0207657_10001365 3300025919 Bacteria 26019
225 Ga0207657_10006228 3300025919 Bacteria 12402
226 Ga0207657_10034259 3300025919 Bacteria 4569
227 Ga0207657_10055185 3300025919 Bacteria 3433
228 Ga0207657_10274710 3300025919 Unclassified 1339
229 Ga0207657_10617727 3300025919 Unclassified 845
230 Ga0207657_10773481 3300025919 Bacteria 743
231 Ga0207649_10016718 3300025920 Bacteria 4146
232 Ga0207652_10073426 3300025921 Bacteria 2976
233 Ga0207652_10083311 3300025921 Bacteria 2800
234 Ga0207652_10207202 3300025921 Bacteria 1765
235 Ga0207652_10265571 3300025921 Bacteria 1548
236 Ga0207652_10460573 3300025921 Unclassified 1146
237 Ga0207652_10572140 3300025921 Bacteria 1014
238 Ga0207646_10253871 3300025922 Bacteria 1589
239 Ga0207646_10313397 3300025922 Bacteria 1418
240 Ga0207694_10052440 3300025924 Bacteria 3161
241 Ga0207694_11283263 3300025924 Bacteria 619
242 Ga0207700_10110252 3300025928 Bacteria 2213
243 Ga0207700_10454129 3300025928 Bacteria 1130
244 Ga0207700_10711139 3300025928 Bacteria 897
245 Ga0207700_11313952 3300025928 Bacteria 644
246 Ga0207664_10143050 3300025929 Bacteria 2025
247 Ga0207664_10701720 3300025929 Unclassified 910
248 Ga0207664_10726213 3300025929 Bacteria 893
249 Ga0207664_10936779 3300025929 Bacteria 777
250 Ga0207644_10234905 3300025931 Bacteria 1458
251 Ga0207690_10196699 3300025932 Bacteria 1528
252 Ga0207690_10586857 3300025932 Bacteria 909
253 Ga0207669_10147318 3300025937 Bacteria 1644
254 Ga0207665_10484446 3300025939 Bacteria 953
255 Ga0207661_10018977 3300025944 Bacteria 5117
256 Ga0207661_10030129 3300025944 Bacteria 4176
257 Ga0207661_10033602 3300025944 Bacteria 3983
258 Ga0207661_10632070 3300025944 Unclassified 983
259 Ga0207679_11021220 3300025945 Bacteria 758
260 Ga0207667_10037766 3300025949 Bacteria 5162
261 Ga0207667_10107863 3300025949 Bacteria 2873
262 Ga0207667_10119150 3300025949 Bacteria 2720
263 Ga0207667_10193550 3300025949 Bacteria 2086
264 Ga0207667_10213459 3300025949 Unclassified 1978
265 Ga0207667_10345238 3300025949 Bacteria 1518
266 Ga0207667_11239649 3300025949 Unclassified 724
267 Ga0207640_10114678 3300025981 Bacteria 1918
268 Ga0207639_10078103 3300026041 Bacteria 2612
269 Ga0207639_10547202 3300026041 Unclassified 1062
270 Ga0207639_10613076 3300026041 Unclassified 1004
271 Ga0207678_10064855 3300026067 Bacteria 3138
272 Ga0207678_10890936 3300026067 Bacteria 787
273 Ga0207702_10101937 3300026078 Bacteria 2536
274 Ga0207702_10114369 3300026078 Bacteria 2405
275 Ga0207702_10260377 3300026078 Bacteria 1633
276 Ga0207702_11135838 3300026078 Bacteria 775
277 Ga0207702_11388872 3300026078 Unclassified 696
278 Ga0207702_12059212 3300026078 Bacteria 561
279 Ga0207674_10055658 3300026116 Bacteria 4021
280 Ga0207674_10117492 3300026116 Bacteria 2630
281 Ga0207674_10501997 3300026116 Bacteria 1172
282 Ga0207683_10034077 3300026121 Bacteria 4424
283 Ga0207683_11631389 3300026121 Bacteria 594
284 Ga0207698_10070544 3300026142 Bacteria 2769
285 Ga0207698_10478805 3300026142 Bacteria 1207
286 Ga0207698_10508333 3300026142 Unclassified 1174
287 Ga0207698_10855744 3300026142 Bacteria 914
288 Ga0265340_10185170 3300031247 Unclassified 940
289 Ga0265327_10330617 3300031251 Unclassified 667
290 Ga0373936_0002477 3300035113 Bacteria 6909
291 Ga0373945_0136265 3300035116 Unclassified 987
292 Ga0373953_0065044 3300035117 Bacteria 1497
293 Ga0373943_0003945 3300035170 Bacteria 6753
294 Ga0373935_0160538 3300035692 Bacteria 1532
295 Ga0373935_1409030 3300035692 Unclassified 521
296 Ga0373933_0031155 3300035724 Bacteria 3093
297 Ga0373947_0002943 3300035725 Bacteria 10164
298 Ga0373937_0112790 3300036401 Bacteria 2529
299 Ga0373925_0063101 3300037068 Bacteria 2787
300 Ga0395899_0025379 3300037312 Bacteria 4474
301 Ga0395900_0030403 3300037418 Bacteria 5546
302 Ga0395900_0041200 3300037418 Bacteria 4762
303 Ga0395900_0369188 3300037418 Bacteria 1405
304 Ga0395900_0395596 3300037418 Bacteria 1347
305 Ga0395900_1147587 3300037418 Bacteria 693
306 Ga0395900_1486006 3300037418 Bacteria 590
307 Ga0395900_1559964 3300037418 Bacteria 572
308 Ga0395898_0009765 3300037466 Bacteria 10057
309 Ga0395898_0019851 3300037466 Bacteria 6835
310 Ga0395898_0020251 3300037466 Bacteria 6758
311 Ga0395898_0183130 3300037466 Unclassified 2002
312 Ga0395898_0396408 3300037466 Bacteria 1316
313 Ga0395905_0010913 3300037471 Bacteria 8795
314 Ga0395905_0069700 3300037471 Bacteria 3294
315 Ga0395905_0160505 3300037471 Bacteria 2113
316 Ga0395905_1258975 3300037471 Bacteria 643
317 Ga0436364_0735803 3300037853 Unclassified 1069
318 Ga0395901_0011097 3300038443 Bacteria 9132
319 Ga0395901_0021946 3300038443 Bacteria 6544
320 Ga0395901_0079544 3300038443 Bacteria 3423
321 Ga0395901_0955455 3300038443 Unclassified 835
322 Ga0395901_1320824 3300038443 Bacteria 682
323 Ga0436365_1191801 3300039437 Bacteria 2556
324 Ga0436365_1670563 3300039437 Bacteria 2254
325 Ga0436363_0484105 3300039450 Bacteria 1292
326 Ga0436363_1514877 3300039450 Bacteria 1608
327 Ga0436362_0172784 3300039453 Unclassified 736
328 Ga0451793_0864106 3300041452 Bacteria 798
329 Ga0451853_2979652 3300041512 Bacteria 902
330 Ga0439448_0045338 3300042005 Bacteria 1431
331 Ga0439448_0100230 3300042005 Bacteria 984
332 Ga0466969_0105623 3300044656 Bacteria 1322
333 Ga0466965_0099349 3300044683 Bacteria 1487
334 Ga0466966_0004360 3300044684 Bacteria 9334
335 Ga0466966_0105969 3300044684 Bacteria 1735
336 Ga0466966_0181892 3300044684 Unclassified 1275
337 Ga0466961_0014467 3300044693 Bacteria 5067
338 Ga0466961_0116838 3300044693 Bacteria 1676
339 Ga0466961_0248172 3300044693 Unclassified 1093
340 Ga0466963_0008226 3300044694 Bacteria 6251
341 Ga0466963_0011089 3300044694 Bacteria 5480
342 Ga0466963_0058311 3300044694 Bacteria 2574
343 Ga0466963_0065488 3300044694 Bacteria 2436
344 Ga0466963_0171891 3300044694 Bacteria 1511
345 Ga0466963_0752678 3300044694 Archaea 687
346 Ga0466963_1208712 3300044694 Bacteria 531
347 Ga0466964_0114993 3300044706 Unclassified 1205
348 Ga0466964_0136035 3300044706 Bacteria 1124
349 Ga0466971_0000400 3300044719 Bacteria 16793
350 Ga0466971_0102120 3300044719 Bacteria 1318
351 Ga0466971_0407768 3300044719 Unclassified 663
352 Ga0466968_0009808 3300044735 Bacteria 3696
353 Ga0466968_0076418 3300044735 Bacteria 1466
354 Ga0466968_0200820 3300044735 Unclassified 934
355 Ga0466970_0010412 3300044765 Bacteria 4723
356 Ga0466970_0201980 3300044765 Unclassified 1106
357 Ga0466957_0001851 3300044842 Bacteria 11164
358 Ga0466957_0967287 3300044842 Bacteria 610
359 Ga0466960_0079901 3300044901 Bacteria 1646
360 Ga0466959_0019048 3300045049 Bacteria 5045
361 Ga0466959_0026114 3300045049 Bacteria 4331
362 Ga0466959_0058549 3300045049 Bacteria 2806
363 Ga0466959_0266626 3300045049 Bacteria 1178
364 Ga0466958_0002579 3300045836 Bacteria 9148
365 Ga0466958_0009855 3300045836 Bacteria 5333
366 Ga0466958_0061395 3300045836 Bacteria 2290
367 Ga0466958_0122846 3300045836 Bacteria 1626
368 Ga0466958_0225180 3300045836 Unclassified 1197
369 Ga0466958_0258814 3300045836 Unclassified 1114
370 Ga0466958_0613538 3300045836 Archaea 708
371 Ga0466967_0002836 3300045976 Bacteria 10995
372 Ga0466967_0027071 3300045976 Bacteria 4763
373 Ga0466967_0044616 3300045976 Bacteria 3847
374 Ga0466967_0047618 3300045976 Bacteria 3738
375 Ga0466967_0061601 3300045976 Bacteria 3329
376 Ga0466967_0095336 3300045976 Bacteria 2711
377 Ga0466967_0117133 3300045976 Bacteria 2455
378 Ga0466967_0215244 3300045976 Bacteria 1823
379 Ga0466967_0241373 3300045976 Bacteria 1724
380 Ga0466967_0261687 3300045976 Bacteria 1655
381 Ga0466967_0437767 3300045976 Bacteria 1276
382 Ga0466967_0540044 3300045976 Unclassified 1147
383 Ga0466967_0540837 3300045976 Unclassified 1146
384 Ga0466967_0759981 3300045976 Bacteria 961
385 Ga0495592_0130609 3300046454 Bacteria 1757
386 Ga0495629_0153913 3300046459 Unclassified 1598
387 Ga0495641_0021584 3300046461 Bacteria 3238
388 Ga0495651_0036412 3300046462 Bacteria 3831
389 Ga0495582_0075412 3300046473 Bacteria 1868
390 Ga0495605_0050982 3300046474 Bacteria 2017
391 Ga0495608_0025266 3300046511 Bacteria 4054
392 Ga0495618_0032217 3300046514 Bacteria 3283
393 Ga0495628_0071133 3300046516 Bacteria 2712
394 Ga0495630_0221603 3300046517 Bacteria 1444
395 Ga0495630_0296663 3300046517 Bacteria 1235
396 Ga0495665_0104792 3300046531 Bacteria 1484
397 Ga0495640_0038491 3300046533 Bacteria 3364
398 Ga0495587_0013763 3300046536 Bacteria 5083
399 Ga0495645_0256794 3300046543 Bacteria 1159
400 Ga0495667_0083266 3300046559 Bacteria 2077
401 Ga0495634_0538538 3300046642 Bacteria 682
402 Ga0495588_0453234 3300046674 Bacteria 673
403 Ga0495657_0005166 3300046675 Bacteria 10339
404 Ga0495657_0267238 3300046675 Bacteria 1026
405 Ga0495623_0062025 3300046679 Bacteria 2343
406 Ga0495646_0042059 3300046680 Bacteria 2806
407 Ga0495658_0002872 3300046683 Bacteria 8655
408 Ga0495613_0466849 3300046689 Bacteria 853
409 Ga0495600_0034930 3300046809 Bacteria 3264
410 Ga0495604_0040449 3300047317 Bacteria 3660
411 Ga0495674_0352996 3300047319 Bacteria 1193
412 Ga0495676_0081664 3300047321 Bacteria 2449
413 Ga0495680_0389899 3300047322 Bacteria 963
414 Ga0495675_0002014 3300047444 Bacteria 12134
415 Ga0495684_0133989 3300047471 Bacteria 1859
416 Ga0495602_0012238 3300048088 Bacteria 8833
417 Ga0495602_0082262 3300048088 Bacteria 2703
418 Ga0495602_0505799 3300048088 Bacteria 844
419 Ga0496100_0017723 3300048903 Bacteria 4210
420 Ga0496100_0052105 3300048903 Bacteria 2659
421 Ga0496100_0054159 3300048903 Bacteria 2615
422 Ga0496101_0001024 3300048904 Bacteria 16471
423 Ga0496101_0016019 3300048904 Bacteria 5059
424 Ga0496101_0059031 3300048904 Bacteria 2780
425 Ga0496101_0062560 3300048904 Bacteria 2706
426 Ga0496102_0022488 3300048905 Bacteria 5587
427 Ga0496102_0066860 3300048905 Bacteria 3295
428 Ga0496102_0203392 3300048905 Bacteria 1866
429 Ga0496103_0131563 3300048906 Bacteria 1598
430 Ga0496103_0578931 3300048906 Bacteria 716
431 Ga0496103_0675600 3300048906 Bacteria 655
432 Ga0496104_0002338 3300048907 Bacteria 16381
433 Ga0496104_0010957 3300048907 Bacteria 8112
434 Ga0496104_0170999 3300048907 Bacteria 2084
435 Ga0496105_0002856 3300048908 Bacteria 12644
436 Ga0496105_0007386 3300048908 Bacteria 8508
437 Ga0496105_0795651 3300048908 Bacteria 719
438 Ga0496106_0012437 3300048909 Bacteria 6285
439 Ga0496106_0016640 3300048909 Bacteria 5440
440 Ga0496106_0162686 3300048909 Bacteria 1765
441 Ga0496107_0000832 3300048910 Bacteria 18003
442 Ga0496107_0002291 3300048910 Bacteria 12358
443 Ga0496107_0087509 3300048910 Bacteria 2274
444 Ga0496108_0129652 3300048911 Bacteria 2168
445 Ga0496108_1144667 3300048911 Bacteria 660
446 Ga0496109_0005292 3300048912 Bacteria 10782
447 Ga0496109_0227066 3300048912 Bacteria 1756
448 Ga0496109_0550407 3300048912 Bacteria 1088
449 Ga0496110_0020449 3300048913 Bacteria 5590
450 Ga0496110_0036285 3300048913 Bacteria 4280
451 Ga0496111_0066233 3300048914 Bacteria 2623
452 Ga0496111_0433718 3300048914 Bacteria 970
453 Ga0496112_0000635 3300048915 Bacteria 24368
454 Ga0496112_0001889 3300048915 Bacteria 16523
455 Ga0496112_0036005 3300048915 Bacteria 4825
456 Ga0496112_0394664 3300048915 Bacteria 1324
457 Ga0496113_0074518 3300048916 Bacteria 2588
458 Ga0496113_0635779 3300048916 Bacteria 854
459 Ga0496114_0001209 3300048917 Bacteria 19531
460 Ga0496114_0011973 3300048917 Bacteria 6939
461 Ga0496114_0028605 3300048917 Bacteria 4575
462 Ga0496114_0634925 3300048917 Bacteria 940
463 Ga0496115_0000701 3300048918 Bacteria 24832
464 Ga0496115_0151596 3300048918 Bacteria 1915
465 Ga0496115_0339339 3300048918 Bacteria 1226
466 Ga0496115_1098013 3300048918 Bacteria 603
467 Ga0501034_0039223 3300049571 Bacteria 4798
468 Ga0501047_0009775 3300049581 Bacteria 9065
469 Ga0501047_0327662 3300049581 Bacteria 1370
470 Ga0501067_0005193 3300049583 Bacteria 7236
471 Ga0501068_0164276 3300049584 Unclassified 1400
472 Ga0501069_0013019 3300049585 Bacteria 4431
473 Ga0501069_0073229 3300049585 Bacteria 1921
474 Ga0501070_0000805 3300049586 Bacteria 28505
475 Ga0501070_0032238 3300049586 Bacteria 4386
476 Ga0501070_0039570 3300049586 Bacteria 3933
477 Ga0501074_0039598 3300049590 Bacteria 3413
478 Ga0501074_0583956 3300049590 Unclassified 790
479 Ga0501080_0204983 3300049742 Bacteria 1809
480 Ga0501080_0373013 3300049742 Bacteria 1286
481 Ga0501080_0780488 3300049742 Bacteria 839
482 Ga0501044_1345255 3300049823 Bacteria 580
483 Ga0495655_0010582 3300053083 Bacteria 1825
484 Ga0495595_0064370 3300053084 Bacteria 1723
485 Ga0495619_0440451 3300053085 Bacteria 898
486 Ga0587066_073237 3300059490 Bacteria 726
487 Ga0587121_11604 3300059606 Bacteria 561
488 Ga0587114_024061 3300059655 Bacteria 883
489 Ga0587114_031010 3300059655 Bacteria 818
490 Ga0501082_0663668 3300060353 Unclassified 913
491 Ga0466962_0005333 3300061719 Bacteria 6176
492 Ga0466962_0413919 3300061719 Bacteria 676
493 Ga0530510_0093116 3300061734 Bacteria 2200
494 Ga0224712_10041484
495 Ga0070658_10014521
496 Ga0070658_10106225
497 Ga0070683_100050227
498 Ga0070683_100110331
499 Ga0070683_100223627
500 Ga0070683_100562056
501 Ga0070680_100001631
502 Ga0070680_100042657
503 Ga0070680_100078452
504 Ga0070680_100104677
505 Ga0070680_100148758
506 Ga0070680_101056228
507 Ga0070682_100075743
508 Ga0070682_100357771
509 Ga0070682_100519650
510 Ga0070660_100001098
511 Ga0070660_100001243
512 Ga0070660_100053414
513 Ga0070660_100054825
514 Ga0070660_100056635
515 Ga0070660_100079020
516 Ga0070660_100475709
517 Ga0070660_100730580
518 Ga0070660_101585868
519 Ga0070691_10171710
520 Ga0070691_10902157
521 Ga0070661_100020928
522 Ga0070661_100021598
523 Ga0070661_100156595
524 Ga0070661_100278256
525 Ga0070674_101437990
526 Ga0070659_100010714
527 Ga0070659_100144316
528 Ga0070659_100477264
529 Ga0070659_100962575
530 Ga0070714_100070408
531 Ga0070714_100120334
532 Ga0070714_100844148
533 Ga0070714_100888655
534 Ga0070714_101796235
535 Ga0070713_100439188
536 Ga0070713_100640636
537 Ga0070713_100968241
538 Ga0070713_101129483
539 Ga0070713_101216926
540 Ga0070710_10415180
541 Ga0070711_100052877
542 Ga0070708_101248109
543 Ga0070663_100193915
544 Ga0070663_100263837
545 Ga0070678_100039625
546 Ga0070681_10002995
547 Ga0070681_10013548
548 Ga0070681_10022399
549 Ga0070681_10028537
550 Ga0070681_10043845
551 Ga0070681_10134531
552 Ga0070681_10183035
553 Ga0070681_10900989
554 Ga0070707_100614979
555 Ga0070679_100016979
556 Ga0070679_100027826
557 Ga0070679_100032549
558 Ga0070679_100100353
559 Ga0070679_100170359
560 Ga0070679_101639267
561 Ga0070684_100017683
562 Ga0070684_100235618
563 Ga0070684_100364252
564 Ga0070684_100387433
565 Ga0070684_100852972
566 Ga0068853_100087832
567 Ga0068853_100272808
568 Ga0068853_100304496
569 Ga0068853_100593169
570 Ga0070696_100527567
571 Ga0070693_100351451
572 Ga0070665_100044395
573 Ga0068855_100022923
574 Ga0068855_100036011
575 Ga0068855_100038449
576 Ga0068855_100039347
577 Ga0068855_100094317
578 Ga0068855_100175960
579 Ga0068855_100583796
580 Ga0068855_100643661
581 Ga0068857_100067061
582 Ga0068857_100360147
583 Ga0068856_100092280
584 Ga0068856_100354122
585 Ga0068856_100398083
586 Ga0068856_100604105
587 Ga0068852_100065345
588 Ga0068852_100128467
589 Ga0068852_101224372
590 Ga0068866_10406761
591 Ga0068851_10224706
592 Ga0070717_10034227
593 Ga0070717_10456585
594 Ga0070717_10855126
595 Ga0070716_100468810
596 Ga0070712_100172764
597 Ga0097621_100561052
598 Ga0097621_101463005
599 Ga0068871_100771816
600 Ga0105240_10052559
601 Ga0105240_10054645
602 Ga0105240_10154898
603 Ga0105240_10479332
604 Ga0105240_10706499
605 Ga0105240_10719269
606 Ga0105245_10378693
607 Ga0105241_11775755
608 Ga0105241_11914763
609 Ga0105242_10425992
610 Ga0105237_10155978
611 Ga0105237_10173339
612 Ga0105237_10562028
613 Ga0105238_10074088
614 Ga0105238_10939131
615 Ga0105239_10404341
616 Ga0105239_11237148
617 Ga0157373_10071934
618 Ga0157373_10548899
619 Ga0157370_10085190
620 Ga0157370_10293780
621 Ga0157370_10308690
622 Ga0157370_10858904
623 Ga0157370_11157396
624 Ga0157369_10025871
625 Ga0157369_10028307
626 Ga0157369_10245990
627 Ga0157374_10053130
628 Ga0157374_10421349
629 Ga0157374_10837782
630 Ga0157374_11046969
631 Ga0157372_10028720
632 Ga0157372_10048564
633 Ga0157372_10232684
634 Ga0157372_10884514
635 Ga0157372_11558608
636 Ga0157375_10054951
637 Ga0182008_10237052
638 Ga0182008_10314261
639 Ga0157376_10171930
640 Ga0197907_10046359
641 Ga0197907_10252711
642 Ga0197907_10360639
643 Ga0197907_10506232
644 Ga0197907_11051262
645 Ga0197907_11368674
646 Ga0197907_11434900
647 Ga0197907_11501728
648 Ga0206356_10163057
649 Ga0206356_10195885
650 Ga0206356_10348599
651 Ga0206356_10678294
652 Ga0206356_11043998
653 Ga0206356_11720777
654 Ga0206349_1141911
655 Ga0206349_1487305
656 Ga0206349_1615013
657 Ga0206349_1936673
658 Ga0206355_1052958
659 Ga0206355_1149417
660 Ga0206355_1222355
661 Ga0206351_10165972
662 Ga0206351_10397212
663 Ga0206352_10976342
664 Ga0206352_11031653
665 Ga0206352_11312247
666 Ga0206350_10153128
667 Ga0206350_11446006
668 Ga0206354_10463961
669 Ga0206354_10557244
670 Ga0206354_11170890
671 Ga0206354_11273219
672 Ga0206353_10031605
673 Ga0206353_11167451
674 Ga0206353_11291783
675 Ga0206353_11755696
676 Ga0206353_11836612
677 Ga0206353_11844727
678 Ga0154015_1001549
679 Ga0154015_1075419
680 Ga0213876_10212486
681 Ga0224712_10006496
682 Ga0224712_10014224
683 Ga0224712_10024377
684 Ga0224712_10056301
685 Ga0224712_10065018
686 Ga0224712_10206604
687 Ga0224712_10438346
688 Ga0224712_10565137
689 Ga0207692_10261092
690 Ga0207692_10414140
691 Ga0207705_10084577
692 Ga0207705_10093016
693 Ga0207705_10135970
694 Ga0207705_10741899
695 Ga0207654_10415161
696 Ga0207707_10020888
697 Ga0207707_10095247
698 Ga0207707_10114233
699 Ga0207707_10170780
700 Ga0207707_10182404
701 Ga0207707_10292124
702 Ga0207707_10312728
703 Ga0207695_10158570
704 Ga0207695_10213377
705 Ga0207695_11003678
706 Ga0207695_11058200
707 Ga0207671_10025618
708 Ga0207671_10279924
709 Ga0207693_10172495
710 Ga0207663_10510699
711 Ga0207660_10019680
712 Ga0207660_10029301
713 Ga0207660_10141514
714 Ga0207660_10364387
715 Ga0207660_10389249
716 Ga0207657_10000166
717 Ga0207657_10001365
718 Ga0207657_10006228
719 Ga0207657_10034259
720 Ga0207657_10055185
721 Ga0207657_10274710
722 Ga0207657_10617727
723 Ga0207657_10773481
724 Ga0207649_10016718
725 Ga0207652_10073426
726 Ga0207652_10083311
727 Ga0207652_10207202
728 Ga0207652_10265571
729 Ga0207652_10460573
730 Ga0207652_10572140
731 Ga0207646_10253871
732 Ga0207646_10313397
733 Ga0207694_10052440
734 Ga0207694_11283263
735 Ga0207700_10110252
736 Ga0207700_10454129
737 Ga0207700_10711139
738 Ga0207700_11313952
739 Ga0207664_10143050
740 Ga0207664_10701720
741 Ga0207664_10726213
742 Ga0207664_10936779
743 Ga0207644_10234905
744 Ga0207690_10196699
745 Ga0207690_10586857
746 Ga0207669_10147318
747 Ga0207665_10484446
748 Ga0207661_10018977
749 Ga0207661_10030129
750 Ga0207661_10033602
751 Ga0207661_10632070
752 Ga0207679_11021220
753 Ga0207667_10037766
754 Ga0207667_10107863
755 Ga0207667_10119150
756 Ga0207667_10193550
757 Ga0207667_10213459
758 Ga0207667_10345238
759 Ga0207667_11239649
760 Ga0207640_10114678
761 Ga0207639_10078103
762 Ga0207639_10547202
763 Ga0207639_10613076
764 Ga0207678_10064855
765 Ga0207678_10890936
766 Ga0207702_10101937
767 Ga0207702_10114369
768 Ga0207702_10260377
769 Ga0207702_11135838
770 Ga0207702_11388872
771 Ga0207702_12059212
772 Ga0207674_10055658
773 Ga0207674_10117492
774 Ga0207674_10501997
775 Ga0207683_10034077
776 Ga0207683_11631389
777 Ga0207698_10070544
778 Ga0207698_10478805
779 Ga0207698_10508333
780 Ga0207698_10855744
781 Ga0265340_10185170
782 Ga0265327_10330617
783 Ga0373936_0002477
784 Ga0373945_0136265
785 Ga0373953_0065044
786 Ga0373943_0003945
787 Ga0373935_0160538
788 Ga0373935_1409030
789 Ga0373933_0031155
790 Ga0373947_0002943
791 Ga0373937_0112790
792 Ga0373925_0063101
793 Ga0395899_0025379
794 Ga0395900_0030403
795 Ga0395900_0041200
796 Ga0395900_0369188
797 Ga0395900_0395596
798 Ga0395900_1147587
799 Ga0395900_1486006
800 Ga0395900_1559964
801 Ga0395898_0009765
802 Ga0395898_0019851
803 Ga0395898_0020251
804 Ga0395898_0183130
805 Ga0395898_0396408
806 Ga0395905_0010913
807 Ga0395905_0069700
808 Ga0395905_0160505
809 Ga0395905_1258975
810 Ga0436364_0735803
811 Ga0395901_0011097
812 Ga0395901_0021946
813 Ga0395901_0079544
814 Ga0395901_0955455
815 Ga0395901_1320824
816 Ga0436365_1191801
817 Ga0436365_1670563
818 Ga0436363_0484105
819 Ga0436363_1514877
820 Ga0436362_0172784
821 Ga0451793_0864106
822 Ga0451853_2979652
823 Ga0439448_0045338
824 Ga0439448_0100230
825 Ga0466969_0105623
826 Ga0466965_0099349
827 Ga0466966_0004360
828 Ga0466966_0105969
829 Ga0466966_0181892
830 Ga0466961_0014467
831 Ga0466961_0116838
832 Ga0466961_0248172
833 Ga0466963_0008226
834 Ga0466963_0011089
835 Ga0466963_0058311
836 Ga0466963_0065488
837 Ga0466963_0171891
838 Ga0466963_0752678
839 Ga0466963_1208712
840 Ga0466964_0114993
841 Ga0466964_0136035
842 Ga0466971_0000400
843 Ga0466971_0102120
844 Ga0466971_0407768
845 Ga0466968_0009808
846 Ga0466968_0076418
847 Ga0466968_0200820
848 Ga0466970_0010412
849 Ga0466970_0201980
850 Ga0466957_0001851
851 Ga0466957_0967287
852 Ga0466960_0079901
853 Ga0466959_0019048
854 Ga0466959_0026114
855 Ga0466959_0058549
856 Ga0466959_0266626
857 Ga0466958_0002579
858 Ga0466958_0009855
859 Ga0466958_0061395
860 Ga0466958_0122846
861 Ga0466958_0225180
862 Ga0466958_0258814
863 Ga0466958_0613538
864 Ga0466967_0002836
865 Ga0466967_0027071
866 Ga0466967_0044616
867 Ga0466967_0047618
868 Ga0466967_0061601
869 Ga0466967_0095336
870 Ga0466967_0117133
871 Ga0466967_0215244
872 Ga0466967_0241373
873 Ga0466967_0261687
874 Ga0466967_0437767
875 Ga0466967_0540044
876 Ga0466967_0540837
877 Ga0466967_0759981
878 Ga0495592_0130609
879 Ga0495629_0153913
880 Ga0495641_0021584
881 Ga0495651_0036412
882 Ga0495582_0075412
883 Ga0495605_0050982
884 Ga0495608_0025266
885 Ga0495618_0032217
886 Ga0495628_0071133
887 Ga0495630_0221603
888 Ga0495630_0296663
889 Ga0495665_0104792
890 Ga0495640_0038491
891 Ga0495587_0013763
892 Ga0495645_0256794
893 Ga0495667_0083266
894 Ga0495634_0538538
895 Ga0495588_0453234
896 Ga0495657_0005166
897 Ga0495657_0267238
898 Ga0495623_0062025
899 Ga0495646_0042059
900 Ga0495658_0002872
901 Ga0495613_0466849
902 Ga0495600_0034930
903 Ga0495604_0040449
904 Ga0495674_0352996
905 Ga0495676_0081664
906 Ga0495680_0389899
907 Ga0495675_0002014
908 Ga0495684_0133989
909 Ga0495602_0012238
910 Ga0495602_0082262
911 Ga0495602_0505799
912 Ga0496100_0017723
913 Ga0496100_0052105
914 Ga0496100_0054159
915 Ga0496101_0001024
916 Ga0496101_0016019
917 Ga0496101_0059031
918 Ga0496101_0062560
919 Ga0496102_0022488
920 Ga0496102_0066860
921 Ga0496102_0203392
922 Ga0496103_0131563
923 Ga0496103_0578931
924 Ga0496103_0675600
925 Ga0496104_0002338
926 Ga0496104_0010957
927 Ga0496104_0170999
928 Ga0496105_0002856
929 Ga0496105_0007386
930 Ga0496105_0795651
931 Ga0496106_0012437
932 Ga0496106_0016640
933 Ga0496106_0162686
934 Ga0496107_0000832
935 Ga0496107_0002291
936 Ga0496107_0087509
937 Ga0496108_0129652
938 Ga0496108_1144667
939 Ga0496109_0005292
940 Ga0496109_0227066
941 Ga0496109_0550407
942 Ga0496110_0020449
943 Ga0496110_0036285
944 Ga0496111_0066233
945 Ga0496111_0433718
946 Ga0496112_0000635
947 Ga0496112_0001889
948 Ga0496112_0036005
949 Ga0496112_0394664
950 Ga0496113_0074518
951 Ga0496113_0635779
952 Ga0496114_0001209
953 Ga0496114_0011973
954 Ga0496114_0028605
955 Ga0496114_0634925
956 Ga0496115_0000701
957 Ga0496115_0151596
958 Ga0496115_0339339
959 Ga0496115_1098013
960 Ga0501034_0039223
961 Ga0501047_0009775
962 Ga0501047_0327662
963 Ga0501067_0005193
964 Ga0501068_0164276
965 Ga0501069_0013019
966 Ga0501069_0073229
967 Ga0501070_0000805
968 Ga0501070_0032238
969 Ga0501070_0039570
970 Ga0501074_0039598
971 Ga0501074_0583956
972 Ga0501080_0204983
973 Ga0501080_0373013
974 Ga0501080_0780488
975 Ga0501044_1345255
976 Ga0495655_0010582
977 Ga0495595_0064370
978 Ga0495619_0440451
979 Ga0587066_073237
980 Ga0587121_11604
981 Ga0587114_024061
982 Ga0587114_031010
983 Ga0501082_0663668
984 Ga0466962_0005333
985 Ga0466962_0413919
986 Ga0530510_0093116

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13581

HATPase_c_2

Histidine kinase-like ATPase domain

45

171

0.89

PF02518

HATPase_c

Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase

74

175

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
6m36-assembly1.cif.gz_E the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.9444 8 143
6m36-assembly1.cif.gz_G the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.9428 8 143
6m36-assembly1.cif.gz_E the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.9354 8 143
6m36-assembly1.cif.gz_G the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.9341 8 143
6m36-assembly2.cif.gz_K the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.9319 8 143
ID Description Score Start End Superfamily
af_F1LVF4_158_307_1.10.357.140 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase 0.8757 16 58 1.10.357.140
af_Q12887_160_330_1.10.357.140 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase 0.8754 16 58 1.10.357.140
af_P21592_152_300_1.10.357.140 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase 0.8658 16 58 1.10.357.140
af_P9WGX7_40_164_3.90.1100.10 Alpha Beta;Alpha-Beta Complex;Rna Polymerase Beta Subunit; Chain: C,domain 2; 0.8303 10 143 3.90.1100.10
af_P9WGX7_40_164_3.90.1100.10 Alpha Beta;Alpha-Beta Complex;Rna Polymerase Beta Subunit; Chain: C,domain 2; 0.8179 10 143 3.90.1100.10
ID Description Score Start End GO Terms
AF-A0A7W0NI73-F1-model_v4 ATP-binding protein 0.8932 4 142 GO:0004674
GO:0005524
AF-A0A1G6Q4R8-F1-model_v4 Serine phosphatase RsbU, regulator of sigma subunit 0.8924 8 143 GO:0016791
AF-A0A1V5IQT2-F1-model_v4 Serine-protein kinase RsbW (EC 2.7.11.1) 0.8903 7 143 GO:0004676
GO:0004677
GO:0004679
GO:0004711
GO:0035175
GO:0035402
GO:0035403
GO:0035979
GO:0044022
GO:0044023
GO:0044024
GO:0044025
GO:0072354
GO:0072371
GO:0072518
GO:0106310
GO:0140823
GO:0140855
GO:0140857
GO:1990244
AF-I0V3W2-F1-model_v4 SpoIIE-like protein with GAF domain 0.8892 9 143 GO:0016791
AF-A0A318KEK9-F1-model_v4 Anti-sigma regulatory factor (Ser/Thr protein kinase) 0.8883 8 143 GO:0004674

Map