F454427

General Info

Members Datasets Scaffolds Average Seq Length
493 211 493 200

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10476631|Ga0157370_104766312
Length 222
Sequence VDKKSMSDERHSRGTKDPSGTPLLIAGLGNPGSQYARNRHNAGFIVVDMLHAEYGFGPWKAKFEGLLSEGALGGRKTYLLKPQTYMNLSGDSVGPALRFFKLPLSALVVVHDEIDLAAGKLKVKTGGGDAGQNGLRSITATLGPDYRRVRLGIGHPGEKAKVSGHVLQNFSKDDIDWLKPLVEAMVQAAPLLAKDDDAGFMSKVALLLKPPKPAKEPKKKDA

Samples

Sample ID Description Type Environment
1 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
68 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
69 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
70 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
72 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
122 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
123 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
124 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
125 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
126 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
127 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
128 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
129 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
130 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
131 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
132 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
133 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
134 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
135 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
136 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
137 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
138 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
139 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
140 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
142 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
143 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
144 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
145 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
146 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
147 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
148 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
149 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
150 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
151 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
152 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
153 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
154 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
155 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
156 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
157 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
158 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
159 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
160 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
161 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
162 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
163 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
164 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
165 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
166 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
167 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
168 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
169 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
170 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
171 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
185 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
186 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
187 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
188 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
189 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
190 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
191 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
192 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
193 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
194 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
195 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
196 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
197 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
200 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
201 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
202 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
203 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
204 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
205 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
206 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
207 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
208 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
209 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
210 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
211 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.25
Nodule 0
Rhizoplane 0.41
Rhizosphere 93.71
Stem 0
Stem Tuber 0
Unclassified 2.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1000017 3300003214 Bacteria 377013
2 JGI25153J46596_10003545 3300003215 Bacteria 8705
3 Ga0070658_10034573 3300005327 Bacteria 4066
4 Ga0070658_10152336 3300005327 Bacteria 1936
5 Ga0070658_10218637 3300005327 Bacteria 1611
6 Ga0070658_10220906 3300005327 Bacteria 1602
7 Ga0070658_10721620 3300005327 Bacteria 865
8 Ga0070658_10767008 3300005327 Bacteria 838
9 Ga0070658_10853053 3300005327 Bacteria 792
10 Ga0070676_10003642 3300005328 Bacteria 8061
11 Ga0070683_100113202 3300005329 Bacteria 2561
12 Ga0070683_100487810 3300005329 Bacteria 1177
13 Ga0070683_100646518 3300005329 Bacteria 1012
14 Ga0068869_100159193 3300005334 Bacteria 1756
15 Ga0070666_10058481 3300005335 Bacteria 2607
16 Ga0070666_10086538 3300005335 Bacteria 2147
17 Ga0070680_100000023 3300005336 Bacteria 78765
18 Ga0070680_100566686 3300005336 Bacteria 974
19 Ga0068868_100354888 3300005338 Bacteria 1257
20 Ga0068868_100429414 3300005338 Bacteria 1145
21 Ga0068868_100880756 3300005338 Bacteria 812
22 Ga0070660_100122620 3300005339 Bacteria 2075
23 Ga0070660_100128998 3300005339 Bacteria 2022
24 Ga0070660_100798896 3300005339 Bacteria 793
25 Ga0070689_100110969 3300005340 Bacteria 2181
26 Ga0070661_100068809 3300005344 Bacteria 2602
27 Ga0070661_100551020 3300005344 Bacteria 928
28 Ga0070675_100532883 3300005354 Bacteria 1060
29 Ga0070674_100184954 3300005356 Bacteria 1598
30 Ga0070673_100149849 3300005364 Bacteria 1975
31 Ga0070659_100073770 3300005366 Bacteria 2717
32 Ga0070667_100056116 3300005367 Bacteria 3327
33 Ga0070667_100109361 3300005367 Bacteria 2395
34 Ga0070713_100083881 3300005436 Bacteria 2725
35 Ga0070713_100191945 3300005436 Bacteria 1841
36 Ga0070713_100900641 3300005436 Bacteria 851
37 Ga0070710_10532062 3300005437 Bacteria 809
38 Ga0070678_100021172 3300005456 Bacteria 4282
39 Ga0070678_100321947 3300005456 Bacteria 1320
40 Ga0070681_10000002 3300005458 Bacteria 821814
41 Ga0070681_10012436 3300005458 Bacteria 8443
42 Ga0070681_10038344 3300005458 Bacteria 4804
43 Ga0070685_10512253 3300005466 Bacteria 851
44 Ga0070679_100000445 3300005530 Bacteria 35145
45 Ga0070679_100006251 3300005530 Bacteria 11095
46 Ga0070679_100102629 3300005530 Bacteria 2846
47 Ga0070679_100156037 3300005530 Bacteria 2257
48 Ga0070679_100227542 3300005530 Bacteria 1825
49 Ga0070684_100613858 3300005535 Bacteria 1011
50 Ga0068853_100009568 3300005539 Bacteria 7809
51 Ga0068853_100225289 3300005539 Bacteria 1714
52 Ga0068853_100683143 3300005539 Bacteria 978
53 Ga0068853_100949973 3300005539 Bacteria 827
54 Ga0070696_100273461 3300005546 Bacteria 1285
55 Ga0070693_100068251 3300005547 Bacteria 2086
56 Ga0070665_100028406 3300005548 Bacteria 5633
57 Ga0070665_100087787 3300005548 Bacteria 3116
58 Ga0070665_100250647 3300005548 Bacteria 1771
59 Ga0070665_100362333 3300005548 Bacteria 1456
60 Ga0070665_100370627 3300005548 Bacteria 1439
61 Ga0070665_100495768 3300005548 Bacteria 1232
62 Ga0068855_100000024 3300005563 Bacteria 184241
63 Ga0068855_100056919 3300005563 Bacteria 4584
64 Ga0068855_100069147 3300005563 Bacteria 4109
65 Ga0068855_100070223 3300005563 Bacteria 4075
66 Ga0068855_100403613 3300005563 Bacteria 1497
67 Ga0068855_100525105 3300005563 Bacteria 1284
68 Ga0068855_101141176 3300005563 Bacteria 813
69 Ga0068857_100936036 3300005577 Bacteria 832
70 Ga0068856_100217282 3300005614 Bacteria 1927
71 Ga0068856_100933392 3300005614 Bacteria 886
72 Ga0068852_100122934 3300005616 Bacteria 2379
73 Ga0068852_100276057 3300005616 Bacteria 1619
74 Ga0068864_100776018 3300005618 Bacteria 941
75 Ga0068851_10310210 3300005834 Bacteria 909
76 Ga0068863_100546424 3300005841 Bacteria 1143
77 Ga0068858_100027703 3300005842 Bacteria 5265
78 Ga0068858_100036832 3300005842 Bacteria 4536
79 Ga0068860_100172504 3300005843 Bacteria 2089
80 Ga0068862_100322755 3300005844 Bacteria 1426
81 Ga0081455_10289420 3300005937 Bacteria 1180
82 Ga0081538_10009086 3300005981 Bacteria 8338
83 Ga0081538_10051882 3300005981 Bacteria 2457
84 Ga0097621_100001198 3300006237 Bacteria 17958
85 Ga0097621_100027207 3300006237 Bacteria 4495
86 Ga0097621_100075371 3300006237 Bacteria 2796
87 Ga0097621_100088591 3300006237 Bacteria 2586
88 Ga0097621_100359555 3300006237 Bacteria 1296
89 Ga0097621_100564106 3300006237 Bacteria 1037
90 Ga0068871_100001487 3300006358 Bacteria 15708
91 Ga0068871_100016092 3300006358 Bacteria 5621
92 Ga0068871_100081422 3300006358 Bacteria 2682
93 Ga0068871_100859948 3300006358 Bacteria 839
94 Ga0068865_100016163 3300006881 Bacteria 4768
95 Ga0068865_100550729 3300006881 Bacteria 969
96 Ga0068865_100884994 3300006881 Bacteria 776
97 Ga0105240_10000564 3300009093 Bacteria 68685
98 Ga0105240_10065312 3300009093 Bacteria 4518
99 Ga0105240_10110867 3300009093 Bacteria 3320
100 Ga0105240_10466895 3300009093 Bacteria 1409
101 Ga0105240_10533729 3300009093 Bacteria 1300
102 Ga0105240_10703195 3300009093 Bacteria 1103
103 Ga0105245_10078946 3300009098 Bacteria 3004
104 Ga0105245_10259039 3300009098 Bacteria 1692
105 Ga0105245_10516716 3300009098 Bacteria 1212
106 Ga0105247_10223239 3300009101 Bacteria 1276
107 Ga0105243_10000738 3300009148 Bacteria 31269
108 Ga0105243_11490064 3300009148 Bacteria 700
109 Ga0105241_10182669 3300009174 Bacteria 1741
110 Ga0105241_11039939 3300009174 Bacteria 768
111 Ga0105242_10138321 3300009176 Bacteria 2110
112 Ga0105242_10150717 3300009176 Bacteria 2027
113 Ga0105248_10584957 3300009177 Bacteria 1259
114 Ga0105248_11082423 3300009177 Bacteria 906
115 Ga0105237_10054098 3300009545 Bacteria 4022
116 Ga0105237_10155318 3300009545 Bacteria 2285
117 Ga0105238_10019556 3300009551 Bacteria 6896
118 Ga0105238_10065443 3300009551 Bacteria 3636
119 Ga0105238_10301275 3300009551 Bacteria 1586
120 Ga0105238_10509109 3300009551 Bacteria 1205
121 Ga0105249_10186011 3300009553 Bacteria 2024
122 Ga0105028_113308 3300009993 Bacteria 871
123 Ga0105239_10003451 3300010375 Bacteria 19346
124 Ga0105239_10010957 3300010375 Bacteria 10126
125 Ga0105239_10023202 3300010375 Bacteria 6838
126 Ga0105239_10030879 3300010375 Bacteria 5894
127 Ga0105239_10036483 3300010375 Bacteria 5398
128 Ga0105239_10312339 3300010375 Bacteria 1772
129 Ga0105239_10487169 3300010375 Bacteria 1401
130 Ga0105246_10308553 3300011119 Bacteria 1281
131 Ga0157371_10035846 3300013102 Bacteria 3554
132 Ga0157371_10790159 3300013102 Bacteria 715
133 Ga0157370_10210544 3300013104 Bacteria 1802
134 Ga0157370_10476631 3300013104 Bacteria 1147
135 Ga0157370_10519748 3300013104 Bacteria 1093
136 Ga0157369_10011169 3300013105 Bacteria 10206
137 Ga0157369_10014299 3300013105 Bacteria 8966
138 Ga0157369_10066093 3300013105 Bacteria 3891
139 Ga0157369_10270969 3300013105 Bacteria 1769
140 Ga0157369_10630350 3300013105 Bacteria 1106
141 Ga0157378_10715318 3300013297 Bacteria 1022
142 Ga0163162_10035284 3300013306 Bacteria 4980
143 Ga0163162_11325913 3300013306 Bacteria 818
144 Ga0157372_10228643 3300013307 Bacteria 2156
145 Ga0157375_10801940 3300013308 Bacteria 1090
146 Ga0157379_10005280 3300014968 Bacteria 11093
147 Ga0157379_10012674 3300014968 Bacteria 7369
148 Ga0157379_10032959 3300014968 Bacteria 4619
149 Ga0157376_10200479 3300014969 Bacteria 1836
150 Ga0163161_10073210 3300017792 Bacteria 2510
151 Ga0213876_10000521 3300021384 Bacteria 29455
152 Ga0213876_10002161 3300021384 Bacteria 11622
153 Ga0213876_10006207 3300021384 Bacteria 6522
154 Ga0207427_113809 3300025231 Bacteria 785
155 Ga0209233_1000006 3300025261 Bacteria 1473685
156 Ga0209233_1013973 3300025261 Bacteria 2278
157 Ga0209675_1010560 3300025291 Bacteria 3141
158 Ga0209758_1000008 3300025297 Bacteria 1215263
159 Ga0209758_1065277 3300025297 Bacteria 1176
160 Ga0207656_10118708 3300025321 Bacteria 1229
161 Ga0207642_10104566 3300025899 Bacteria 1429
162 Ga0207642_10233231 3300025899 Bacteria 1035
163 Ga0207710_10117300 3300025900 Bacteria 1268
164 Ga0207688_10142341 3300025901 Bacteria 1412
165 Ga0207680_10007149 3300025903 Bacteria 5427
166 Ga0207680_10038964 3300025903 Bacteria 2754
167 Ga0207645_10238016 3300025907 Bacteria 1202
168 Ga0207705_10001372 3300025909 Bacteria 19446
169 Ga0207705_10141945 3300025909 Bacteria 1794
170 Ga0207705_10143392 3300025909 Bacteria 1785
171 Ga0207705_10152644 3300025909 Bacteria 1731
172 Ga0207705_10167439 3300025909 Bacteria 1653
173 Ga0207705_10405186 3300025909 Bacteria 1055
174 Ga0207705_10628332 3300025909 Bacteria 835
175 Ga0207705_10789384 3300025909 Bacteria 737
176 Ga0207654_10429172 3300025911 Bacteria 923
177 Ga0207707_10000002 3300025912 Bacteria 1142054
178 Ga0207707_10020324 3300025912 Bacteria 5798
179 Ga0207707_10232115 3300025912 Bacteria 1605
180 Ga0207695_10000003 3300025913 Bacteria 1368691
181 Ga0207695_10032341 3300025913 Bacteria 5726
182 Ga0207695_10066906 3300025913 Bacteria 3688
183 Ga0207695_10089265 3300025913 Bacteria 3100
184 Ga0207695_10166417 3300025913 Bacteria 2133
185 Ga0207695_10269703 3300025913 Bacteria 1598
186 Ga0207695_10305690 3300025913 Bacteria 1481
187 Ga0207695_10404412 3300025913 Bacteria 1250
188 Ga0207695_10574967 3300025913 Bacteria 1008
189 Ga0207695_10879246 3300025913 Bacteria 776
190 Ga0207671_10078020 3300025914 Bacteria 2480
191 Ga0207671_10253114 3300025914 Bacteria 1385
192 Ga0207671_10487858 3300025914 Bacteria 982
193 Ga0207660_10000765 3300025917 Bacteria 21388
194 Ga0207660_10307729 3300025917 Bacteria 1263
195 Ga0207657_10035550 3300025919 Bacteria 4466
196 Ga0207657_10056649 3300025919 Bacteria 3381
197 Ga0207657_10162216 3300025919 Bacteria 1815
198 Ga0207657_10814736 3300025919 Bacteria 721
199 Ga0207657_10818661 3300025919 Bacteria 719
200 Ga0207657_10924070 3300025919 Bacteria 672
201 Ga0207649_10096864 3300025920 Bacteria 1944
202 Ga0207652_10000641 3300025921 Bacteria 34615
203 Ga0207652_10057654 3300025921 Bacteria 3345
204 Ga0207652_10085378 3300025921 Bacteria 2766
205 Ga0207652_10187196 3300025921 Bacteria 1861
206 Ga0207652_10257270 3300025921 Bacteria 1575
207 Ga0207652_10450004 3300025921 Bacteria 1161
208 Ga0207652_10454690 3300025921 Bacteria 1154
209 Ga0207694_10000016 3300025924 Bacteria 349087
210 Ga0207694_10107605 3300025924 Bacteria 2215
211 Ga0207694_10113500 3300025924 Bacteria 2157
212 Ga0207659_10309681 3300025926 Bacteria 1300
213 Ga0207687_10039820 3300025927 Bacteria 3219
214 Ga0207687_10053854 3300025927 Bacteria 2813
215 Ga0207700_10263384 3300025928 Bacteria 1477
216 Ga0207700_10868067 3300025928 Bacteria 807
217 Ga0207664_10186830 3300025929 Bacteria 1782
218 Ga0207644_10082418 3300025931 Bacteria 2380
219 Ga0207690_10028833 3300025932 Bacteria 3522
220 Ga0207686_10043644 3300025934 Bacteria 2749
221 Ga0207686_10092230 3300025934 Bacteria 2002
222 Ga0207709_10023127 3300025935 Bacteria 3534
223 Ga0207709_10140047 3300025935 Bacteria 1661
224 Ga0207704_10060808 3300025938 Bacteria 2339
225 Ga0207704_10082299 3300025938 Bacteria 2085
226 Ga0207691_10136736 3300025940 Bacteria 2161
227 Ga0207711_10045348 3300025941 Bacteria 3757
228 Ga0207689_10137468 3300025942 Bacteria 2012
229 Ga0207661_10154058 3300025944 Bacteria 1989
230 Ga0207661_10208406 3300025944 Bacteria 1722
231 Ga0207661_10438601 3300025944 Bacteria 1188
232 Ga0207667_10000021 3300025949 Bacteria 370524
233 Ga0207667_10166552 3300025949 Bacteria 2266
234 Ga0207667_10181204 3300025949 Bacteria 2163
235 Ga0207667_10397558 3300025949 Bacteria 1403
236 Ga0207667_10752111 3300025949 Bacteria 974
237 Ga0207651_10042735 3300025960 Bacteria 3019
238 Ga0207651_10113728 3300025960 Bacteria 2037
239 Ga0207668_10751678 3300025972 Bacteria 860
240 Ga0207658_10114329 3300025986 Bacteria 2140
241 Ga0207658_10129345 3300025986 Bacteria 2026
242 Ga0207658_10609025 3300025986 Bacteria 982
243 Ga0207677_10053048 3300026023 Bacteria 2758
244 Ga0207677_10327937 3300026023 Bacteria 1275
245 Ga0207703_10018894 3300026035 Bacteria 5384
246 Ga0207639_10059395 3300026041 Bacteria 2946
247 Ga0207639_10105925 3300026041 Bacteria 2282
248 Ga0207639_10195267 3300026041 Bacteria 1732
249 Ga0207678_10036672 3300026067 Bacteria 4268
250 Ga0207678_10374515 3300026067 Bacteria 1230
251 Ga0207678_10776876 3300026067 Bacteria 845
252 Ga0207702_10201978 3300026078 Bacteria 1843
253 Ga0207702_10337165 3300026078 Bacteria 1440
254 Ga0207702_10948447 3300026078 Bacteria 853
255 Ga0207641_10249794 3300026088 Bacteria 1656
256 Ga0207648_10002031 3300026089 Bacteria 22111
257 Ga0207676_10122979 3300026095 Bacteria 2192
258 Ga0207676_10384739 3300026095 Bacteria 1307
259 Ga0207674_10095464 3300026116 Bacteria 2959
260 Ga0207674_10735467 3300026116 Bacteria 952
261 Ga0207675_100452937 3300026118 Bacteria 1272
262 Ga0207683_10002526 3300026121 Bacteria 15976
263 Ga0207698_10001973 3300026142 Bacteria 12074
264 Ga0207698_10069692 3300026142 Bacteria 2782
265 Ga0207698_10199614 3300026142 Bacteria 1790
266 Ga0207698_10514844 3300026142 Bacteria 1167
267 Ga0209983_1036926 3300027665 Bacteria 1051
268 Ga0268266_10053294 3300028379 Bacteria 3475
269 Ga0268266_10081262 3300028379 Bacteria 2825
270 Ga0268266_10289504 3300028379 Bacteria 1525
271 Ga0268266_10307615 3300028379 Bacteria 1480
272 Ga0268266_10389905 3300028379 Bacteria 1315
273 Ga0268265_10149459 3300028380 Bacteria 1968
274 Ga0268264_10647793 3300028381 Bacteria 1045
275 Ga0265318_10000046 3300028577 Bacteria 126568
276 Ga0265318_10002912 3300028577 Bacteria 8900
277 Ga0265338_10007293 3300028800 Bacteria 13796
278 Ga0265338_10090006 3300028800 Bacteria 2541
279 Ga0265338_10678802 3300028800 Bacteria 712
280 Ga0265330_10133902 3300031235 Bacteria 1054
281 Ga0265332_10007540 3300031238 Bacteria 4919
282 Ga0265332_10126372 3300031238 Bacteria 1073
283 Ga0265328_10136682 3300031239 Bacteria 919
284 Ga0265320_10000179 3300031240 Bacteria 53742
285 Ga0265320_10099596 3300031240 Bacteria 1339
286 Ga0265325_10000001 3300031241 Bacteria 726814
287 Ga0265325_10006847 3300031241 Bacteria 6889
288 Ga0265325_10050208 3300031241 Bacteria 2149
289 Ga0265325_10182183 3300031241 Bacteria 978
290 Ga0265340_10001732 3300031247 Bacteria 12516
291 Ga0265340_10040639 3300031247 Bacteria 2290
292 Ga0265340_10203524 3300031247 Bacteria 890
293 Ga0265339_10001144 3300031249 Bacteria 20009
294 Ga0265339_10008403 3300031249 Bacteria 6569
295 Ga0265339_10113777 3300031249 Bacteria 1397
296 Ga0265331_10004432 3300031250 Bacteria 8772
297 Ga0265331_10010113 3300031250 Bacteria 5241
298 Ga0265331_10094359 3300031250 Bacteria 1381
299 Ga0265331_10274787 3300031250 Bacteria 755
300 Ga0265316_10019103 3300031344 Bacteria 5871
301 Ga0265316_10124497 3300031344 Bacteria 1945
302 Ga0265316_10131492 3300031344 Bacteria 1885
303 Ga0265313_10001956 3300031595 Bacteria 18633
304 Ga0265313_10002770 3300031595 Bacteria 14780
305 Ga0265313_10007643 3300031595 Bacteria 7331
306 Ga0265313_10015676 3300031595 Bacteria 4398
307 Ga0265313_10164676 3300031595 Bacteria 940
308 Ga0265314_10002927 3300031711 Bacteria 16943
309 Ga0265314_10005967 3300031711 Bacteria 10873
310 Ga0265314_10014300 3300031711 Bacteria 6361
311 Ga0265314_10017664 3300031711 Bacteria 5590
312 Ga0265314_10237664 3300031711 Bacteria 1053
313 Ga0265342_10019826 3300031712 Bacteria 4326
314 Ga0265342_10041824 3300031712 Bacteria 2771
315 Ga0265342_10061091 3300031712 Bacteria 2221
316 Ga0265342_10105293 3300031712 Bacteria 1602
317 Ga0307516_10015499 3300031730 Bacteria 8017
318 Ga0307516_10021243 3300031730 Bacteria 6687
319 Ga0307516_10140957 3300031730 Bacteria 2181
320 Ga0307413_10089979 3300031824 Bacteria 1996
321 Ga0307412_10352839 3300031911 Bacteria 1182
322 Ga0373957_0018901 3300035120 Bacteria 2419
323 Ga0373927_0062376 3300035695 Bacteria 2411
324 Ga0373937_0014640 3300036401 Bacteria 6926
325 Ga0395899_0146593 3300037312 Bacteria 1676
326 Ga0395900_0203489 3300037418 Bacteria 2002
327 Ga0395898_0088054 3300037466 Bacteria 2990
328 Ga0395901_0010959 3300038443 Bacteria 9184
329 Ga0395901_0164279 3300038443 Bacteria 2331
330 Ga0436365_0537031 3300039437 Bacteria 38995
331 Ga0436365_1011740 3300039437 Bacteria 786
332 Ga0436365_1427236 3300039437 Bacteria 631
333 Ga0436365_1687427 3300039437 Bacteria 16468
334 Ga0436365_1935268 3300039437 Bacteria 135877
335 Ga0436360_1300782 3300039438 Bacteria 1841
336 Ga0436361_0875815 3300039447 Bacteria 954
337 Ga0439434_0060929 3300042435 Bacteria 1180
338 Ga0439460_0082223 3300042461 Bacteria 1012
339 Ga0466964_0055136 3300044706 Bacteria 1641
340 Ga0495628_0644640 3300046516 Bacteria 753
341 Ga0495652_0552838 3300046529 Bacteria 791
342 Ga0495586_0294349 3300046535 Bacteria 930
343 Ga0495587_0087474 3300046536 Bacteria 1803
344 Ga0495621_0104673 3300046539 Bacteria 1080
345 Ga0495645_0012628 3300046543 Bacteria 5956
346 Ga0495667_0125732 3300046559 Bacteria 1655
347 Ga0495635_0450712 3300046663 Bacteria 851
348 Ga0495599_0249322 3300046678 Bacteria 1081
349 Ga0495623_0171233 3300046679 Bacteria 1268
350 Ga0495669_0198716 3300046684 Bacteria 958
351 Ga0495613_0585467 3300046689 Bacteria 744
352 Ga0495600_0291040 3300046809 Bacteria 1032
353 Ga0495672_0198516 3300047320 Bacteria 1005
354 Ga0495673_0119168 3300047469 Bacteria 1047
355 Ga0496103_0145916 3300048906 Bacteria 1515
356 Ga0496111_0087758 3300048914 Bacteria 2277
357 Ga0496121_0000323 3300048924 Bacteria 100188
358 Ga0496126_0498662 3300048929 Bacteria 973
359 Ga0495682_0013050 3300049460 Bacteria 3169
360 Ga0501031_0000410 3300049568 Bacteria 24834
361 Ga0501032_0056610 3300049569 Bacteria 2635
362 Ga0501032_0108566 3300049569 Bacteria 1837
363 Ga0501033_0014372 3300049570 Bacteria 6013
364 Ga0501033_0029313 3300049570 Bacteria 4136
365 Ga0501033_0058715 3300049570 Bacteria 2841
366 Ga0501033_0064978 3300049570 Bacteria 2684
367 Ga0501033_0104364 3300049570 Bacteria 2066
368 Ga0501033_0160574 3300049570 Bacteria 1618
369 Ga0501034_0019080 3300049571 Bacteria 7021
370 Ga0501034_0067763 3300049571 Bacteria 3581
371 Ga0501034_0103932 3300049571 Bacteria 2834
372 Ga0501034_0181463 3300049571 Bacteria 2070
373 Ga0501034_0243928 3300049571 Bacteria 1742
374 Ga0501034_0352250 3300049571 Bacteria 1400
375 Ga0501034_0352772 3300049571 Bacteria 1399
376 Ga0501034_0470354 3300049571 Bacteria 1173
377 Ga0501034_0475746 3300049571 Bacteria 1165
378 Ga0501034_0697735 3300049571 Bacteria 914
379 Ga0501034_0921296 3300049571 Bacteria 761
380 Ga0501036_0000803 3300049572 Bacteria 23354
381 Ga0501036_0082004 3300049572 Bacteria 2726
382 Ga0501036_0359455 3300049572 Bacteria 1216
383 Ga0501036_0366018 3300049572 Bacteria 1203
384 Ga0501036_0372461 3300049572 Bacteria 1192
385 Ga0501037_0011117 3300049573 Bacteria 6623
386 Ga0501037_0153107 3300049573 Bacteria 1647
387 Ga0501037_0210175 3300049573 Bacteria 1372
388 Ga0501037_0238456 3300049573 Bacteria 1275
389 Ga0501038_0012808 3300049574 Bacteria 7659
390 Ga0501038_0085671 3300049574 Bacteria 2649
391 Ga0501038_0219172 3300049574 Bacteria 1519
392 Ga0501038_0377364 3300049574 Bacteria 1100
393 Ga0501038_0398314 3300049574 Bacteria 1065
394 Ga0501038_0483734 3300049574 Bacteria 948
395 Ga0501039_0000235 3300049575 Bacteria 40369
396 Ga0501039_0071152 3300049575 Bacteria 2702
397 Ga0501040_0004037 3300049576 Bacteria 9538
398 Ga0501040_0300155 3300049576 Bacteria 1148
399 Ga0501040_0642210 3300049576 Bacteria 767
400 Ga0501043_0032612 3300049579 Bacteria 4095
401 Ga0501043_0062157 3300049579 Bacteria 2932
402 Ga0501043_0216432 3300049579 Bacteria 1483
403 Ga0501043_0234265 3300049579 Bacteria 1417
404 Ga0501043_0346989 3300049579 Bacteria 1128
405 Ga0501046_0003636 3300049580 Bacteria 14129
406 Ga0501046_0015285 3300049580 Bacteria 6455
407 Ga0501046_0084359 3300049580 Bacteria 2450
408 Ga0501046_0227918 3300049580 Bacteria 1378
409 Ga0501046_0258835 3300049580 Bacteria 1279
410 Ga0501046_0476884 3300049580 Bacteria 895
411 Ga0501047_0001840 3300049581 Bacteria 20467
412 Ga0501047_0002517 3300049581 Bacteria 17477
413 Ga0501047_0014073 3300049581 Bacteria 7603
414 Ga0501047_0022186 3300049581 Bacteria 6100
415 Ga0501047_0029038 3300049581 Bacteria 5334
416 Ga0501047_0033123 3300049581 Bacteria 4988
417 Ga0501047_0045566 3300049581 Bacteria 4241
418 Ga0501047_0081559 3300049581 Bacteria 3109
419 Ga0501047_0102927 3300049581 Bacteria 2735
420 Ga0501047_0109371 3300049581 Bacteria 2647
421 Ga0501047_0327218 3300049581 Bacteria 1371
422 Ga0501047_0336791 3300049581 Bacteria 1347
423 Ga0501047_0705737 3300049581 Bacteria 826
424 Ga0501048_0015256 3300049582 Bacteria 5675
425 Ga0501048_0120783 3300049582 Bacteria 1851
426 Ga0501067_0002807 3300049583 Bacteria 9580
427 Ga0501069_0001097 3300049585 Bacteria 13057
428 Ga0501070_0020041 3300049586 Bacteria 5607
429 Ga0501070_0377604 3300049586 Bacteria 1148
430 Ga0501071_0025116 3300049587 Bacteria 4173
431 Ga0501072_0015928 3300049588 Bacteria 5764
432 Ga0501072_0016842 3300049588 Bacteria 5615
433 Ga0501072_0078728 3300049588 Bacteria 2610
434 Ga0501073_0014772 3300049589 Bacteria 5670
435 Ga0501073_0261828 3300049589 Bacteria 1193
436 Ga0501073_0363517 3300049589 Bacteria 999
437 Ga0501074_0004276 3300049590 Bacteria 10191
438 Ga0501074_0212529 3300049590 Bacteria 1378
439 Ga0501074_0282606 3300049590 Bacteria 1180
440 Ga0501076_0112472 3300049592 Bacteria 2202
441 Ga0501076_0215481 3300049592 Bacteria 1570
442 Ga0501076_0495815 3300049592 Bacteria 1007
443 Ga0501077_0042223 3300049593 Bacteria 2900
444 Ga0501079_0028066 3300049741 Bacteria 4318
445 Ga0501079_0163170 3300049741 Bacteria 1738
446 Ga0501079_0435493 3300049741 Bacteria 1029
447 Ga0501080_0027322 3300049742 Bacteria 5306
448 Ga0501080_0038098 3300049742 Bacteria 4490
449 Ga0501080_0039023 3300049742 Bacteria 4431
450 Ga0501080_0126215 3300049742 Bacteria 2370
451 Ga0501080_0131302 3300049742 Bacteria 2319
452 Ga0501080_0219327 3300049742 Bacteria 1741
453 Ga0501080_0297099 3300049742 Bacteria 1465
454 Ga0501080_0470906 3300049742 Bacteria 1125
455 Ga0501081_0007164 3300049743 Bacteria 7251
456 Ga0501081_0543603 3300049743 Bacteria 868
457 Ga0501083_0001635 3300049744 Bacteria 15325
458 Ga0501083_0367580 3300049744 Bacteria 935
459 Ga0501035_0010456 3300049822 Bacteria 8600
460 Ga0501035_0037338 3300049822 Bacteria 4399
461 Ga0501035_0054884 3300049822 Bacteria 3558
462 Ga0501035_0072023 3300049822 Bacteria 3059
463 Ga0501035_0095431 3300049822 Bacteria 2614
464 Ga0501035_0097485 3300049822 Bacteria 2582
465 Ga0501035_0137723 3300049822 Bacteria 2124
466 Ga0501035_0210549 3300049822 Bacteria 1663
467 Ga0501044_0004024 3300049823 Bacteria 16477
468 Ga0501044_0014932 3300049823 Bacteria 8374
469 Ga0501044_0061197 3300049823 Bacteria 3852
470 Ga0501044_0113450 3300049823 Bacteria 2717
471 Ga0501044_0117807 3300049823 Bacteria 2659
472 Ga0501044_0165706 3300049823 Bacteria 2184
473 Ga0501044_0286886 3300049823 Bacteria 1578
474 Ga0501044_0391794 3300049823 Bacteria 1303
475 Ga0501044_0485854 3300049823 Bacteria 1137
476 Ga0501044_0596597 3300049823 Bacteria 998
477 Ga0501044_0628719 3300049823 Bacteria 964
478 Ga0501045_0005701 3300049824 Bacteria 8615
479 Ga0501045_0494309 3300049824 Bacteria 908
480 Ga0500643_000017 3300053087 Bacteria 305781
481 Ga0500566_0086113 3300053094 Bacteria 1742
482 Ga0500594_0096111 3300053118 Bacteria 906
483 Ga0500595_013849 3300053119 Bacteria 3078
484 Ga0500559_0040981 3300053136 Bacteria 2018
485 Ga0500568_0120068 3300053139 Bacteria 980
486 Ga0500588_0192532 3300053146 Bacteria 753
487 Ga0500645_048488 3300053730 Bacteria 1244
488 Ga0501084_0000431 3300054114 Bacteria 32242
489 Ga0501084_0005999 3300054114 Bacteria 9992
490 Ga0501084_0169562 3300054114 Bacteria 1842
491 Ga0590075_054518 3300059424 Bacteria 1027
492 Ga0501082_0019113 3300060353 Bacteria 5904
493 Ga0530510_0621353 3300061734 Bacteria 822

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048914 Ga0496111_0087758 Ga0496111_0087758_11_523 168
2 3300005436 Ga0070713_100900641 Ga0070713_1009006412 174
3 3300039437 Ga0436365_1427236 Ga0436365_1427236_68_610 174
4 3300028577 Ga0265318_10000046 Ga0265318_1000004678 176
5 3300005328 Ga0070676_10003642 Ga0070676_100036422 179
6 3300005334 Ga0068869_100159193 Ga0068869_1001591932 179
7 3300005354 Ga0070675_100532883 Ga0070675_1005328832 179
8 3300005356 Ga0070674_100184954 Ga0070674_1001849542 179
9 3300005456 Ga0070678_100321947 Ga0070678_1003219472 179
10 3300006358 Ga0068871_100081422 Ga0068871_1000814224 179
11 3300006881 Ga0068865_100550729 Ga0068865_1005507291 179
12 3300009093 Ga0105240_10065312 Ga0105240_100653125 179
13 3300009148 Ga0105243_10000738 Ga0105243_100007382 179
14 3300010375 Ga0105239_10312339 Ga0105239_103123392 179
15 3300013105 Ga0157369_10630350 Ga0157369_106303502 179
16 3300025901 Ga0207688_10142341 Ga0207688_101423412 179
17 3300025913 Ga0207695_10032341 Ga0207695_100323413 179
18 3300025927 Ga0207687_10039820 Ga0207687_100398205 179
19 3300025935 Ga0207709_10023127 Ga0207709_100231274 179
20 3300025940 Ga0207691_10136736 Ga0207691_101367363 179
21 3300025942 Ga0207689_10137468 Ga0207689_101374682 179
22 3300025960 Ga0207651_10042735 Ga0207651_100427354 179
23 3300026089 Ga0207648_10002031 Ga0207648_100020312 179
24 3300026116 Ga0207674_10095464 Ga0207674_100954644 179
25 3300028379 Ga0268266_10289504 Ga0268266_102895042 179
26 3300046559 Ga0495667_0125732 Ga0495667_0125732_589_1194 179
27 3300005335 Ga0070666_10058481 Ga0070666_100584811 180
28 3300006237 Ga0097621_100001198 Ga0097621_10000119811 180
29 3300006358 Ga0068871_100001487 Ga0068871_10000148711 180
30 3300025903 Ga0207680_10007149 Ga0207680_100071492 180
31 3300025909 Ga0207705_10628332 Ga0207705_106283322 180
32 3300025919 Ga0207657_10035550 Ga0207657_100355506 180
33 3300025935 Ga0207709_10140047 Ga0207709_101400472 180
34 3300046689 Ga0495613_0585467 Ga0495613_0585467_119_727 180
35 3300053119 Ga0500595_013849 Ga0500595_013849_1008_1616 180
36 3300025926 Ga0207659_10309681 Ga0207659_103096811 181
37 3300049572 Ga0501036_0082004 Ga0501036_0082004_986_1603 181
38 3300049573 Ga0501037_0238456 Ga0501037_0238456_548_1165 181
39 3300049574 Ga0501038_0398314 Ga0501038_0398314_80_697 181
40 3300049579 Ga0501043_0346989 Ga0501043_0346989_230_847 181
41 3300049581 Ga0501047_0014073 Ga0501047_0014073_6894_7511 181
42 3300049822 Ga0501035_0210549 Ga0501035_0210549_182_799 181
43 3300049823 Ga0501044_0014932 Ga0501044_0014932_6414_7031 181
44 3300031824 Ga0307413_10089979 Ga0307413_100899793 182
45 3300049571 Ga0501034_0352772 Ga0501034_0352772_327_917 182
46 3300053087 Ga0500643_000017 Ga0500643_000017_305016_305639 182
47 3300005844 Ga0068862_100322755 Ga0068862_1003227552 183
48 3300025921 Ga0207652_10257270 Ga0207652_102572701 183
49 3300025972 Ga0207668_10751678 Ga0207668_107516781 183
50 3300028380 Ga0268265_10149459 Ga0268265_101494592 183
51 3300028800 Ga0265338_10007293 Ga0265338_1000729311 183
52 3300031235 Ga0265330_10133902 Ga0265330_101339021 183
53 3300031238 Ga0265332_10007540 Ga0265332_100075404 183
54 3300031241 Ga0265325_10050208 Ga0265325_100502082 183
55 3300031247 Ga0265340_10040639 Ga0265340_100406393 183
56 3300031250 Ga0265331_10004432 Ga0265331_100044324 183
57 3300031344 Ga0265316_10019103 Ga0265316_100191033 183
58 3300031711 Ga0265314_10005967 Ga0265314_100059676 183
59 3300005327 Ga0070658_10767008 Ga0070658_107670082 185
60 3300005329 Ga0070683_100646518 Ga0070683_1006465182 185
61 3300005338 Ga0068868_100429414 Ga0068868_1004294142 185
62 3300005437 Ga0070710_10532062 Ga0070710_105320621 185
63 3300005530 Ga0070679_100102629 Ga0070679_1001026292 185
64 3300005548 Ga0070665_100250647 Ga0070665_1002506472 185
65 3300014968 Ga0157379_10005280 Ga0157379_100052803 185
66 3300025921 Ga0207652_10454690 Ga0207652_104546902 185
67 3300028379 Ga0268266_10081262 Ga0268266_100812623 185
68 3300006237 Ga0097621_100088591 Ga0097621_1000885912 186
69 3300005329 Ga0070683_100487810 Ga0070683_1004878102 187
70 3300005458 Ga0070681_10038344 Ga0070681_100383443 187
71 3300005539 Ga0068853_100225289 Ga0068853_1002252892 187
72 3300005616 Ga0068852_100276057 Ga0068852_1002760572 187
73 3300013104 Ga0157370_10519748 Ga0157370_105197482 187
74 3300025911 Ga0207654_10429172 Ga0207654_104291722 187
75 3300026118 Ga0207675_100452937 Ga0207675_1004529372 187
76 3300028379 Ga0268266_10053294 Ga0268266_100532943 187
77 3300042435 Ga0439434_0060929 Ga0439434_0060929_198_809 187
78 3300005327 Ga0070658_10721620 Ga0070658_107216202 188
79 3300005339 Ga0070660_100128998 Ga0070660_1001289983 188
80 3300005339 Ga0070660_100798896 Ga0070660_1007988961 188
81 3300005530 Ga0070679_100156037 Ga0070679_1001560372 188
82 3300005546 Ga0070696_100273461 Ga0070696_1002734612 188
83 3300005548 Ga0070665_100362333 Ga0070665_1003623333 188
84 3300005563 Ga0068855_101141176 Ga0068855_1011411762 188
85 3300013102 Ga0157371_10035846 Ga0157371_100358462 188
86 3300013102 Ga0157371_10790159 Ga0157371_107901591 188
87 3300025909 Ga0207705_10143392 Ga0207705_101433923 188
88 3300025909 Ga0207705_10152644 Ga0207705_101526442 188
89 3300025909 Ga0207705_10789384 Ga0207705_107893842 188
90 3300025912 Ga0207707_10232115 Ga0207707_102321152 188
91 3300025919 Ga0207657_10814736 Ga0207657_108147361 188
92 3300025919 Ga0207657_10818661 Ga0207657_108186611 188
93 3300025921 Ga0207652_10057654 Ga0207652_100576544 188
94 3300026041 Ga0207639_10105925 Ga0207639_101059252 188
95 3300026067 Ga0207678_10036672 Ga0207678_100366723 188
96 3300026078 Ga0207702_10337165 Ga0207702_103371652 188
97 3300026142 Ga0207698_10199614 Ga0207698_101996142 188
98 3300028379 Ga0268266_10307615 Ga0268266_103076151 188
99 3300037312 Ga0395899_0146593 Ga0395899_0146593_711_1340 188
100 3300037466 Ga0395898_0088054 Ga0395898_0088054_1766_2395 188
101 3300038443 Ga0395901_0010959 Ga0395901_0010959_599_1228 188
102 3300048906 Ga0496103_0145916 Ga0496103_0145916_776_1348 188
103 3300049742 Ga0501080_0126215 Ga0501080_0126215_597_1226 188
104 3300005327 Ga0070658_10218637 Ga0070658_102186371 189
105 3300005327 Ga0070658_10034573 Ga0070658_100345734 190
106 3300025909 Ga0207705_10141945 Ga0207705_101419452 190
107 3300046684 Ga0495669_0198716 Ga0495669_0198716_285_878 190
108 3300048929 Ga0496126_0498662 Ga0496126_0498662_168_773 190
109 3300049581 Ga0501047_0705737 Ga0501047_0705737_131_724 190
110 3300049742 Ga0501080_0470906 Ga0501080_0470906_437_1030 190
111 3300006237 Ga0097621_100564106 Ga0097621_1005641062 191
112 3300013306 Ga0163162_11325913 Ga0163162_113259131 191
113 3300005338 Ga0068868_100880756 Ga0068868_1008807561 192
114 3300005367 Ga0070667_100109361 Ga0070667_1001093612 192
115 3300005548 Ga0070665_100495768 Ga0070665_1004957682 192
116 3300028800 Ga0265338_10678802 Ga0265338_106788021 192
117 3300005436 Ga0070713_100191945 Ga0070713_1001919452 193
118 3300005981 Ga0081538_10009086 Ga0081538_100090869 193
119 3300025291 Ga0209675_1010560 Ga0209675_10105604 193
120 3300025928 Ga0207700_10263384 Ga0207700_102633841 193
121 3300027665 Ga0209983_1036926 Ga0209983_10369262 193
122 3300035120 Ga0373957_0018901 Ga0373957_0018901_1216_1839 193
123 3300036401 Ga0373937_0014640 Ga0373937_0014640_5997_6620 193
124 3300049571 Ga0501034_0181463 Ga0501034_0181463_146_784 193
125 3300049823 Ga0501044_0628719 Ga0501044_0628719_64_729 193
126 3300059424 Ga0590075_054518 Ga0590075_054518_251_856 193
127 3300005937 Ga0081455_10289420 Ga0081455_102894202 194
128 3300005981 Ga0081538_10051882 Ga0081538_100518822 194
129 3300009093 Ga0105240_10466895 Ga0105240_104668952 194
130 3300013297 Ga0157378_10715318 Ga0157378_107153181 194
131 3300025913 Ga0207695_10089265 Ga0207695_100892652 194
132 3300026067 Ga0207678_10776876 Ga0207678_107768762 194
133 3300031911 Ga0307412_10352839 Ga0307412_103528392 194
134 3300042461 Ga0439460_0082223 Ga0439460_0082223_42_656 194
135 3300049570 Ga0501033_0160574 Ga0501033_0160574_177_833 194
136 3300049574 Ga0501038_0377364 Ga0501038_0377364_21_635 194
137 3300049575 Ga0501039_0071152 Ga0501039_0071152_1218_1832 194
138 3300049576 Ga0501040_0004037 Ga0501040_0004037_6478_7092 194
139 3300049576 Ga0501040_0300155 Ga0501040_0300155_357_971 194
140 3300049579 Ga0501043_0234265 Ga0501043_0234265_345_959 194
141 3300049580 Ga0501046_0084359 Ga0501046_0084359_1179_1793 194
142 3300049582 Ga0501048_0120783 Ga0501048_0120783_898_1512 194
143 3300049587 Ga0501071_0025116 Ga0501071_0025116_1059_1673 194
144 3300049588 Ga0501072_0015928 Ga0501072_0015928_2450_3064 194
145 3300049590 Ga0501074_0212529 Ga0501074_0212529_654_1268 194
146 3300049592 Ga0501076_0112472 Ga0501076_0112472_423_1031 194
147 3300049592 Ga0501076_0495815 Ga0501076_0495815_312_926 194
148 3300049593 Ga0501077_0042223 Ga0501077_0042223_565_1179 194
149 3300049741 Ga0501079_0028066 Ga0501079_0028066_2807_3421 194
150 3300049741 Ga0501079_0435493 Ga0501079_0435493_99_713 194
151 3300049742 Ga0501080_0027322 Ga0501080_0027322_211_825 194
152 3300049743 Ga0501081_0007164 Ga0501081_0007164_4825_5439 194
153 3300049743 Ga0501081_0543603 Ga0501081_0543603_134_748 194
154 3300049822 Ga0501035_0097485 Ga0501035_0097485_697_1311 194
155 3300049824 Ga0501045_0494309 Ga0501045_0494309_220_834 194
156 3300054114 Ga0501084_0169562 Ga0501084_0169562_684_1298 194
157 3300060353 Ga0501082_0019113 Ga0501082_0019113_4775_5389 194
158 3300061734 Ga0530510_0621353 Ga0530510_0621353_91_705 194
159 3300005327 Ga0070658_10152336 Ga0070658_101523361 195
160 3300005458 Ga0070681_10012436 Ga0070681_100124363 195
161 3300005563 Ga0068855_100069147 Ga0068855_1000691474 195
162 3300005614 Ga0068856_100217282 Ga0068856_1002172822 195
163 3300025909 Ga0207705_10001372 Ga0207705_1000137214 195
164 3300025912 Ga0207707_10020324 Ga0207707_100203243 195
165 3300025919 Ga0207657_10056649 Ga0207657_100566493 195
166 3300026041 Ga0207639_10195267 Ga0207639_101952672 195
167 3300031344 Ga0265316_10131492 Ga0265316_101314923 195
168 3300049571 Ga0501034_0243928 Ga0501034_0243928_89_718 195
169 3300049574 Ga0501038_0219172 Ga0501038_0219172_284_952 195
170 3300049580 Ga0501046_0015285 Ga0501046_0015285_199_828 195
171 3300049581 Ga0501047_0001840 Ga0501047_0001840_2536_3165 195
172 3300049589 Ga0501073_0363517 Ga0501073_0363517_167_796 195
173 3300049742 Ga0501080_0131302 Ga0501080_0131302_1381_2010 195
174 3300005548 Ga0070665_100087787 Ga0070665_1000877872 196
175 3300021384 Ga0213876_10002161 Ga0213876_1000216110 196
176 3300028379 Ga0268266_10389905 Ga0268266_103899052 196
177 3300039437 Ga0436365_1687427 Ga0436365_1687427_9737_10333 196
178 3300049569 Ga0501032_0108566 Ga0501032_0108566_195_794 196
179 3300049572 Ga0501036_0366018 Ga0501036_0366018_120_719 196
180 3300049573 Ga0501037_0210175 Ga0501037_0210175_539_1138 196
181 3300049579 Ga0501043_0062157 Ga0501043_0062157_1238_1837 196
182 3300049742 Ga0501080_0219327 Ga0501080_0219327_88_687 196
183 3300049822 Ga0501035_0037338 Ga0501035_0037338_940_1539 196
184 3300049823 Ga0501044_0113450 Ga0501044_0113450_645_1244 196
185 3300053094 Ga0500566_0086113 Ga0500566_0086113_348_980 196
186 3300003215 JGI25153J46596_10003545 JGI25153J46596_100035454 197
187 3300005436 Ga0070713_100083881 Ga0070713_1000838812 197
188 3300005535 Ga0070684_100613858 Ga0070684_1006138581 197
189 3300005563 Ga0068855_100525105 Ga0068855_1005251052 197
190 3300009093 Ga0105240_10110867 Ga0105240_101108672 197
191 3300009148 Ga0105243_11490064 Ga0105243_114900641 197
192 3300013105 Ga0157369_10270969 Ga0157369_102709693 197
193 3300025297 Ga0209758_1000008 Ga0209758_1000008663 197
194 3300025913 Ga0207695_10269703 Ga0207695_102697032 197
195 3300025949 Ga0207667_10752111 Ga0207667_107521112 197
196 3300028577 Ga0265318_10002912 Ga0265318_100029127 197
197 3300028800 Ga0265338_10090006 Ga0265338_100900062 197
198 3300031239 Ga0265328_10136682 Ga0265328_101366821 197
199 3300031240 Ga0265320_10099596 Ga0265320_100995962 197
200 3300031250 Ga0265331_10274787 Ga0265331_102747871 197
201 3300031595 Ga0265313_10002770 Ga0265313_100027705 197
202 3300031711 Ga0265314_10017664 Ga0265314_100176642 197
203 3300031712 Ga0265342_10041824 Ga0265342_100418242 197
204 3300035695 Ga0373927_0062376 Ga0373927_0062376_761_1375 197
205 3300039447 Ga0436361_0875815 Ga0436361_0875815_111_707 197
206 3300049570 Ga0501033_0064978 Ga0501033_0064978_630_1232 197
207 3300049570 Ga0501033_0104364 Ga0501033_0104364_112_717 197
208 3300049571 Ga0501034_0470354 Ga0501034_0470354_427_1029 197
209 3300049571 Ga0501034_0921296 Ga0501034_0921296_150_749 197
210 3300049572 Ga0501036_0372461 Ga0501036_0372461_149_751 197
211 3300049573 Ga0501037_0011117 Ga0501037_0011117_260_862 197
212 3300049576 Ga0501040_0642210 Ga0501040_0642210_55_657 197
213 3300049580 Ga0501046_0227918 Ga0501046_0227918_410_1012 197
214 3300049823 Ga0501044_0485854 Ga0501044_0485854_477_1079 197
215 3300054114 Ga0501084_0000431 Ga0501084_0000431_20869_21471 197
216 3300005335 Ga0070666_10086538 Ga0070666_100865381 198
217 3300005340 Ga0070689_100110969 Ga0070689_1001109692 198
218 3300005563 Ga0068855_100056919 Ga0068855_1000569195 198
219 3300005841 Ga0068863_100546424 Ga0068863_1005464241 198
220 3300005842 Ga0068858_100027703 Ga0068858_1000277033 198
221 3300005842 Ga0068858_100036832 Ga0068858_1000368322 198
222 3300009098 Ga0105245_10078946 Ga0105245_100789462 198
223 3300009177 Ga0105248_10584957 Ga0105248_105849572 198
224 3300009545 Ga0105237_10155318 Ga0105237_101553182 198
225 3300010375 Ga0105239_10023202 Ga0105239_100232024 198
226 3300010375 Ga0105239_10036483 Ga0105239_100364834 198
227 3300021384 Ga0213876_10000521 Ga0213876_1000052113 198
228 3300025903 Ga0207680_10038964 Ga0207680_100389642 198
229 3300025921 Ga0207652_10450004 Ga0207652_104500041 198
230 3300025927 Ga0207687_10053854 Ga0207687_100538542 198
231 3300025941 Ga0207711_10045348 Ga0207711_100453485 198
232 3300026088 Ga0207641_10249794 Ga0207641_102497942 198
233 3300039437 Ga0436365_1011740 Ga0436365_1011740_58_660 198
234 3300039437 Ga0436365_1935268 Ga0436365_1935268_53787_54404 198
235 3300048924 Ga0496121_0000323 Ga0496121_0000323_52026_52631 198
236 3300049571 Ga0501034_0067763 Ga0501034_0067763_184_804 198
237 3300049574 Ga0501038_0483734 Ga0501038_0483734_84_704 198
238 3300049581 Ga0501047_0102927 Ga0501047_0102927_806_1426 198
239 3300049586 Ga0501070_0377604 Ga0501070_0377604_272_892 198
240 3300049590 Ga0501074_0282606 Ga0501074_0282606_208_828 198
241 3300049744 Ga0501083_0367580 Ga0501083_0367580_245_865 198
242 3300049823 Ga0501044_0286886 Ga0501044_0286886_226_846 198
243 3300005327 Ga0070658_10220906 Ga0070658_102209062 199
244 3300005327 Ga0070658_10853053 Ga0070658_108530531 199
245 3300005336 Ga0070680_100000023 Ga0070680_10000002336 199
246 3300005336 Ga0070680_100566686 Ga0070680_1005666862 199
247 3300005339 Ga0070660_100122620 Ga0070660_1001226202 199
248 3300005344 Ga0070661_100068809 Ga0070661_1000688093 199
249 3300005366 Ga0070659_100073770 Ga0070659_1000737703 199
250 3300005367 Ga0070667_100056116 Ga0070667_1000561162 199
251 3300005458 Ga0070681_10000002 Ga0070681_1000000256 199
252 3300005466 Ga0070685_10512253 Ga0070685_105122531 199
253 3300005530 Ga0070679_100000445 Ga0070679_1000004455 199
254 3300005530 Ga0070679_100006251 Ga0070679_10000625111 199
255 3300005530 Ga0070679_100227542 Ga0070679_1002275423 199
256 3300005539 Ga0068853_100009568 Ga0068853_1000095687 199
257 3300005539 Ga0068853_100683143 Ga0068853_1006831431 199
258 3300005539 Ga0068853_100949973 Ga0068853_1009499731 199
259 3300005548 Ga0070665_100028406 Ga0070665_1000284064 199
260 3300005548 Ga0070665_100370627 Ga0070665_1003706272 199
261 3300005563 Ga0068855_100000024 Ga0068855_1000000242 199
262 3300005563 Ga0068855_100070223 Ga0068855_1000702234 199
263 3300005563 Ga0068855_100403613 Ga0068855_1004036132 199
264 3300005577 Ga0068857_100936036 Ga0068857_1009360361 199
265 3300005614 Ga0068856_100933392 Ga0068856_1009333922 199
266 3300005616 Ga0068852_100122934 Ga0068852_1001229342 199
267 3300005618 Ga0068864_100776018 Ga0068864_1007760182 199
268 3300005834 Ga0068851_10310210 Ga0068851_103102101 199
269 3300006237 Ga0097621_100075371 Ga0097621_1000753714 199
270 3300006237 Ga0097621_100359555 Ga0097621_1003595552 199
271 3300006358 Ga0068871_100016092 Ga0068871_1000160925 199
272 3300009093 Ga0105240_10000564 Ga0105240_1000056432 199
273 3300009093 Ga0105240_10703195 Ga0105240_107031952 199
274 3300009101 Ga0105247_10223239 Ga0105247_102232392 199
275 3300009174 Ga0105241_10182669 Ga0105241_101826692 199
276 3300009174 Ga0105241_11039939 Ga0105241_110399391 199
277 3300009176 Ga0105242_10138321 Ga0105242_101383212 199
278 3300009177 Ga0105248_11082423 Ga0105248_110824231 199
279 3300009545 Ga0105237_10054098 Ga0105237_100540982 199
280 3300009551 Ga0105238_10019556 Ga0105238_100195568 199
281 3300009551 Ga0105238_10065443 Ga0105238_100654432 199
282 3300009551 Ga0105238_10301275 Ga0105238_103012752 199
283 3300009553 Ga0105249_10186011 Ga0105249_101860113 199
284 3300009993 Ga0105028_113308 Ga0105028_1133082 199
285 3300010375 Ga0105239_10003451 Ga0105239_1000345117 199
286 3300010375 Ga0105239_10010957 Ga0105239_100109576 199
287 3300010375 Ga0105239_10030879 Ga0105239_100308794 199
288 3300010375 Ga0105239_10487169 Ga0105239_104871692 199
289 3300011119 Ga0105246_10308553 Ga0105246_103085532 199
290 3300013104 Ga0157370_10210544 Ga0157370_102105442 199
291 3300013104 Ga0157370_10476631 Ga0157370_104766312 199
292 3300013105 Ga0157369_10011169 Ga0157369_1001116910 199
293 3300013105 Ga0157369_10014299 Ga0157369_1001429910 199
294 3300013105 Ga0157369_10066093 Ga0157369_100660933 199
295 3300013306 Ga0163162_10035284 Ga0163162_100352844 199
296 3300013307 Ga0157372_10228643 Ga0157372_102286432 199
297 3300021384 Ga0213876_10006207 Ga0213876_100062077 199
298 3300025261 Ga0209233_1013973 Ga0209233_10139733 199
299 3300025297 Ga0209758_1065277 Ga0209758_10652772 199
300 3300025321 Ga0207656_10118708 Ga0207656_101187082 199
301 3300025899 Ga0207642_10104566 Ga0207642_101045661 199
302 3300025900 Ga0207710_10117300 Ga0207710_101173002 199
303 3300025909 Ga0207705_10167439 Ga0207705_101674392 199
304 3300025909 Ga0207705_10405186 Ga0207705_104051862 199
305 3300025912 Ga0207707_10000002 Ga0207707_10000002895 199
306 3300025913 Ga0207695_10000003 Ga0207695_10000003124 199
307 3300025913 Ga0207695_10066906 Ga0207695_100669061 199
308 3300025913 Ga0207695_10404412 Ga0207695_104044122 199
309 3300025913 Ga0207695_10574967 Ga0207695_105749672 199
310 3300025913 Ga0207695_10879246 Ga0207695_108792461 199
311 3300025914 Ga0207671_10253114 Ga0207671_102531142 199
312 3300025914 Ga0207671_10487858 Ga0207671_104878582 199
313 3300025917 Ga0207660_10000765 Ga0207660_1000076514 199
314 3300025917 Ga0207660_10307729 Ga0207660_103077292 199
315 3300025919 Ga0207657_10162216 Ga0207657_101622162 199
316 3300025919 Ga0207657_10924070 Ga0207657_109240701 199
317 3300025920 Ga0207649_10096864 Ga0207649_100968643 199
318 3300025921 Ga0207652_10000641 Ga0207652_100006416 199
319 3300025921 Ga0207652_10085378 Ga0207652_100853783 199
320 3300025921 Ga0207652_10187196 Ga0207652_101871962 199
321 3300025924 Ga0207694_10000016 Ga0207694_10000016104 199
322 3300025924 Ga0207694_10107605 Ga0207694_101076052 199
323 3300025924 Ga0207694_10113500 Ga0207694_101135002 199
324 3300025932 Ga0207690_10028833 Ga0207690_100288334 199
325 3300025934 Ga0207686_10092230 Ga0207686_100922302 199
326 3300025938 Ga0207704_10082299 Ga0207704_100822992 199
327 3300025944 Ga0207661_10208406 Ga0207661_102084062 199
328 3300025949 Ga0207667_10000021 Ga0207667_10000021251 199
329 3300025949 Ga0207667_10166552 Ga0207667_101665522 199
330 3300025949 Ga0207667_10181204 Ga0207667_101812043 199
331 3300025949 Ga0207667_10397558 Ga0207667_103975582 199
332 3300025986 Ga0207658_10114329 Ga0207658_101143292 199
333 3300025986 Ga0207658_10609025 Ga0207658_106090252 199
334 3300026023 Ga0207677_10327937 Ga0207677_103279372 199
335 3300026041 Ga0207639_10059395 Ga0207639_100593952 199
336 3300026067 Ga0207678_10374515 Ga0207678_103745152 199
337 3300026078 Ga0207702_10201978 Ga0207702_102019782 199
338 3300026078 Ga0207702_10948447 Ga0207702_109484472 199
339 3300026095 Ga0207676_10384739 Ga0207676_103847392 199
340 3300026116 Ga0207674_10735467 Ga0207674_107354672 199
341 3300026142 Ga0207698_10001973 Ga0207698_100019739 199
342 3300026142 Ga0207698_10069692 Ga0207698_100696922 199
343 3300026142 Ga0207698_10514844 Ga0207698_105148441 199
344 3300031238 Ga0265332_10126372 Ga0265332_101263722 199
345 3300031247 Ga0265340_10203524 Ga0265340_102035242 199
346 3300031250 Ga0265331_10094359 Ga0265331_100943592 199
347 3300031344 Ga0265316_10124497 Ga0265316_101244972 199
348 3300031595 Ga0265313_10001956 Ga0265313_1000195613 199
349 3300031595 Ga0265313_10015676 Ga0265313_100156761 199
350 3300031711 Ga0265314_10014300 Ga0265314_100143003 199
351 3300031711 Ga0265314_10237664 Ga0265314_102376642 199
352 3300031712 Ga0265342_10061091 Ga0265342_100610912 199
353 3300031712 Ga0265342_10105293 Ga0265342_101052932 199
354 3300031730 Ga0307516_10015499 Ga0307516_100154994 199
355 3300031730 Ga0307516_10021243 Ga0307516_100212432 199
356 3300037418 Ga0395900_0203489 Ga0395900_0203489_1198_1833 199
357 3300038443 Ga0395901_0164279 Ga0395901_0164279_1274_1909 199
358 3300039437 Ga0436365_0537031 Ga0436365_0537031_2675_3292 199
359 3300039438 Ga0436360_1300782 Ga0436360_1300782_1117_1725 199
360 3300046536 Ga0495587_0087474 Ga0495587_0087474_550_1185 199
361 3300046539 Ga0495621_0104673 Ga0495621_0104673_52_675 199
362 3300046679 Ga0495623_0171233 Ga0495623_0171233_229_864 199
363 3300046809 Ga0495600_0291040 Ga0495600_0291040_125_760 199
364 3300049460 Ga0495682_0013050 Ga0495682_0013050_46_663 199
365 3300049568 Ga0501031_0000410 Ga0501031_0000410_3065_3700 199
366 3300049569 Ga0501032_0056610 Ga0501032_0056610_751_1386 199
367 3300049570 Ga0501033_0014372 Ga0501033_0014372_2559_3194 199
368 3300049570 Ga0501033_0029313 Ga0501033_0029313_2517_3122 199
369 3300049570 Ga0501033_0058715 Ga0501033_0058715_2128_2787 199
370 3300049571 Ga0501034_0019080 Ga0501034_0019080_3009_3644 199
371 3300049571 Ga0501034_0475746 Ga0501034_0475746_95_712 199
372 3300049571 Ga0501034_0697735 Ga0501034_0697735_45_674 199
373 3300049572 Ga0501036_0000803 Ga0501036_0000803_14566_15201 199
374 3300049572 Ga0501036_0359455 Ga0501036_0359455_75_695 199
375 3300049573 Ga0501037_0153107 Ga0501037_0153107_708_1325 199
376 3300049574 Ga0501038_0012808 Ga0501038_0012808_4350_4985 199
377 3300049574 Ga0501038_0085671 Ga0501038_0085671_139_768 199
378 3300049575 Ga0501039_0000235 Ga0501039_0000235_2580_3215 199
379 3300049579 Ga0501043_0032612 Ga0501043_0032612_1166_1801 199
380 3300049579 Ga0501043_0216432 Ga0501043_0216432_256_885 199
381 3300049580 Ga0501046_0003636 Ga0501046_0003636_7857_8492 199
382 3300049580 Ga0501046_0258835 Ga0501046_0258835_49_678 199
383 3300049580 Ga0501046_0476884 Ga0501046_0476884_57_665 199
384 3300049581 Ga0501047_0022186 Ga0501047_0022186_954_1571 199
385 3300049581 Ga0501047_0029038 Ga0501047_0029038_1387_2004 199
386 3300049581 Ga0501047_0033123 Ga0501047_0033123_3188_3823 199
387 3300049581 Ga0501047_0045566 Ga0501047_0045566_1985_2593 199
388 3300049581 Ga0501047_0081559 Ga0501047_0081559_1511_2128 199
389 3300049581 Ga0501047_0109371 Ga0501047_0109371_1262_1891 199
390 3300049581 Ga0501047_0327218 Ga0501047_0327218_208_828 199
391 3300049582 Ga0501048_0015256 Ga0501048_0015256_3601_4236 199
392 3300049585 Ga0501069_0001097 Ga0501069_0001097_5709_6344 199
393 3300049586 Ga0501070_0020041 Ga0501070_0020041_4222_4857 199
394 3300049588 Ga0501072_0078728 Ga0501072_0078728_1695_2330 199
395 3300049589 Ga0501073_0014772 Ga0501073_0014772_5009_5644 199
396 3300049590 Ga0501074_0004276 Ga0501074_0004276_751_1386 199
397 3300049592 Ga0501076_0215481 Ga0501076_0215481_750_1385 199
398 3300049742 Ga0501080_0038098 Ga0501080_0038098_251_859 199
399 3300049742 Ga0501080_0039023 Ga0501080_0039023_3725_4360 199
400 3300049744 Ga0501083_0001635 Ga0501083_0001635_5886_6521 199
401 3300049822 Ga0501035_0010456 Ga0501035_0010456_6408_7025 199
402 3300049822 Ga0501035_0054884 Ga0501035_0054884_2289_2906 199
403 3300049822 Ga0501035_0072023 Ga0501035_0072023_856_1461 199
404 3300049822 Ga0501035_0095431 Ga0501035_0095431_576_1196 199
405 3300049822 Ga0501035_0137723 Ga0501035_0137723_485_1114 199
406 3300049823 Ga0501044_0004024 Ga0501044_0004024_4114_4731 199
407 3300049823 Ga0501044_0117807 Ga0501044_0117807_1004_1633 199
408 3300049823 Ga0501044_0165706 Ga0501044_0165706_1024_1629 199
409 3300049823 Ga0501044_0391794 Ga0501044_0391794_278_898 199
410 3300049823 Ga0501044_0596597 Ga0501044_0596597_78_698 199
411 3300049824 Ga0501045_0005701 Ga0501045_0005701_5574_6209 199
412 3300053118 Ga0500594_0096111 Ga0500594_0096111_225_833 199
413 3300053139 Ga0500568_0120068 Ga0500568_0120068_112_720 199
414 3300053730 Ga0500645_048488 Ga0500645_048488_564_1172 199
415 3300054114 Ga0501084_0005999 Ga0501084_0005999_1166_1801 199
416 3300005329 Ga0070683_100113202 Ga0070683_1001132022 200
417 3300005456 Ga0070678_100021172 Ga0070678_1000211723 200
418 3300005547 Ga0070693_100068251 Ga0070693_1000682512 200
419 3300006358 Ga0068871_100859948 Ga0068871_1008599481 200
420 3300006881 Ga0068865_100884994 Ga0068865_1008849942 200
421 3300009098 Ga0105245_10516716 Ga0105245_105167162 200
422 3300009551 Ga0105238_10509109 Ga0105238_105091092 200
423 3300013308 Ga0157375_10801940 Ga0157375_108019401 200
424 3300014968 Ga0157379_10012674 Ga0157379_100126742 200
425 3300014968 Ga0157379_10032959 Ga0157379_100329592 200
426 3300025913 Ga0207695_10166417 Ga0207695_101664173 200
427 3300025928 Ga0207700_10868067 Ga0207700_108680671 200
428 3300025929 Ga0207664_10186830 Ga0207664_101868302 200
429 3300025944 Ga0207661_10154058 Ga0207661_101540582 200
430 3300026121 Ga0207683_10002526 Ga0207683_100025265 200
431 3300031241 Ga0265325_10000001 Ga0265325_10000001559 200
432 3300031241 Ga0265325_10182183 Ga0265325_101821832 200
433 3300031249 Ga0265339_10001144 Ga0265339_1000114419 200
434 3300031249 Ga0265339_10008403 Ga0265339_100084036 200
435 3300031250 Ga0265331_10010113 Ga0265331_100101136 200
436 3300031595 Ga0265313_10007643 Ga0265313_100076436 200
437 3300031711 Ga0265314_10002927 Ga0265314_1000292717 200
438 3300031712 Ga0265342_10019826 Ga0265342_100198265 200
439 3300046516 Ga0495628_0644640 Ga0495628_0644640_34_651 200
440 3300046529 Ga0495652_0552838 Ga0495652_0552838_150_767 200
441 3300046543 Ga0495645_0012628 Ga0495645_0012628_2760_3377 200
442 3300046678 Ga0495599_0249322 Ga0495599_0249322_309_926 200
443 3300049571 Ga0501034_0103932 Ga0501034_0103932_852_1475 200
444 3300049571 Ga0501034_0352250 Ga0501034_0352250_477_1094 200
445 3300049581 Ga0501047_0002517 Ga0501047_0002517_6912_7529 200
446 3300049583 Ga0501067_0002807 Ga0501067_0002807_5336_5953 200
447 3300049588 Ga0501072_0016842 Ga0501072_0016842_1199_1816 200
448 3300049589 Ga0501073_0261828 Ga0501073_0261828_284_901 200
449 3300049741 Ga0501079_0163170 Ga0501079_0163170_317_934 200
450 3300049742 Ga0501080_0297099 Ga0501080_0297099_91_708 200
451 3300053136 Ga0500559_0040981 Ga0500559_0040981_134_751 200
452 3300003214 JGI25165J46597_1000017 JGI25165J46597_10000172 201
453 3300005338 Ga0068868_100354888 Ga0068868_1003548882 201
454 3300005344 Ga0070661_100551020 Ga0070661_1005510202 201
455 3300005364 Ga0070673_100149849 Ga0070673_1001498492 201
456 3300005843 Ga0068860_100172504 Ga0068860_1001725043 201
457 3300006237 Ga0097621_100027207 Ga0097621_1000272073 201
458 3300006881 Ga0068865_100016163 Ga0068865_1000161634 201
459 3300009093 Ga0105240_10533729 Ga0105240_105337292 201
460 3300009098 Ga0105245_10259039 Ga0105245_102590392 201
461 3300009176 Ga0105242_10150717 Ga0105242_101507173 201
462 3300014969 Ga0157376_10200479 Ga0157376_102004792 201
463 3300017792 Ga0163161_10073210 Ga0163161_100732101 201
464 3300025231 Ga0207427_113809 Ga0207427_1138092 201
465 3300025261 Ga0209233_1000006 Ga0209233_1000006337 201
466 3300025899 Ga0207642_10233231 Ga0207642_102332312 201
467 3300025907 Ga0207645_10238016 Ga0207645_102380162 201
468 3300025913 Ga0207695_10305690 Ga0207695_103056902 201
469 3300025914 Ga0207671_10078020 Ga0207671_100780202 201
470 3300025931 Ga0207644_10082418 Ga0207644_100824183 201
471 3300025934 Ga0207686_10043644 Ga0207686_100436443 201
472 3300025938 Ga0207704_10060808 Ga0207704_100608082 201
473 3300025944 Ga0207661_10438601 Ga0207661_104386012 201
474 3300025960 Ga0207651_10113728 Ga0207651_101137282 201
475 3300025986 Ga0207658_10129345 Ga0207658_101293453 201
476 3300026023 Ga0207677_10053048 Ga0207677_100530482 201
477 3300026035 Ga0207703_10018894 Ga0207703_100188943 201
478 3300026095 Ga0207676_10122979 Ga0207676_101229793 201
479 3300028381 Ga0268264_10647793 Ga0268264_106477932 201
480 3300031240 Ga0265320_10000179 Ga0265320_1000017953 201
481 3300031241 Ga0265325_10006847 Ga0265325_100068476 201
482 3300031247 Ga0265340_10001732 Ga0265340_100017326 201
483 3300031249 Ga0265339_10113777 Ga0265339_101137772 201
484 3300031595 Ga0265313_10164676 Ga0265313_101646762 201
485 3300031730 Ga0307516_10140957 Ga0307516_101409572 201
486 3300044706 Ga0466964_0055136 Ga0466964_0055136_955_1581 201
487 3300046535 Ga0495586_0294349 Ga0495586_0294349_202_822 201
488 3300046663 Ga0495635_0450712 Ga0495635_0450712_49_666 201
489 3300047320 Ga0495672_0198516 Ga0495672_0198516_85_708 201
490 3300047469 Ga0495673_0119168 Ga0495673_0119168_21_635 201
491 3300049581 Ga0501047_0336791 Ga0501047_0336791_130_747 201
492 3300049823 Ga0501044_0061197 Ga0501044_0061197_2121_2738 201
493 3300053146 Ga0500588_0192532 Ga0500588_0192532_18_641 201

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01195

Pept_tRNA_hydro

Peptidyl-tRNA hydrolase

24

205

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ryb-assembly1.cif.gz_A crystal structure of the chloroplast group ii intron splicing factor crs2 0.95 3 177
6ix6-assembly1.cif.gz_A crystal structure of the complex of peptidyl-trna hydrolase with n-propanol at 1.43 a resolution 0.9495 5 186
3v2i-assembly1.cif.gz_A structure of a peptidyl-trna hydrolase (pth) from burkholderia thailandensis 0.9457 5 185
5imb-assembly1.cif.gz_A crystal structure of peptidyl-trna hydrolase mutant-n14d from vibrio cholerae 0.9454 3 186
2z2j-assembly1.cif.gz_A crystal structure of peptidyl-trna hydrolase from mycobacterium tuberculosis 0.9406 1 174
ID Description Score Start End Superfamily
5ektA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9289 1 186 3.40.50.1470
af_Q10LI6_46_183_3.40.50.1470 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9288 3 134 3.40.50.1470
4q55B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9226 4 185 3.40.50.1470
5zx8A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.921 3 177 3.40.50.1470
4ylyA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9208 5 186 3.40.50.1470
ID Description Score Start End GO Terms
AF-A0A434SHI8-F1-model_v4 Peptidyl-tRNA hydrolase (EC 3.1.1.29) 0.9885 5 179 GO:0004045
AF-A0A0Q4FF18-F1-model_v4 Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) 0.9858 5 191 GO:0004045
GO:0005737
GO:0006412
AF-A0A257PW60-F1-model_v4 peptidyl-tRNA hydrolase (EC 3.1.1.29) 0.9851 5 178 GO:0004045
AF-A0A420WJN6-F1-model_v4 Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) 0.9841 5 189 GO:0004045
GO:0005737
GO:0006412
AF-A0A7C1P4V1-F1-model_v4 Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) 0.9834 5 154 GO:0004045
GO:0005737
GO:0006412

Feature Viewer

pLDDT pTM Quality
92.88 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map