F454294

General Info

Members Datasets Scaffolds Average Seq Length
492 317 458 210

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0016980|Ga0395899_0016980_4362_5063
Length 216
Sequence MLDLRWKHRAVARAGRPSFRFAALAVSALMLSGCGGGSMFGGTQASQDSPSLSSRFSQLFGSNSQPATTAVTIRSGASTYAVGAPGKEATGNDLRYQATIVRTARDCTLNDGQVTARIGIEGRVIVGPAGAPASVEVPLRIAVVQSGVGEEKTIFTKAYRTTVTMQGDSTMSFSLVAEDVVYPAPSAAVGDSYVFYIGFDPQALRPEPRRRSHRKR

Samples

Sample ID Description Type Environment
1 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
2 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
3 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
4 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
5 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
6 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
7 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
8 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
9 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
10 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
11 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
12 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
13 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
14 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
15 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
16 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
17 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
18 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
19 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
20 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
21 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
22 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
23 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
40 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
73 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
74 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
75 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
76 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
77 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
78 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
79 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
80 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
81 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
82 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
85 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
91 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
92 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
93 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
105 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
117 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
167 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
168 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
169 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
173 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
174 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
175 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
176 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
177 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
178 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
179 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
180 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
181 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
182 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
183 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
184 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
185 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
186 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
187 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
188 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
189 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
190 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
191 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
192 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
193 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
194 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
195 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
196 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
197 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
198 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
199 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
200 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
201 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
202 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
203 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
204 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
205 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
206 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
207 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
208 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
209 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
210 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
211 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
212 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
213 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
214 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
215 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
216 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
217 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
218 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
219 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
220 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
221 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
222 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
223 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
224 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
225 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
226 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
227 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
228 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
229 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
230 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
231 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
232 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
233 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
234 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
235 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
236 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
237 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
238 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
239 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
240 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
241 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
242 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
243 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
244 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
245 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
246 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
247 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
248 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
249 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
250 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
251 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
252 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
253 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
254 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
261 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
262 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
263 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
264 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
265 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
266 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
267 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
269 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
270 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
271 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
272 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
273 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
274 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
275 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
276 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
277 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
278 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
279 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
280 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
281 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
282 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
283 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
284 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
285 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
286 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
287 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
288 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
289 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
290 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
291 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
292 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
293 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
294 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
295 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
296 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
297 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
298 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
299 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
300 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
301 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
302 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
303 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
304 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
305 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
306 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
307 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
308 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
309 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
310 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
311 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
312 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
313 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
314 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
315 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
316 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
317 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.66
Metatranscriptomes 0
Isolates 6.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.2
Nodule 6.1
Rhizoplane 5.69
Rhizosphere 68.9
Stem 0
Stem Tuber 0
Unclassified 7.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10003994 3300003215 Bacteria 8063
2 Ga0070658_10059664 3300005327 Bacteria 3107
3 Ga0070658_10231797 3300005327 Bacteria 1563
4 Ga0070683_100069952 3300005329 Bacteria 3273
5 Ga0070690_100060089 3300005330 Bacteria 2445
6 Ga0068869_100250776 3300005334 Bacteria 1413
7 Ga0068869_100332593 3300005334 Bacteria 1234
8 Ga0070682_100021957 3300005337 Bacteria 3773
9 Ga0070682_100423025 3300005337 Bacteria 1013
10 Ga0068868_100011153 3300005338 Bacteria 6543
11 Ga0068868_100088304 3300005338 Bacteria 2495
12 Ga0070660_100001273 3300005339 Bacteria 17200
13 Ga0070661_100065195 3300005344 Bacteria 2676
14 Ga0070661_100066992 3300005344 Bacteria 2639
15 Ga0070668_100249018 3300005347 Bacteria 1474
16 Ga0070668_100328877 3300005347 Bacteria 1288
17 Ga0070668_100378959 3300005347 Bacteria 1203
18 Ga0070669_100048887 3300005353 Bacteria 3088
19 Ga0070671_100523178 3300005355 Bacteria 1021
20 Ga0070671_100799545 3300005355 Bacteria 821
21 Ga0070674_100576186 3300005356 Bacteria 948
22 Ga0070673_100162224 3300005364 Bacteria 1902
23 Ga0070688_100523617 3300005365 Bacteria 898
24 Ga0070659_100252581 3300005366 Bacteria 1462
25 Ga0070659_100678093 3300005366 Bacteria 890
26 Ga0070703_10023738 3300005406 Bacteria 1808
27 Ga0070709_10195067 3300005434 Bacteria 1431
28 Ga0070700_100020038 3300005441 Bacteria 3868
29 Ga0070694_100075569 3300005444 Bacteria 2330
30 Ga0070663_100034674 3300005455 Bacteria 3496
31 Ga0070663_100184180 3300005455 Bacteria 1622
32 Ga0070663_100238823 3300005455 Bacteria 1433
33 Ga0070678_100015032 3300005456 Bacteria 4904
34 Ga0070678_100037737 3300005456 Bacteria 3395
35 Ga0070678_100122294 3300005456 Bacteria 2054
36 Ga0070678_100331057 3300005456 Bacteria 1303
37 Ga0070681_10002300 3300005458 Bacteria 17486
38 Ga0070681_10056597 3300005458 Bacteria 3902
39 Ga0068867_100085834 3300005459 Bacteria 2380
40 Ga0068867_100450451 3300005459 Bacteria 1096
41 Ga0070706_100700063 3300005467 Bacteria 940
42 Ga0070699_100071253 3300005518 Bacteria 3022
43 Ga0070679_100030870 3300005530 Bacteria 5294
44 Ga0070679_100158656 3300005530 Bacteria 2236
45 Ga0070684_100141140 3300005535 Bacteria 2179
46 Ga0070697_100067843 3300005536 Bacteria 2919
47 Ga0068853_100005373 3300005539 Bacteria 10031
48 Ga0068853_100036024 3300005539 Bacteria 4205
49 Ga0068853_100076145 3300005539 Bacteria 2929
50 Ga0068853_100641338 3300005539 Bacteria 1011
51 Ga0070672_100634354 3300005543 Bacteria 932
52 Ga0070686_100086379 3300005544 Bacteria 2088
53 Ga0070696_100073267 3300005546 Bacteria 2413
54 Ga0070693_100277185 3300005547 Bacteria 1122
55 Ga0070665_100048597 3300005548 Bacteria 4258
56 Ga0070665_100062798 3300005548 Bacteria 3724
57 Ga0070665_100070223 3300005548 Bacteria 3509
58 Ga0070665_100082821 3300005548 Bacteria 3213
59 Ga0070665_100140823 3300005548 Bacteria 2415
60 Ga0070665_100396164 3300005548 Bacteria 1388
61 Ga0068855_100005358 3300005563 Bacteria 15645
62 Ga0068855_100044590 3300005563 Bacteria 5248
63 Ga0070664_100183552 3300005564 Bacteria 1861
64 Ga0068854_100210869 3300005578 Bacteria 1532
65 Ga0070702_100080093 3300005615 Bacteria 1953
66 Ga0070702_100454386 3300005615 Bacteria 930
67 Ga0068852_100103263 3300005616 Bacteria 2578
68 Ga0068852_100145672 3300005616 Bacteria 2197
69 Ga0068859_100231938 3300005617 Bacteria 1934
70 Ga0068859_100427707 3300005617 Bacteria 1420
71 Ga0068864_100176927 3300005618 Bacteria 1948
72 Ga0068864_100202594 3300005618 Bacteria 1824
73 Ga0068864_100839496 3300005618 Bacteria 905
74 Ga0068866_10088355 3300005718 Bacteria 1682
75 Ga0068866_10098244 3300005718 Bacteria 1610
76 Ga0068861_100196198 3300005719 Bacteria 1691
77 Ga0068861_100665566 3300005719 Bacteria 963
78 Ga0068851_10009508 3300005834 Bacteria 4523
79 Ga0068851_10052276 3300005834 Bacteria 2077
80 Ga0068851_10374621 3300005834 Bacteria 833
81 Ga0068863_100545553 3300005841 Bacteria 1144
82 Ga0068858_100609314 3300005842 Bacteria 1059
83 Ga0068858_100776506 3300005842 Bacteria 934
84 Ga0068860_100169048 3300005843 Bacteria 2111
85 Ga0068860_100240872 3300005843 Bacteria 1759
86 Ga0068860_100340110 3300005843 Bacteria 1475
87 Ga0068862_100139939 3300005844 Bacteria 2147
88 Ga0068862_100170299 3300005844 Bacteria 1949
89 Ga0068862_100494017 3300005844 Bacteria 1160
90 Ga0068862_100710265 3300005844 Bacteria 974
91 Ga0081455_10010629 3300005937 Bacteria 9315
92 Ga0081455_10109991 3300005937 Bacteria 2192
93 Ga0081538_10009617 3300005981 Bacteria 8042
94 Ga0081538_10089241 3300005981 Bacteria 1601
95 Ga0081540_1001861 3300005983 Bacteria 17661
96 Ga0081540_1013564 3300005983 Bacteria 5289
97 Ga0075365_10197691 3300006038 Bacteria 1408
98 Ga0075365_10392852 3300006038 Bacteria 979
99 Ga0075363_100054319 3300006048 Bacteria 2142
100 Ga0075364_10107079 3300006051 Bacteria 1863
101 Ga0075364_10124416 3300006051 Bacteria 1728
102 Ga0070716_100104884 3300006173 Bacteria 1741
103 Ga0070716_100472786 3300006173 Bacteria 919
104 Ga0070712_100026520 3300006175 Bacteria 3861
105 Ga0075362_10091768 3300006177 Bacteria 1410
106 Ga0075367_10170484 3300006178 Bacteria 1356
107 Ga0075366_10072355 3300006195 Bacteria 2054
108 Ga0075366_10299535 3300006195 Bacteria 983
109 Ga0097621_100226381 3300006237 Bacteria 1631
110 Ga0075370_10053511 3300006353 Bacteria 2291
111 Ga0068871_100083955 3300006358 Bacteria 2642
112 Ga0075434_100174976 3300006871 Bacteria 2166
113 Ga0075429_100223331 3300006880 Bacteria 1650
114 Ga0068865_100015653 3300006881 Bacteria 4839
115 Ga0068865_100278115 3300006881 Bacteria 1332
116 Ga0068865_100560467 3300006881 Bacteria 961
117 Ga0097620_100231939 3300006931 Bacteria 1934
118 Ga0097620_100427693 3300006931 Bacteria 1420
119 Ga0099824_1015040 3300006942 Bacteria 7478
120 Ga0099822_1010518 3300006943 Bacteria 11468
121 Ga0075435_100021255 3300007076 Bacteria 4987
122 Ga0105250_10014308 3300009092 Bacteria 3263
123 Ga0105240_10320608 3300009093 Bacteria 1767
124 Ga0105245_10100772 3300009098 Bacteria 2672
125 Ga0105245_10506177 3300009098 Bacteria 1224
126 Ga0114129_10040150 3300009147 Bacteria 6597
127 Ga0114129_11227592 3300009147 Bacteria 932
128 Ga0105243_10027662 3300009148 Bacteria 4347
129 Ga0105243_10911253 3300009148 Bacteria 875
130 Ga0105242_10036976 3300009176 Bacteria 3920
131 Ga0105248_10102575 3300009177 Bacteria 3225
132 Ga0105248_10356795 3300009177 Bacteria 1646
133 Ga0105237_10020603 3300009545 Bacteria 6795
134 Ga0105237_10438618 3300009545 Bacteria 1312
135 Ga0105238_10004261 3300009551 Bacteria 14208
136 Ga0105238_10202754 3300009551 Bacteria 1959
137 Ga0105238_10269960 3300009551 Bacteria 1681
138 Ga0105238_10291049 3300009551 Bacteria 1615
139 Ga0105239_10320404 3300010375 Bacteria 1748
140 Ga0105239_10339080 3300010375 Bacteria 1696
141 Ga0105239_10671519 3300010375 Bacteria 1184
142 Ga0105246_10041285 3300011119 Bacteria 3117
143 Ga0105246_10200517 3300011119 Bacteria 1551
144 Ga0105246_10490969 3300011119 Bacteria 1041
145 Ga0157373_10066140 3300013100 Bacteria 2558
146 Ga0157370_10079923 3300013104 Bacteria 3079
147 Ga0157370_10117750 3300013104 Bacteria 2481
148 Ga0157370_10203042 3300013104 Bacteria 1838
149 Ga0157369_10019281 3300013105 Bacteria 7631
150 Ga0157369_10075325 3300013105 Bacteria 3619
151 Ga0157374_10031569 3300013296 Bacteria 4816
152 Ga0157374_11093085 3300013296 Bacteria 818
153 Ga0163162_10046887 3300013306 Bacteria 4332
154 Ga0163162_10052853 3300013306 Bacteria 4081
155 Ga0163162_11038605 3300013306 Bacteria 927
156 Ga0157372_11491101 3300013307 Bacteria 779
157 Ga0157372_11537174 3300013307 Bacteria 766
158 Ga0157375_10008463 3300013308 Bacteria 9010
159 Ga0163163_10155735 3300014325 Bacteria 2329
160 Ga0163163_10384082 3300014325 Bacteria 1462
161 Ga0163163_10425528 3300014325 Bacteria 1387
162 Ga0157380_10452792 3300014326 Bacteria 1233
163 Ga0157379_10107985 3300014968 Bacteria 2499
164 Ga0157379_10158744 3300014968 Bacteria 2041
165 Ga0157379_11074232 3300014968 Bacteria 770
166 Ga0157376_10005234 3300014969 Bacteria 9057
167 Ga0157376_10467364 3300014969 Bacteria 1234
168 Ga0163161_10054089 3300017792 Bacteria 2913
169 Ga0163161_10721588 3300017792 Bacteria 831
170 Ga0163161_10793793 3300017792 Bacteria 795
171 Ga0209758_1002609 3300025297 Bacteria 17979
172 Ga0209758_1019604 3300025297 Bacteria 3252
173 Ga0207653_10003808 3300025885 Bacteria 4748
174 Ga0207692_10448178 3300025898 Bacteria 812
175 Ga0207710_10063204 3300025900 Bacteria 1684
176 Ga0207688_10016649 3300025901 Bacteria 3991
177 Ga0207688_10074489 3300025901 Bacteria 1931
178 Ga0207680_10331433 3300025903 Bacteria 1066
179 Ga0207705_10088792 3300025909 Bacteria 2261
180 Ga0207705_10123193 3300025909 Bacteria 1925
181 Ga0207705_10335198 3300025909 Bacteria 1164
182 Ga0207654_10047544 3300025911 Bacteria 2452
183 Ga0207707_10001937 3300025912 Bacteria 18825
184 Ga0207695_10262880 3300025913 Bacteria 1623
185 Ga0207671_10415571 3300025914 Bacteria 1070
186 Ga0207693_10045819 3300025915 Bacteria 3436
187 Ga0207663_10011973 3300025916 Bacteria 4674
188 Ga0207660_10002941 3300025917 Bacteria 11135
189 Ga0207662_10340778 3300025918 Bacteria 1004
190 Ga0207657_10001268 3300025919 Bacteria 26929
191 Ga0207657_10006639 3300025919 Bacteria 11976
192 Ga0207657_10247785 3300025919 Bacteria 1421
193 Ga0207657_10301192 3300025919 Bacteria 1270
194 Ga0207649_10089883 3300025920 Bacteria 2008
195 Ga0207649_10158150 3300025920 Bacteria 1568
196 Ga0207652_10001009 3300025921 Bacteria 25962
197 Ga0207652_10182467 3300025921 Bacteria 1886
198 Ga0207652_10209178 3300025921 Bacteria 1756
199 Ga0207681_10297866 3300025923 Bacteria 1275
200 Ga0207694_10005039 3300025924 Bacteria 10219
201 Ga0207694_10149529 3300025924 Bacteria 1881
202 Ga0207694_10560006 3300025924 Bacteria 960
203 Ga0207687_10028927 3300025927 Bacteria 3725
204 Ga0207687_10049173 3300025927 Bacteria 2931
205 Ga0207687_10061296 3300025927 Bacteria 2656
206 Ga0207644_10822298 3300025931 Bacteria 777
207 Ga0207690_10162530 3300025932 Bacteria 1666
208 Ga0207706_10087558 3300025933 Bacteria 2739
209 Ga0207709_10070269 3300025935 Bacteria 2220
210 Ga0207709_10157456 3300025935 Bacteria 1580
211 Ga0207669_10004480 3300025937 Bacteria 6157
212 Ga0207669_10078473 3300025937 Bacteria 2104
213 Ga0207669_10475353 3300025937 Bacteria 995
214 Ga0207704_10546070 3300025938 Bacteria 941
215 Ga0207704_10626181 3300025938 Bacteria 884
216 Ga0207665_10031648 3300025939 Bacteria 3501
217 Ga0207691_10024728 3300025940 Bacteria 5647
218 Ga0207691_10505133 3300025940 Bacteria 1027
219 Ga0207711_10168389 3300025941 Bacteria 1987
220 Ga0207689_10237757 3300025942 Bacteria 1505
221 Ga0207689_10595226 3300025942 Bacteria 930
222 Ga0207661_10104970 3300025944 Bacteria 2380
223 Ga0207679_10074372 3300025945 Bacteria 2574
224 Ga0207667_10045105 3300025949 Bacteria 4669
225 Ga0207667_10056584 3300025949 Bacteria 4119
226 Ga0207667_10142266 3300025949 Bacteria 2470
227 Ga0207712_10034939 3300025961 Bacteria 3410
228 Ga0207668_10019194 3300025972 Bacteria 4315
229 Ga0207668_10037062 3300025972 Bacteria 3260
230 Ga0207640_10362842 3300025981 Bacteria 1168
231 Ga0207640_10714615 3300025981 Bacteria 860
232 Ga0207640_10873158 3300025981 Bacteria 784
233 Ga0207658_10298896 3300025986 Bacteria 1386
234 Ga0207658_10955506 3300025986 Bacteria 781
235 Ga0207677_10096423 3300026023 Bacteria 2164
236 Ga0207703_10092523 3300026035 Bacteria 2545
237 Ga0207703_10193062 3300026035 Bacteria 1805
238 Ga0207703_10269871 3300026035 Bacteria 1541
239 Ga0207639_10053848 3300026041 Bacteria 3072
240 Ga0207639_10239330 3300026041 Bacteria 1577
241 Ga0207639_10694017 3300026041 Bacteria 944
242 Ga0207639_10741678 3300026041 Bacteria 913
243 Ga0207678_10007923 3300026067 Bacteria 9364
244 Ga0207678_10008515 3300026067 Bacteria 9040
245 Ga0207678_10280032 3300026067 Bacteria 1431
246 Ga0207678_10483022 3300026067 Bacteria 1079
247 Ga0207708_10176170 3300026075 Bacteria 1696
248 Ga0207708_10564040 3300026075 Bacteria 961
249 Ga0207702_10618048 3300026078 Bacteria 1064
250 Ga0207648_10046685 3300026089 Bacteria 3797
251 Ga0207676_10158903 3300026095 Bacteria 1956
252 Ga0207676_11062121 3300026095 Bacteria 799
253 Ga0207674_10496087 3300026116 Bacteria 1180
254 Ga0207675_100158843 3300026118 Bacteria 2155
255 Ga0207675_100406629 3300026118 Bacteria 1342
256 Ga0207683_10104392 3300026121 Bacteria 2533
257 Ga0207698_10133900 3300026142 Bacteria 2123
258 Ga0209589_1000002 3300027357 Bacteria 708598
259 Ga0209489_100002 3300027361 Bacteria 708609
260 Ga0209700_100002 3300027363 Bacteria 708598
261 Ga0268266_10001826 3300028379 Bacteria 24057
262 Ga0268266_10042569 3300028379 Bacteria 3879
263 Ga0268266_10051078 3300028379 Bacteria 3548
264 Ga0268266_10149442 3300028379 Bacteria 2104
265 Ga0268265_10282669 3300028380 Bacteria 1485
266 Ga0268264_10225868 3300028381 Bacteria 1726
267 Ga0268264_10229068 3300028381 Bacteria 1715
268 Ga0307517_10000650 3300028786 Bacteria 59699
269 Ga0307517_10190184 3300028786 Bacteria 1305
270 Ga0307515_10090494 3300028794 Bacteria 3837
271 Ga0307515_10629050 3300028794 Bacteria 685
272 Ga0265332_10043774 3300031238 Bacteria 1932
273 Ga0265325_10008912 3300031241 Bacteria 5894
274 Ga0307513_10231157 3300031456 Bacteria 1662
275 Ga0307509_10206466 3300031507 Bacteria 1794
276 Ga0307408_100517154 3300031548 Bacteria 1048
277 Ga0265313_10149120 3300031595 Bacteria 1001
278 Ga0307508_10087687 3300031616 Bacteria 2696
279 Ga0265314_10126255 3300031711 Bacteria 1602
280 Ga0265342_10055031 3300031712 Bacteria 2363
281 Ga0307516_10059702 3300031730 Bacteria 3708
282 Ga0307516_10273394 3300031730 Bacteria 1374
283 Ga0307405_10690247 3300031731 Bacteria 844
284 Ga0307410_10315402 3300031852 Bacteria 1239
285 Ga0307406_10127287 3300031901 Bacteria 1782
286 Ga0307406_10402682 3300031901 Bacteria 1085
287 Ga0307407_10357235 3300031903 Bacteria 1036
288 Ga0307412_10201909 3300031911 Bacteria 1510
289 Ga0307412_10203947 3300031911 Bacteria 1504
290 Ga0307412_10509008 3300031911 Bacteria 1004
291 Ga0307416_100879882 3300032002 Bacteria 995
292 Ga0307414_10269950 3300032004 Bacteria 1424
293 Ga0307411_10175856 3300032005 Bacteria 1620
294 Ga0307415_100060993 3300032126 Bacteria 2609
295 Ga0307415_100126245 3300032126 Bacteria 1929
296 Ga0307415_100707134 3300032126 Bacteria 910
297 Ga0307510_10039331 3300033180 Bacteria 5212
298 Ga0307510_10290115 3300033180 Bacteria 1102
299 Ga0373933_0000290 3300035724 Bacteria 32568
300 Ga0373933_0163855 3300035724 Bacteria 1413
301 Ga0373947_0829454 3300035725 Bacteria 631
302 Ga0373925_0626541 3300037068 Bacteria 886
303 Ga0395899_0016980 3300037312 Bacteria 5547
304 Ga0395900_0235024 3300037418 Bacteria 1841
305 Ga0395898_0102302 3300037466 Bacteria 2750
306 Ga0395898_0845117 3300037466 Bacteria 855
307 Ga0395905_0079778 3300037471 Bacteria 3068
308 Ga0395905_0104751 3300037471 Bacteria 2656
309 Ga0451787_624031 3300041441 Bacteria 854
310 Ga0451791_0831322 3300041451 Bacteria 1563
311 Ga0451793_1640344 3300041452 Bacteria 1021
312 Ga0451847_0907993 3300041503 Bacteria 1023
313 Ga0451849_0099554 3300041505 Bacteria 1054
314 Ga0495617_046180 3300046452 Bacteria 1451
315 Ga0495603_0027126 3300046455 Bacteria 3458
316 Ga0495590_0162903 3300046457 Bacteria 811
317 Ga0495591_051858 3300046458 Bacteria 1118
318 Ga0495629_0349937 3300046459 Bacteria 1008
319 Ga0495638_0276312 3300046460 Bacteria 914
320 Ga0495651_0515948 3300046462 Bacteria 763
321 Ga0495639_0141230 3300046475 Bacteria 1158
322 Ga0495639_0161775 3300046475 Bacteria 1084
323 Ga0495584_0127068 3300046491 Bacteria 1292
324 Ga0495584_0141331 3300046491 Bacteria 1222
325 Ga0495585_0186268 3300046492 Bacteria 1064
326 Ga0495596_0192302 3300046500 Bacteria 793
327 Ga0495616_0172402 3300046513 Bacteria 966
328 Ga0495620_0071966 3300046515 Bacteria 1412
329 Ga0495648_0001122 3300046524 Bacteria 27137
330 Ga0495640_0164664 3300046533 Bacteria 1419
331 Ga0495609_0232477 3300046538 Bacteria 763
332 Ga0495621_0009907 3300046539 Bacteria 2909
333 Ga0495597_0040364 3300046542 Bacteria 2086
334 Ga0495622_0035383 3300046557 Bacteria 2329
335 Ga0495633_0037623 3300046558 Bacteria 2314
336 Ga0495633_0274345 3300046558 Bacteria 767
337 Ga0495656_0035143 3300046615 Bacteria 2057
338 Ga0495656_0449735 3300046615 Bacteria 678
339 Ga0495668_0066300 3300046616 Bacteria 1986
340 Ga0495669_0200657 3300046684 Bacteria 953
341 Ga0495649_0358808 3300046694 Bacteria 736
342 Ga0495581_0049990 3300047315 Bacteria 2415
343 Ga0495683_0145512 3300047323 Bacteria 1107
344 Ga0495681_0099423 3300047470 Bacteria 1274
345 Ga0495686_0146670 3300047472 Bacteria 1388
346 Ga0495686_0375574 3300047472 Bacteria 768
347 Ga0495626_0119381 3300048091 Bacteria 1135
348 Ga0496100_0468920 3300048903 Bacteria 967
349 Ga0496101_0012874 3300048904 Bacteria 5595
350 Ga0496102_0001228 3300048905 Bacteria 23201
351 Ga0496102_0204378 3300048905 Bacteria 1862
352 Ga0496102_0385818 3300048905 Bacteria 1318
353 Ga0496102_0656436 3300048905 Bacteria 972
354 Ga0496103_0018583 3300048906 Bacteria 4170
355 Ga0496103_0404661 3300048906 Bacteria 877
356 Ga0496104_0040847 3300048907 Bacteria 4348
357 Ga0496104_0275264 3300048907 Bacteria 1596
358 Ga0496104_0486103 3300048907 Bacteria 1146
359 Ga0496106_0241652 3300048909 Bacteria 1443
360 Ga0496107_0054959 3300048910 Bacteria 2875
361 Ga0496107_0333063 3300048910 Bacteria 1129
362 Ga0496108_0597183 3300048911 Bacteria 962
363 Ga0496109_0007384 3300048912 Bacteria 9302
364 Ga0496109_0141907 3300048912 Bacteria 2246
365 Ga0496110_0070824 3300048913 Bacteria 3090
366 Ga0496110_0314531 3300048913 Bacteria 1426
367 Ga0496112_0057272 3300048915 Bacteria 3836
368 Ga0496113_0006192 3300048916 Bacteria 7557
369 Ga0496113_0134083 3300048916 Bacteria 1945
370 Ga0496115_0002636 3300048918 Bacteria 12885
371 Ga0496115_0728692 3300048918 Bacteria 777
372 Ga0496117_0285293 3300048920 Bacteria 882
373 Ga0496119_0311551 3300048922 Bacteria 773
374 Ga0496121_0097950 3300048924 Bacteria 2271
375 Ga0496121_0145335 3300048924 Bacteria 1753
376 Ga0496121_0193283 3300048924 Bacteria 1457
377 Ga0496124_0334132 3300048927 Bacteria 1079
378 Ga0496125_0291351 3300048928 Bacteria 1005
379 Ga0496125_0324592 3300048928 Bacteria 931
380 Ga0496126_0008705 3300048929 Bacteria 10897
381 Ga0496126_0008925 3300048929 Bacteria 10735
382 Ga0496126_0012601 3300048929 Bacteria 8655
383 Ga0496126_0134975 3300048929 Bacteria 2129
384 Ga0496126_0248527 3300048929 Bacteria 1483
385 Ga0496126_0573574 3300048929 Bacteria 892
386 Ga0501032_0119528 3300049569 Bacteria 1742
387 Ga0501033_0061539 3300049570 Bacteria 2766
388 Ga0501033_0116363 3300049570 Bacteria 1942
389 Ga0501033_0140304 3300049570 Bacteria 1747
390 Ga0501034_0234973 3300049571 Bacteria 1781
391 Ga0501038_0224618 3300049574 Bacteria 1497
392 Ga0501046_0276309 3300049580 Bacteria 1231
393 Ga0501048_0062560 3300049582 Bacteria 2634
394 Ga0501067_0018214 3300049583 Bacteria 3889
395 Ga0501068_0066887 3300049584 Bacteria 2189
396 Ga0501071_0174250 3300049587 Bacteria 1611
397 Ga0501073_0016592 3300049589 Bacteria 5336
398 Ga0501074_0161187 3300049590 Bacteria 1602
399 Ga0501076_0177663 3300049592 Bacteria 1735
400 Ga0501079_0050138 3300049741 Bacteria 3223
401 Ga0501044_0072579 3300049823 Bacteria 3499
402 Ga0501044_0113202 3300049823 Bacteria 2720
403 Ga0501044_0508932 3300049823 Bacteria 1104
404 Ga0501044_1074398 3300049823 Bacteria 675
405 Ga0501045_0066892 3300049824 Bacteria 2638
406 nmdc:mga03683_132544_c1 3300050489 Bacteria 1116
407 nmdc:mga03683_158864_c1 3300050489 Bacteria 1023
408 nmdc:mga03n38_162530_c1 3300050490 Bacteria 1132
409 nmdc:mga03n38_319178_c1 3300050490 Bacteria 838
410 nmdc:mga00v17_211218_c1 3300050491 Bacteria 1256
411 nmdc:mga0yw44_255003_c1 3300050492 Bacteria 1168
412 nmdc:mga0yw44_6437_c1 3300050492 Bacteria 5677
413 nmdc:mga0k408_47483_c1 3300050493 Bacteria 2482
414 nmdc:mga06z11_14975_c1 3300050494 Bacteria 3450
415 nmdc:mga06z11_244557_c1 3300050494 Bacteria 1055
416 nmdc:mga07m45_102738_c1 3300050496 Bacteria 1642
417 nmdc:mga07m45_383958_c1 3300050496 Bacteria 816
418 nmdc:mga07m45_47905_c1 3300050496 Bacteria 2403
419 nmdc:mga05p37_100536_c1 3300050507 Bacteria 3562
420 nmdc:mga0qj67_1009807_c1 3300050509 Bacteria 652
421 nmdc:mga0n895_75518_c1 3300050512 Bacteria 3350
422 nmdc:mga0rr50_138245_c1 3300050513 Bacteria 1957
423 Ga0500610_0160935 3300053079 Bacteria 1117
424 Ga0500635_0007315 3300053080 Bacteria 2991
425 Ga0495655_0074096 3300053083 Bacteria 958
426 Ga0495655_0111726 3300053083 Bacteria 822
427 Ga0500651_0035523 3300053093 Bacteria 3141
428 Ga0500566_0000056 3300053094 Bacteria 53974
429 Ga0500640_000018 3300053095 Bacteria 24576
430 Ga0500641_0147811 3300053096 Bacteria 1015
431 Ga0500554_000460 3300053102 Bacteria 8536
432 Ga0500562_045173 3300053108 Bacteria 1174
433 Ga0500569_178149 3300053109 Bacteria 722
434 Ga0500572_000779 3300053111 Bacteria 10210
435 Ga0500591_023145 3300053115 Bacteria 3013
436 Ga0500594_0014012 3300053118 Bacteria 1915
437 Ga0500595_000476 3300053119 Bacteria 24760
438 Ga0500595_012514 3300053119 Bacteria 3278
439 Ga0500608_002139 3300053122 Bacteria 7093
440 Ga0500614_000537 3300053123 Bacteria 9752
441 Ga0500655_046255 3300053133 Bacteria 861
442 Ga0500658_0367184 3300053134 Bacteria 660
443 Ga0500559_0146462 3300053136 Bacteria 1107
444 Ga0500589_081666 3300053147 Bacteria 1442
445 Ga0500589_101049 3300053147 Bacteria 1252
446 Ga0500590_112289 3300053148 Bacteria 1291
447 Ga0500590_142522 3300053148 Bacteria 1093
448 Ga0500603_000072 3300053150 Bacteria 23238
449 Ga0500603_000078 3300053150 Bacteria 22308
450 Ga0500603_125678 3300053150 Bacteria 780
451 Ga0500630_002405 3300053159 Bacteria 9058
452 Ga0500634_0082107 3300053161 Bacteria 1658
453 Ga0500638_001417 3300053162 Bacteria 7498
454 Ga0500639_000093 3300053163 Bacteria 41781
455 Ga0500637_0000753 3300053178 Bacteria 12967
456 Ga0500637_0001580 3300053178 Bacteria 9750
457 Ga0500596_000938 3300053735 Bacteria 5815
458 Ga0500601_002313 3300053737 Bacteria 2050

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049823 Ga0501044_1074398 Ga0501044_1074398_49_663 175
2 3300049571 Ga0501034_0234973 Ga0501034_0234973_687_1385 182
3 3300009551 Ga0105238_10291049 Ga0105238_102910492 184
4 3300013100 Ga0157373_10066140 Ga0157373_100661403 184
5 3300013104 Ga0157370_10203042 Ga0157370_102030423 184
6 3300035724 Ga0373933_0163855 Ga0373933_0163855_320_1006 185
7 3300005578 Ga0068854_100210869 Ga0068854_1002108692 187
8 3300005616 Ga0068852_100103263 Ga0068852_1001032632 187
9 3300005834 Ga0068851_10009508 Ga0068851_100095084 187
10 3300009545 Ga0105237_10020603 Ga0105237_100206034 187
11 3300009551 Ga0105238_10004261 Ga0105238_1000426112 187
12 3300010375 Ga0105239_10320404 Ga0105239_103204042 187
13 3300013104 Ga0157370_10117750 Ga0157370_101177503 187
14 3300013105 Ga0157369_10019281 Ga0157369_1001928110 187
15 3300035725 Ga0373947_0829454 Ga0373947_0829454_34_621 188
16 3300037471 Ga0395905_0079778 Ga0395905_0079778_2396_3031 188
17 3300005456 Ga0070678_100015032 Ga0070678_1000150321 189
18 3300005834 Ga0068851_10052276 Ga0068851_100522761 189
19 3300011119 Ga0105246_10041285 Ga0105246_100412851 189
20 3300013296 Ga0157374_10031569 Ga0157374_100315694 189
21 3300026121 Ga0207683_10104392 Ga0207683_101043924 189
22 3300031238 Ga0265332_10043774 Ga0265332_100437741 189
23 3300031241 Ga0265325_10008912 Ga0265325_100089124 189
24 3300031595 Ga0265313_10149120 Ga0265313_101491201 189
25 3300031711 Ga0265314_10126255 Ga0265314_101262551 189
26 3300031712 Ga0265342_10055031 Ga0265342_100550313 189
27 3300046475 Ga0495639_0141230 Ga0495639_0141230_226_861 189
28 3300047323 Ga0495683_0145512 Ga0495683_0145512_34_609 189
29 3300050491 nmdc:mga00v17_211218_c1 nmdc:mga00v17_211218_c1_671_1246 189
30 3300050493 nmdc:mga0k408_47483_c1 nmdc:mga0k408_47483_c1_1893_2468 189
31 3300049580 Ga0501046_0276309 Ga0501046_0276309_126_791 190
32 3300005329 Ga0070683_100069952 Ga0070683_1000699523 191
33 3300005337 Ga0070682_100021957 Ga0070682_1000219574 191
34 3300005338 Ga0068868_100011153 Ga0068868_1000111535 191
35 3300005535 Ga0070684_100141140 Ga0070684_1001411403 191
36 3300005548 Ga0070665_100062798 Ga0070665_1000627983 191
37 3300005618 Ga0068864_100176927 Ga0068864_1001769271 191
38 3300005834 Ga0068851_10374621 Ga0068851_103746211 191
39 3300005842 Ga0068858_100776506 Ga0068858_1007765062 191
40 3300006173 Ga0070716_100472786 Ga0070716_1004727861 191
41 3300006881 Ga0068865_100560467 Ga0068865_1005604672 191
42 3300009098 Ga0105245_10100772 Ga0105245_101007722 191
43 3300013308 Ga0157375_10008463 Ga0157375_100084639 191
44 3300014325 Ga0163163_10155735 Ga0163163_101557353 191
45 3300014969 Ga0157376_10005234 Ga0157376_100052344 191
46 3300025920 Ga0207649_10158150 Ga0207649_101581502 191
47 3300025927 Ga0207687_10028927 Ga0207687_100289275 191
48 3300025938 Ga0207704_10626181 Ga0207704_106261811 191
49 3300025944 Ga0207661_10104970 Ga0207661_101049704 191
50 3300025981 Ga0207640_10714615 Ga0207640_107146151 191
51 3300026035 Ga0207703_10193062 Ga0207703_101930623 191
52 3300026041 Ga0207639_10741678 Ga0207639_107416781 191
53 3300026067 Ga0207678_10008515 Ga0207678_1000851510 191
54 3300026095 Ga0207676_11062121 Ga0207676_110621211 191
55 3300046459 Ga0495629_0349937 Ga0495629_0349937_171_845 191
56 3300048904 Ga0496101_0012874 Ga0496101_0012874_2320_2994 191
57 3300048905 Ga0496102_0001228 Ga0496102_0001228_8471_9145 191
58 3300048906 Ga0496103_0018583 Ga0496103_0018583_2887_3561 191
59 3300048907 Ga0496104_0040847 Ga0496104_0040847_3581_4255 191
60 3300048912 Ga0496109_0007384 Ga0496109_0007384_578_1252 191
61 3300048913 Ga0496110_0070824 Ga0496110_0070824_181_855 191
62 3300048915 Ga0496112_0057272 Ga0496112_0057272_2899_3573 191
63 3300048916 Ga0496113_0006192 Ga0496113_0006192_3480_4154 191
64 3300048918 Ga0496115_0002636 Ga0496115_0002636_1370_2044 191
65 3300053083 Ga0495655_0074096 Ga0495655_0074096_180_854 191
66 3300037068 Ga0373925_0626541 Ga0373925_0626541_270_863 192
67 3300041503 Ga0451847_0907993 Ga0451847_0907993_84_698 192
68 3300046533 Ga0495640_0164664 Ga0495640_0164664_635_1273 192
69 3300049570 Ga0501033_0061539 Ga0501033_0061539_382_1080 192
70 3300049823 Ga0501044_0113202 Ga0501044_0113202_1098_1796 192
71 3300037312 Ga0395899_0016980 Ga0395899_0016980_4362_5063 193
72 3300037418 Ga0395900_0235024 Ga0395900_0235024_793_1494 193
73 3300037466 Ga0395898_0102302 Ga0395898_0102302_1586_2287 193
74 3300049574 Ga0501038_0224618 Ga0501038_0224618_619_1242 193
75 3300009098 Ga0105245_10506177 Ga0105245_105061772 194
76 3300005455 Ga0070663_100184180 Ga0070663_1001841802 195
77 3300005458 Ga0070681_10056597 Ga0070681_100565974 195
78 3300005530 Ga0070679_100158656 Ga0070679_1001586561 195
79 3300025909 Ga0207705_10123193 Ga0207705_101231932 195
80 3300025919 Ga0207657_10001268 Ga0207657_1000126822 195
81 3300025921 Ga0207652_10182467 Ga0207652_101824672 195
82 3300025949 Ga0207667_10056584 Ga0207667_100565842 195
83 3300026041 Ga0207639_10694017 Ga0207639_106940172 195
84 3300049582 Ga0501048_0062560 Ga0501048_0062560_1744_2427 195
85 3300049583 Ga0501067_0018214 Ga0501067_0018214_3108_3791 195
86 3300049569 Ga0501032_0119528 Ga0501032_0119528_43_726 196
87 3300049570 Ga0501033_0116363 Ga0501033_0116363_973_1656 196
88 3300049584 Ga0501068_0066887 Ga0501068_0066887_334_1017 196
89 3300049589 Ga0501073_0016592 Ga0501073_0016592_3930_4613 196
90 3300049590 Ga0501074_0161187 Ga0501074_0161187_889_1572 196
91 3300049741 Ga0501079_0050138 Ga0501079_0050138_2318_3001 196
92 3300049823 Ga0501044_0508932 Ga0501044_0508932_23_706 196
93 3300049824 Ga0501045_0066892 Ga0501045_0066892_1740_2423 196
94 3300041505 Ga0451849_0099554 Ga0451849_0099554_352_975 197
95 3300009148 Ga0105243_10911253 Ga0105243_109112531 198
96 3300013105 Ga0157369_10075325 Ga0157369_100753253 198
97 3300013306 Ga0163162_10052853 Ga0163162_100528533 198
98 3300005983 Ga0081540_1001861 Ga0081540_100186115 200
99 3300006871 Ga0075434_100174976 Ga0075434_1001749762 201
100 3300031616 Ga0307508_10087687 Ga0307508_100876873 201
101 3300037466 Ga0395898_0845117 Ga0395898_0845117_121_765 201
102 3300005347 Ga0070668_100328877 Ga0070668_1003288772 202
103 3300014326 Ga0157380_10452792 Ga0157380_104527922 202
104 3300025909 Ga0207705_10335198 Ga0207705_103351982 202
105 3300025918 Ga0207662_10340778 Ga0207662_103407782 202
106 3300025932 Ga0207690_10162530 Ga0207690_101625302 202
107 3300026041 Ga0207639_10053848 Ga0207639_100538484 202
108 3300026067 Ga0207678_10483022 Ga0207678_104830222 202
109 3300031548 Ga0307408_100517154 Ga0307408_1005171541 202
110 3300031903 Ga0307407_10357235 Ga0307407_103572352 202
111 3300032005 Ga0307411_10175856 Ga0307411_101758561 202
112 3300046694 Ga0495649_0358808 Ga0495649_0358808_10_618 202
113 3300047472 Ga0495686_0375574 Ga0495686_0375574_53_733 202
114 3300050490 nmdc:mga03n38_319178_c1 nmdc:mga03n38_319178_c1_128_736 202
115 3300050492 nmdc:mga0yw44_255003_c1 nmdc:mga0yw44_255003_c1_549_1157 202
116 3300050496 nmdc:mga07m45_102738_c1 nmdc:mga07m45_102738_c1_51_659 202
117 3300053118 Ga0500594_0014012 Ga0500594_0014012_1010_1618 202
118 3300053119 Ga0500595_000476 Ga0500595_000476_21880_22524 202
119 3300053134 Ga0500658_0367184 Ga0500658_0367184_29_637 202
120 3300053147 Ga0500589_081666 Ga0500589_081666_773_1381 202
121 3300053147 Ga0500589_101049 Ga0500589_101049_289_897 202
122 3300053150 Ga0500603_125678 Ga0500603_125678_18_662 202
123 3300053162 Ga0500638_001417 Ga0500638_001417_1097_1741 202
124 3300053178 Ga0500637_0000753 Ga0500637_0000753_11299_11943 202
125 iso_pu_bacteria 2791355197 2793073302 202
126 3300009551 Ga0105238_10202754 Ga0105238_102027542 203
127 3300010375 Ga0105239_10671519 Ga0105239_106715192 203
128 3300013307 Ga0157372_11537174 Ga0157372_115371741 203
129 3300041452 Ga0451793_1640344 Ga0451793_1640344_271_888 203
130 iso_pu_bacteria 2904690495 2904695640 203
131 iso_pu_bacteria 2908756301 2908764108 203
132 3300009177 Ga0105248_10102575 Ga0105248_101025753 204
133 3300014968 Ga0157379_10107985 Ga0157379_101079853 204
134 3300025941 Ga0207711_10168389 Ga0207711_101683891 204
135 3300031456 Ga0307513_10231157 Ga0307513_102311572 204
136 iso_pu_bacteria 2513237145 2513917416 204
137 iso_pu_bacteria 2517572143 2517888037 204
138 iso_pu_bacteria 2524023228 2524535587 204
139 iso_pu_bacteria 2667528175 2671121171 204
140 iso_pu_bacteria 2728368998 2728753940 204
141 iso_pu_bacteria 2904699407 2904707962 204
142 iso_pu_bacteria 2906610324 2906612970 204
143 iso_pu_bacteria 2906635258 2906641089 204
144 iso_pu_bacteria 2906660503 2906665645 204
145 iso_pu_bacteria 2908739725 2908746127 204
146 iso_pu_bacteria 2935630451 2935634992 204
147 iso_pu_bacteria 2941507105 2941511729 204
148 iso_pu_bacteria 2941515067 2941519288 204
149 iso_pu_bacteria 2941523033 2941527588 204
150 iso_pu_bacteria 8006933436 8006935482 204
151 iso_pu_bacteria 8006973647 8006975410 204
152 iso_pu_bacteria 8019555841 8019563319 204
153 iso_pu_bacteria 8019565922 8019573398 204
154 3300005844 Ga0068862_100710265 Ga0068862_1007102652 205
155 3300017792 Ga0163161_10054089 Ga0163161_100540894 205
156 3300025981 Ga0207640_10362842 Ga0207640_103628421 205
157 3300026118 Ga0207675_100406629 Ga0207675_1004066291 205
158 3300046524 Ga0495648_0001122 Ga0495648_0001122_15862_16578 205
159 3300048929 Ga0496126_0008705 Ga0496126_0008705_7592_8278 205
160 iso_pu_bacteria 8056689827 8056694656 205
161 3300005327 Ga0070658_10059664 Ga0070658_100596643 206
162 3300005458 Ga0070681_10002300 Ga0070681_1000230018 206
163 3300005530 Ga0070679_100030870 Ga0070679_1000308704 206
164 3300005539 Ga0068853_100076145 Ga0068853_1000761455 206
165 3300005563 Ga0068855_100005358 Ga0068855_10000535816 206
166 3300009093 Ga0105240_10320608 Ga0105240_103206081 206
167 3300013104 Ga0157370_10079923 Ga0157370_100799232 206
168 3300025909 Ga0207705_10088792 Ga0207705_100887923 206
169 3300025913 Ga0207695_10262880 Ga0207695_102628803 206
170 3300025921 Ga0207652_10209178 Ga0207652_102091782 206
171 3300025949 Ga0207667_10142266 Ga0207667_101422663 206
172 3300025981 Ga0207640_10873158 Ga0207640_108731581 206
173 3300026041 Ga0207639_10239330 Ga0207639_102393303 206
174 3300050509 nmdc:mga0qj67_1009807_c1 nmdc:mga0qj67_1009807_c1_18_638 206
175 iso_pu_bacteria 2513237101 2513694441 206
176 iso_pu_bacteria 2874604998 2874607030 206
177 iso_pu_bacteria 8006994254 8006995276 206
178 3300031730 Ga0307516_10273394 Ga0307516_102733942 207
179 3300033180 Ga0307510_10290115 Ga0307510_102901152 207
180 3300041441 Ga0451787_624031 Ga0451787_624031_51_710 207
181 3300049570 Ga0501033_0140304 Ga0501033_0140304_268_966 207
182 3300049823 Ga0501044_0072579 Ga0501044_0072579_1639_2337 207
183 iso_pu_bacteria 2721755755 2723849071 207
184 iso_pu_bacteria 2791355199 2793079793 207
185 iso_pu_bacteria 2879110137 2879117138 207
186 iso_pu_bacteria 2889033259 2889034871 207
187 iso_pu_bacteria 2922361189 2922364701 207
188 iso_pu_bacteria 2922386360 2922391836 207
189 iso_pu_bacteria 8006964411 8006965029 207
190 iso_pu_bacteria 8006984368 8006988516 207
191 iso_pu_bacteria 8056673599 8056679229 207
192 3300005337 Ga0070682_100423025 Ga0070682_1004230252 208
193 3300005339 Ga0070660_100001273 Ga0070660_10000127316 208
194 3300005344 Ga0070661_100066992 Ga0070661_1000669922 208
195 3300005356 Ga0070674_100576186 Ga0070674_1005761861 208
196 3300005366 Ga0070659_100678093 Ga0070659_1006780931 208
197 3300005455 Ga0070663_100034674 Ga0070663_1000346743 208
198 3300005536 Ga0070697_100067843 Ga0070697_1000678432 208
199 3300005539 Ga0068853_100036024 Ga0068853_1000360246 208
200 3300005981 Ga0081538_10089241 Ga0081538_100892412 208
201 3300006038 Ga0075365_10197691 Ga0075365_101976912 208
202 3300006942 Ga0099824_1015040 Ga0099824_10150404 208
203 3300006943 Ga0099822_1010518 Ga0099822_101051810 208
204 3300009551 Ga0105238_10269960 Ga0105238_102699603 208
205 3300014968 Ga0157379_10158744 Ga0157379_101587443 208
206 3300025912 Ga0207707_10001937 Ga0207707_100019377 208
207 3300025917 Ga0207660_10002941 Ga0207660_1000294112 208
208 3300025919 Ga0207657_10006639 Ga0207657_1000663910 208
209 3300025921 Ga0207652_10001009 Ga0207652_1000100912 208
210 3300025924 Ga0207694_10005039 Ga0207694_100050392 208
211 3300025937 Ga0207669_10475353 Ga0207669_104753532 208
212 3300027357 Ga0209589_1000002 Ga0209589_1000002686 208
213 3300027361 Ga0209489_100002 Ga0209489_100002686 208
214 3300027363 Ga0209700_100002 Ga0209700_100002686 208
215 3300037471 Ga0395905_0104751 Ga0395905_0104751_1523_2164 208
216 3300046462 Ga0495651_0515948 Ga0495651_0515948_94_741 208
217 3300048905 Ga0496102_0656436 Ga0496102_0656436_286_918 208
218 3300048909 Ga0496106_0241652 Ga0496106_0241652_64_696 208
219 3300048910 Ga0496107_0054959 Ga0496107_0054959_980_1627 208
220 3300048911 Ga0496108_0597183 Ga0496108_0597183_193_825 208
221 3300048924 Ga0496121_0193283 Ga0496121_0193283_249_896 208
222 3300048929 Ga0496126_0008925 Ga0496126_0008925_9011_9676 208
223 3300048929 Ga0496126_0248527 Ga0496126_0248527_728_1375 208
224 3300053080 Ga0500635_0007315 Ga0500635_0007315_1008_1679 208
225 3300053094 Ga0500566_0000056 Ga0500566_0000056_4094_4732 208
226 3300053095 Ga0500640_000018 Ga0500640_000018_2939_3577 208
227 3300053102 Ga0500554_000460 Ga0500554_000460_3478_4149 208
228 3300053111 Ga0500572_000779 Ga0500572_000779_5705_6343 208
229 3300053115 Ga0500591_023145 Ga0500591_023145_513_1151 208
230 3300053122 Ga0500608_002139 Ga0500608_002139_3586_4224 208
231 3300053123 Ga0500614_000537 Ga0500614_000537_5007_5645 208
232 3300053136 Ga0500559_0146462 Ga0500559_0146462_261_899 208
233 3300053148 Ga0500590_112289 Ga0500590_112289_141_779 208
234 3300053150 Ga0500603_000072 Ga0500603_000072_18461_19132 208
235 3300053150 Ga0500603_000078 Ga0500603_000078_20725_21363 208
236 3300053159 Ga0500630_002405 Ga0500630_002405_4935_5573 208
237 3300053163 Ga0500639_000093 Ga0500639_000093_15968_16606 208
238 3300053178 Ga0500637_0001580 Ga0500637_0001580_5074_5745 208
239 3300053735 Ga0500596_000938 Ga0500596_000938_1315_1953 208
240 3300053737 Ga0500601_002313 Ga0500601_002313_60_698 208
241 3300005330 Ga0070690_100060089 Ga0070690_1000600893 209
242 3300005338 Ga0068868_100088304 Ga0068868_1000883041 209
243 3300005353 Ga0070669_100048887 Ga0070669_1000488873 209
244 3300005355 Ga0070671_100799545 Ga0070671_1007995451 209
245 3300005441 Ga0070700_100020038 Ga0070700_1000200382 209
246 3300005456 Ga0070678_100037737 Ga0070678_1000377373 209
247 3300005459 Ga0068867_100085834 Ga0068867_1000858341 209
248 3300005548 Ga0070665_100396164 Ga0070665_1003961642 209
249 3300005563 Ga0068855_100044590 Ga0068855_1000445904 209
250 3300005615 Ga0070702_100080093 Ga0070702_1000800931 209
251 3300005615 Ga0070702_100454386 Ga0070702_1004543861 209
252 3300005718 Ga0068866_10088355 Ga0068866_100883552 209
253 3300005719 Ga0068861_100196198 Ga0068861_1001961982 209
254 3300005843 Ga0068860_100240872 Ga0068860_1002408722 209
255 3300006173 Ga0070716_100104884 Ga0070716_1001048842 209
256 3300006175 Ga0070712_100026520 Ga0070712_1000265201 209
257 3300006881 Ga0068865_100015653 Ga0068865_1000156533 209
258 3300009148 Ga0105243_10027662 Ga0105243_100276624 209
259 3300009176 Ga0105242_10036976 Ga0105242_100369764 209
260 3300009177 Ga0105248_10356795 Ga0105248_103567951 209
261 3300010375 Ga0105239_10339080 Ga0105239_103390802 209
262 3300011119 Ga0105246_10490969 Ga0105246_104909692 209
263 3300013296 Ga0157374_11093085 Ga0157374_110930851 209
264 3300013306 Ga0163162_10046887 Ga0163162_100468871 209
265 3300017792 Ga0163161_10721588 Ga0163161_107215881 209
266 3300025898 Ga0207692_10448178 Ga0207692_104481781 209
267 3300025901 Ga0207688_10016649 Ga0207688_100166493 209
268 3300025915 Ga0207693_10045819 Ga0207693_100458196 209
269 3300025916 Ga0207663_10011973 Ga0207663_100119735 209
270 3300025919 Ga0207657_10247785 Ga0207657_102477852 209
271 3300025927 Ga0207687_10061296 Ga0207687_100612963 209
272 3300025931 Ga0207644_10822298 Ga0207644_108222981 209
273 3300025933 Ga0207706_10087558 Ga0207706_100875582 209
274 3300025935 Ga0207709_10070269 Ga0207709_100702693 209
275 3300025937 Ga0207669_10004480 Ga0207669_100044803 209
276 3300025938 Ga0207704_10546070 Ga0207704_105460702 209
277 3300025939 Ga0207665_10031648 Ga0207665_100316483 209
278 3300025940 Ga0207691_10024728 Ga0207691_100247281 209
279 3300025961 Ga0207712_10034939 Ga0207712_100349393 209
280 3300025972 Ga0207668_10037062 Ga0207668_100370624 209
281 3300026023 Ga0207677_10096423 Ga0207677_100964233 209
282 3300026067 Ga0207678_10007923 Ga0207678_100079231 209
283 3300026075 Ga0207708_10176170 Ga0207708_101761702 209
284 3300026089 Ga0207648_10046685 Ga0207648_100466854 209
285 3300028379 Ga0268266_10149442 Ga0268266_101494422 209
286 3300028381 Ga0268264_10225868 Ga0268264_102258682 209
287 3300028786 Ga0307517_10190184 Ga0307517_101901842 209
288 3300035724 Ga0373933_0000290 Ga0373933_0000290_27473_28117 209
289 3300047315 Ga0495581_0049990 Ga0495581_0049990_1257_1892 209
290 3300048903 Ga0496100_0468920 Ga0496100_0468920_127_780 209
291 3300048905 Ga0496102_0204378 Ga0496102_0204378_84_743 209
292 3300048905 Ga0496102_0385818 Ga0496102_0385818_114_749 209
293 3300048924 Ga0496121_0145335 Ga0496121_0145335_280_948 209
294 3300049587 Ga0501071_0174250 Ga0501071_0174250_89_724 209
295 3300005548 Ga0070665_100070223 Ga0070665_1000702233 210
296 3300005937 Ga0081455_10010629 Ga0081455_100106295 210
297 3300025937 Ga0207669_10078473 Ga0207669_100784733 210
298 3300028786 Ga0307517_10000650 Ga0307517_1000065030 210
299 3300028794 Ga0307515_10090494 Ga0307515_100904946 210
300 3300031911 Ga0307412_10201909 Ga0307412_102019092 210
301 3300031911 Ga0307412_10203947 Ga0307412_102039472 210
302 3300032126 Ga0307415_100707134 Ga0307415_1007071341 210
303 3300048907 Ga0496104_0486103 Ga0496104_0486103_280_942 210
304 3300053079 Ga0500610_0160935 Ga0500610_0160935_201_839 210
305 3300053119 Ga0500595_012514 Ga0500595_012514_1504_2142 210
306 3300053148 Ga0500590_142522 Ga0500590_142522_136_774 210
307 3300003215 JGI25153J46596_10003994 JGI25153J46596_100039946 211
308 3300005327 Ga0070658_10231797 Ga0070658_102317972 211
309 3300005334 Ga0068869_100250776 Ga0068869_1002507762 211
310 3300005334 Ga0068869_100332593 Ga0068869_1003325931 211
311 3300005344 Ga0070661_100065195 Ga0070661_1000651953 211
312 3300005347 Ga0070668_100249018 Ga0070668_1002490182 211
313 3300005347 Ga0070668_100378959 Ga0070668_1003789592 211
314 3300005355 Ga0070671_100523178 Ga0070671_1005231782 211
315 3300005364 Ga0070673_100162224 Ga0070673_1001622242 211
316 3300005365 Ga0070688_100523617 Ga0070688_1005236171 211
317 3300005366 Ga0070659_100252581 Ga0070659_1002525811 211
318 3300005406 Ga0070703_10023738 Ga0070703_100237382 211
319 3300005434 Ga0070709_10195067 Ga0070709_101950671 211
320 3300005444 Ga0070694_100075569 Ga0070694_1000755692 211
321 3300005455 Ga0070663_100238823 Ga0070663_1002388232 211
322 3300005456 Ga0070678_100122294 Ga0070678_1001222943 211
323 3300005456 Ga0070678_100331057 Ga0070678_1003310572 211
324 3300005459 Ga0068867_100450451 Ga0068867_1004504511 211
325 3300005467 Ga0070706_100700063 Ga0070706_1007000631 211
326 3300005518 Ga0070699_100071253 Ga0070699_1000712534 211
327 3300005539 Ga0068853_100005373 Ga0068853_1000053737 211
328 3300005539 Ga0068853_100641338 Ga0068853_1006413381 211
329 3300005543 Ga0070672_100634354 Ga0070672_1006343541 211
330 3300005544 Ga0070686_100086379 Ga0070686_1000863792 211
331 3300005546 Ga0070696_100073267 Ga0070696_1000732673 211
332 3300005547 Ga0070693_100277185 Ga0070693_1002771852 211
333 3300005548 Ga0070665_100048597 Ga0070665_1000485972 211
334 3300005548 Ga0070665_100082821 Ga0070665_1000828213 211
335 3300005548 Ga0070665_100140823 Ga0070665_1001408232 211
336 3300005564 Ga0070664_100183552 Ga0070664_1001835522 211
337 3300005616 Ga0068852_100145672 Ga0068852_1001456722 211
338 3300005617 Ga0068859_100231938 Ga0068859_1002319381 211
339 3300005617 Ga0068859_100427707 Ga0068859_1004277072 211
340 3300005618 Ga0068864_100202594 Ga0068864_1002025943 211
341 3300005618 Ga0068864_100839496 Ga0068864_1008394962 211
342 3300005718 Ga0068866_10098244 Ga0068866_100982442 211
343 3300005719 Ga0068861_100665566 Ga0068861_1006655661 211
344 3300005841 Ga0068863_100545553 Ga0068863_1005455532 211
345 3300005842 Ga0068858_100609314 Ga0068858_1006093142 211
346 3300005843 Ga0068860_100169048 Ga0068860_1001690482 211
347 3300005843 Ga0068860_100340110 Ga0068860_1003401101 211
348 3300005844 Ga0068862_100139939 Ga0068862_1001399392 211
349 3300005844 Ga0068862_100170299 Ga0068862_1001702992 211
350 3300005844 Ga0068862_100494017 Ga0068862_1004940171 211
351 3300005937 Ga0081455_10109991 Ga0081455_101099913 211
352 3300005981 Ga0081538_10009617 Ga0081538_100096179 211
353 3300005983 Ga0081540_1013564 Ga0081540_10135643 211
354 3300006038 Ga0075365_10392852 Ga0075365_103928522 211
355 3300006048 Ga0075363_100054319 Ga0075363_1000543192 211
356 3300006051 Ga0075364_10107079 Ga0075364_101070793 211
357 3300006051 Ga0075364_10124416 Ga0075364_101244163 211
358 3300006177 Ga0075362_10091768 Ga0075362_100917682 211
359 3300006178 Ga0075367_10170484 Ga0075367_101704841 211
360 3300006195 Ga0075366_10072355 Ga0075366_100723552 211
361 3300006195 Ga0075366_10299535 Ga0075366_102995352 211
362 3300006237 Ga0097621_100226381 Ga0097621_1002263812 211
363 3300006353 Ga0075370_10053511 Ga0075370_100535112 211
364 3300006358 Ga0068871_100083955 Ga0068871_1000839553 211
365 3300006880 Ga0075429_100223331 Ga0075429_1002233312 211
366 3300006881 Ga0068865_100278115 Ga0068865_1002781152 211
367 3300006931 Ga0097620_100231939 Ga0097620_1002319391 211
368 3300006931 Ga0097620_100427693 Ga0097620_1004276932 211
369 3300007076 Ga0075435_100021255 Ga0075435_1000212553 211
370 3300009092 Ga0105250_10014308 Ga0105250_100143085 211
371 3300009147 Ga0114129_10040150 Ga0114129_100401502 211
372 3300009147 Ga0114129_11227592 Ga0114129_112275921 211
373 3300009545 Ga0105237_10438618 Ga0105237_104386181 211
374 3300011119 Ga0105246_10200517 Ga0105246_102005173 211
375 3300013306 Ga0163162_11038605 Ga0163162_110386052 211
376 3300013307 Ga0157372_11491101 Ga0157372_114911011 211
377 3300014325 Ga0163163_10384082 Ga0163163_103840823 211
378 3300014325 Ga0163163_10425528 Ga0163163_104255282 211
379 3300014968 Ga0157379_11074232 Ga0157379_110742321 211
380 3300014969 Ga0157376_10467364 Ga0157376_104673643 211
381 3300017792 Ga0163161_10793793 Ga0163161_107937931 211
382 3300025297 Ga0209758_1002609 Ga0209758_10026093 211
383 3300025297 Ga0209758_1019604 Ga0209758_10196043 211
384 3300025885 Ga0207653_10003808 Ga0207653_100038082 211
385 3300025900 Ga0207710_10063204 Ga0207710_100632043 211
386 3300025901 Ga0207688_10074489 Ga0207688_100744893 211
387 3300025903 Ga0207680_10331433 Ga0207680_103314332 211
388 3300025911 Ga0207654_10047544 Ga0207654_100475443 211
389 3300025914 Ga0207671_10415571 Ga0207671_104155712 211
390 3300025919 Ga0207657_10301192 Ga0207657_103011922 211
391 3300025920 Ga0207649_10089883 Ga0207649_100898833 211
392 3300025923 Ga0207681_10297866 Ga0207681_102978662 211
393 3300025924 Ga0207694_10149529 Ga0207694_101495292 211
394 3300025924 Ga0207694_10560006 Ga0207694_105600062 211
395 3300025927 Ga0207687_10049173 Ga0207687_100491733 211
396 3300025935 Ga0207709_10157456 Ga0207709_101574562 211
397 3300025940 Ga0207691_10505133 Ga0207691_105051331 211
398 3300025942 Ga0207689_10237757 Ga0207689_102377573 211
399 3300025942 Ga0207689_10595226 Ga0207689_105952261 211
400 3300025945 Ga0207679_10074372 Ga0207679_100743721 211
401 3300025949 Ga0207667_10045105 Ga0207667_100451052 211
402 3300025972 Ga0207668_10019194 Ga0207668_100191947 211
403 3300025986 Ga0207658_10298896 Ga0207658_102988961 211
404 3300025986 Ga0207658_10955506 Ga0207658_109555061 211
405 3300026035 Ga0207703_10092523 Ga0207703_100925233 211
406 3300026035 Ga0207703_10269871 Ga0207703_102698712 211
407 3300026067 Ga0207678_10280032 Ga0207678_102800322 211
408 3300026075 Ga0207708_10564040 Ga0207708_105640401 211
409 3300026078 Ga0207702_10618048 Ga0207702_106180481 211
410 3300026095 Ga0207676_10158903 Ga0207676_101589033 211
411 3300026116 Ga0207674_10496087 Ga0207674_104960872 211
412 3300026118 Ga0207675_100158843 Ga0207675_1001588432 211
413 3300026142 Ga0207698_10133900 Ga0207698_101339003 211
414 3300028379 Ga0268266_10001826 Ga0268266_1000182617 211
415 3300028379 Ga0268266_10042569 Ga0268266_100425695 211
416 3300028379 Ga0268266_10051078 Ga0268266_100510785 211
417 3300028380 Ga0268265_10282669 Ga0268265_102826692 211
418 3300028381 Ga0268264_10229068 Ga0268264_102290681 211
419 3300028794 Ga0307515_10629050 Ga0307515_106290501 211
420 3300031507 Ga0307509_10206466 Ga0307509_102064663 211
421 3300031730 Ga0307516_10059702 Ga0307516_100597023 211
422 3300031731 Ga0307405_10690247 Ga0307405_106902471 211
423 3300031852 Ga0307410_10315402 Ga0307410_103154022 211
424 3300031901 Ga0307406_10127287 Ga0307406_101272872 211
425 3300031901 Ga0307406_10402682 Ga0307406_104026821 211
426 3300031911 Ga0307412_10509008 Ga0307412_105090082 211
427 3300032002 Ga0307416_100879882 Ga0307416_1008798822 211
428 3300032004 Ga0307414_10269950 Ga0307414_102699501 211
429 3300032126 Ga0307415_100060993 Ga0307415_1000609932 211
430 3300032126 Ga0307415_100126245 Ga0307415_1001262452 211
431 3300033180 Ga0307510_10039331 Ga0307510_100393313 211
432 3300041451 Ga0451791_0831322 Ga0451791_0831322_375_1010 211
433 3300046452 Ga0495617_046180 Ga0495617_046180_584_1225 211
434 3300046455 Ga0495603_0027126 Ga0495603_0027126_227_868 211
435 3300046457 Ga0495590_0162903 Ga0495590_0162903_68_709 211
436 3300046458 Ga0495591_051858 Ga0495591_051858_377_1018 211
437 3300046460 Ga0495638_0276312 Ga0495638_0276312_22_663 211
438 3300046475 Ga0495639_0161775 Ga0495639_0161775_217_858 211
439 3300046491 Ga0495584_0127068 Ga0495584_0127068_242_883 211
440 3300046491 Ga0495584_0141331 Ga0495584_0141331_18_653 211
441 3300046492 Ga0495585_0186268 Ga0495585_0186268_262_897 211
442 3300046500 Ga0495596_0192302 Ga0495596_0192302_111_746 211
443 3300046513 Ga0495616_0172402 Ga0495616_0172402_266_907 211
444 3300046515 Ga0495620_0071966 Ga0495620_0071966_606_1247 211
445 3300046538 Ga0495609_0232477 Ga0495609_0232477_76_717 211
446 3300046539 Ga0495621_0009907 Ga0495621_0009907_2002_2637 211
447 3300046542 Ga0495597_0040364 Ga0495597_0040364_436_1077 211
448 3300046557 Ga0495622_0035383 Ga0495622_0035383_1178_1843 211
449 3300046558 Ga0495633_0037623 Ga0495633_0037623_11_646 211
450 3300046558 Ga0495633_0274345 Ga0495633_0274345_10_651 211
451 3300046615 Ga0495656_0035143 Ga0495656_0035143_1369_2004 211
452 3300046615 Ga0495656_0449735 Ga0495656_0449735_18_653 211
453 3300046616 Ga0495668_0066300 Ga0495668_0066300_89_730 211
454 3300046684 Ga0495669_0200657 Ga0495669_0200657_13_648 211
455 3300047470 Ga0495681_0099423 Ga0495681_0099423_231_866 211
456 3300047472 Ga0495686_0146670 Ga0495686_0146670_231_872 211
457 3300048091 Ga0495626_0119381 Ga0495626_0119381_167_808 211
458 3300048906 Ga0496103_0404661 Ga0496103_0404661_68_733 211
459 3300048907 Ga0496104_0275264 Ga0496104_0275264_950_1585 211
460 3300048910 Ga0496107_0333063 Ga0496107_0333063_476_1117 211
461 3300048912 Ga0496109_0141907 Ga0496109_0141907_233_898 211
462 3300048913 Ga0496110_0314531 Ga0496110_0314531_149_814 211
463 3300048916 Ga0496113_0134083 Ga0496113_0134083_868_1509 211
464 3300048918 Ga0496115_0728692 Ga0496115_0728692_34_669 211
465 3300048920 Ga0496117_0285293 Ga0496117_0285293_221_862 211
466 3300048922 Ga0496119_0311551 Ga0496119_0311551_99_734 211
467 3300048924 Ga0496121_0097950 Ga0496121_0097950_119_760 211
468 3300048927 Ga0496124_0334132 Ga0496124_0334132_323_964 211
469 3300048928 Ga0496125_0291351 Ga0496125_0291351_235_900 211
470 3300048928 Ga0496125_0324592 Ga0496125_0324592_247_888 211
471 3300048929 Ga0496126_0012601 Ga0496126_0012601_6686_7327 211
472 3300048929 Ga0496126_0134975 Ga0496126_0134975_643_1284 211
473 3300048929 Ga0496126_0573574 Ga0496126_0573574_125_790 211
474 3300049592 Ga0501076_0177663 Ga0501076_0177663_37_672 211
475 3300050489 nmdc:mga03683_132544_c1 nmdc:mga03683_132544_c1_281_916 211
476 3300050489 nmdc:mga03683_158864_c1 nmdc:mga03683_158864_c1_324_965 211
477 3300050490 nmdc:mga03n38_162530_c1 nmdc:mga03n38_162530_c1_276_911 211
478 3300050492 nmdc:mga0yw44_6437_c1 nmdc:mga0yw44_6437_c1_3049_3684 211
479 3300050494 nmdc:mga06z11_14975_c1 nmdc:mga06z11_14975_c1_37_672 211
480 3300050494 nmdc:mga06z11_244557_c1 nmdc:mga06z11_244557_c1_183_848 211
481 3300050496 nmdc:mga07m45_383958_c1 nmdc:mga07m45_383958_c1_64_729 211
482 3300050496 nmdc:mga07m45_47905_c1 nmdc:mga07m45_47905_c1_1393_2028 211
483 3300050507 nmdc:mga05p37_100536_c1 nmdc:mga05p37_100536_c1_656_1291 211
484 3300050512 nmdc:mga0n895_75518_c1 nmdc:mga0n895_75518_c1_1419_2084 211
485 3300050513 nmdc:mga0rr50_138245_c1 nmdc:mga0rr50_138245_c1_357_1022 211
486 3300053083 Ga0495655_0111726 Ga0495655_0111726_130_771 211
487 3300053093 Ga0500651_0035523 Ga0500651_0035523_1686_2327 211
488 3300053096 Ga0500641_0147811 Ga0500641_0147811_73_708 211
489 3300053108 Ga0500562_045173 Ga0500562_045173_14_655 211
490 3300053109 Ga0500569_178149 Ga0500569_178149_64_699 211
491 3300053133 Ga0500655_046255 Ga0500655_046255_135_776 211
492 3300053161 Ga0500634_0082107 Ga0500634_0082107_464_1105 211

Structural Annotation

Top 5 Hits

ID Description Score Start End
5t9g-assembly2.cif.gz_B crystal structure of bugh2cwt in complex with galactoisofagomine 0.7174 97 179
8e72-assembly1.cif.gz_B treponema lecithinolyticum beta-glucuronidase in complex with a ciprofloxacin-glucuronide conjugate 0.6875 92 194
5t99-assembly1.cif.gz_A crystal structure of bugh2awt in complex with galactoisofagomine 0.6862 97 178
5t9g-assembly1.cif.gz_A crystal structure of bugh2cwt in complex with galactoisofagomine 0.664 97 179
5t9a-assembly3.cif.gz_C crystal structure of bugh2cwt 0.6628 97 179
ID Description Score Start End Superfamily
af_A0A1D6M373_288_408_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7134 92 190 2.60.40.10
5c71D02 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6832 92 190 2.60.40.10
af_P84634_1455_1536_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.6403 96 122 3.30.160.20
af_Q93324_214_323_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6236 92 192 2.60.40.10
af_Q8VC04_24_251_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6039 92 175 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A2E9U9N8-F1-model_v4 Uncharacterized protein 0.8886 66 193
AF-A0A327K241-F1-model_v4 deleted 0.8685 49 209
AF-A0A399R858-F1-model_v4 Tat pathway signal sequence domain protein 0.861 62 193
AF-A0A327K241-F1-model_v4 deleted 0.8582 49 209
AF-A0A1M3AA06-F1-model_v4 deleted 0.8563 62 193

Feature Viewer

pLDDT pTM Quality
75.34 0.61 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map