F454268

General Info

Members Datasets Scaffolds Average Seq Length
492 277 984 273

Family's Representative Sequence

Representative Sequence 3300021388|Ga0213875_10000155|Ga0213875_1000015552
Length 298
Sequence MPAQGSNTQAETQPVAATPQRTTTQAEPLYGGHTRGRVTVRDIAAAKARGEKWPMLTAYDALTAGIFDEAGIPVLLVGDSAAMVVYGHDTTIPVTVDDLIPLTAAVVRGTSRAMIVADLPFGSYQASPAAALEAATRFFKESGAHAVKLEGGMRVAHQVEELVAAGIPVMAHLGLTPQSVHAFGGYRVQGRGEDGERLLHDAKALQAAGAFSVVLECVPAALGARITEALSIPTIGIGAGPHCDAQVLVWQDMAGLSPRTPKFVKKYADVAGVLRGAAAAFAKDVTSGAFPAEEFSYR

Samples

Sample ID Description Type Environment
1 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300003503 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
45 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
48 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
77 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
127 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
128 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
129 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
130 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
131 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
132 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
133 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
134 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
135 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
136 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
137 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
138 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
139 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
140 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
141 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
142 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
143 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
144 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
145 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
146 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
147 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
148 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
149 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
150 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
151 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
152 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
153 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
154 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
155 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
156 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
157 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
160 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
161 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
162 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
163 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
164 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
165 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
166 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
167 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
168 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
169 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
170 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
171 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
172 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
173 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
174 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
175 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
176 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
177 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
178 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
179 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
180 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
181 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
182 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
183 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
184 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
185 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
186 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
187 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
188 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
189 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
190 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
191 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
192 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
193 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
194 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
195 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
196 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
197 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
198 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
199 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
200 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
201 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
202 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
203 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
204 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
205 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
206 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
207 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
208 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
209 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
210 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
211 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
212 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
213 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
214 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
215 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
216 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
217 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
218 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
219 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
220 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
221 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
222 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
223 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
224 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
225 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
226 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
227 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
228 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
229 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
230 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
231 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
232 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
233 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
234 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
235 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
236 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
237 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
238 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
250 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
251 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
252 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
253 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
254 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
255 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
256 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
257 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
258 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
259 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
260 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
263 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
264 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
265 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
266 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
267 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
268 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
269 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
270 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
271 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
272 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
273 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
274 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
275 2582580736 Prauserella sp. Am3 Isolate Unclassified
276 2920107658 Aquisphaera insulae JC669 Isolate Rhizosphere
277 8055157932 Frankia umida Ag45/Mut15 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.19
Metatranscriptomes 0.2
Isolates 0.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.2
Nodule 0.2
Rhizoplane 3.86
Rhizosphere 92.48
Stem 0
Stem Tuber 0
Unclassified 0.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213875_10000155 3300021388 Bacteria 72442
2 JGI25407J50210_10009821 3300003373 Bacteria 2427
3 JGI26141J51220_1001313 3300003503 Bacteria 1496
4 Ga0065712_10140626 3300005290 Bacteria 1453
5 Ga0070676_10107500 3300005328 Bacteria 1732
6 Ga0070690_100304820 3300005330 Bacteria 1143
7 Ga0068869_100010235 3300005334 Bacteria 6109
8 Ga0068869_100170789 3300005334 Bacteria 1698
9 Ga0070680_100176428 3300005336 Bacteria 1799
10 Ga0070661_100139101 3300005344 Bacteria 1829
11 Ga0070669_100068582 3300005353 Bacteria 2618
12 Ga0070669_100243169 3300005353 Bacteria 1430
13 Ga0070669_100428608 3300005353 Bacteria 1087
14 Ga0070675_100093682 3300005354 Bacteria 2519
15 Ga0070671_100244842 3300005355 Bacteria 1522
16 Ga0070673_100044728 3300005364 Bacteria 3430
17 Ga0070703_10012418 3300005406 Bacteria 2414
18 Ga0070709_10008360 3300005434 Bacteria 5684
19 Ga0070709_10246952 3300005434 Bacteria 1284
20 Ga0070714_100000316 3300005435 Bacteria 36600
21 Ga0070714_100079849 3300005435 Bacteria 2845
22 Ga0070714_100149188 3300005435 Bacteria 2105
23 Ga0070713_100018076 3300005436 Bacteria 5354
24 Ga0070713_100046285 3300005436 Bacteria 3569
25 Ga0070713_100212368 3300005436 Bacteria 1752
26 Ga0070713_100570241 3300005436 Bacteria 1073
27 Ga0070710_10020779 3300005437 Bacteria 3411
28 Ga0070710_10198080 3300005437 Bacteria 1266
29 Ga0070711_100137324 3300005439 Bacteria 1829
30 Ga0070700_100181871 3300005441 Bacteria 1464
31 Ga0070694_100009482 3300005444 Bacteria 5971
32 Ga0070708_100017529 3300005445 Bacteria 5979
33 Ga0070708_100190813 3300005445 Bacteria 1916
34 Ga0070708_100306549 3300005445 Bacteria 1495
35 Ga0070663_100314875 3300005455 Bacteria 1257
36 Ga0070662_100123802 3300005457 Bacteria 1985
37 Ga0070681_10156047 3300005458 Bacteria 2207
38 Ga0068867_100221789 3300005459 Bacteria 1524
39 Ga0070706_100049026 3300005467 Bacteria 3897
40 Ga0070706_100089318 3300005467 Bacteria 2857
41 Ga0070706_100100957 3300005467 Bacteria 2681
42 Ga0070707_100011933 3300005468 Bacteria 8108
43 Ga0070707_100021834 3300005468 Bacteria 6051
44 Ga0070707_100130524 3300005468 Bacteria 2444
45 Ga0070707_100202971 3300005468 Bacteria 1932
46 Ga0070707_100282917 3300005468 Bacteria 1612
47 Ga0070698_100001869 3300005471 Bacteria 23455
48 Ga0070698_100005603 3300005471 Bacteria 13731
49 Ga0070698_100006730 3300005471 Bacteria 12461
50 Ga0070698_100027373 3300005471 Bacteria 5930
51 Ga0070698_100118812 3300005471 Bacteria 2604
52 Ga0070699_100001708 3300005518 Bacteria 20011
53 Ga0070699_100003323 3300005518 Bacteria 14223
54 Ga0070679_100115597 3300005530 Bacteria 2668
55 Ga0070679_100138339 3300005530 Bacteria 2416
56 Ga0070684_100010753 3300005535 Bacteria 7265
57 Ga0070684_100488813 3300005535 Bacteria 1140
58 Ga0070697_100024352 3300005536 Bacteria 4819
59 Ga0070672_100056857 3300005543 Bacteria 3070
60 Ga0070672_100063587 3300005543 Bacteria 2914
61 Ga0070695_100158818 3300005545 Bacteria 1585
62 Ga0070665_100154070 3300005548 Bacteria 2300
63 Ga0070704_100017118 3300005549 Bacteria 4600
64 Ga0070704_100454554 3300005549 Bacteria 1103
65 Ga0070664_100011889 3300005564 Bacteria 7065
66 Ga0068854_100136913 3300005578 Bacteria 1875
67 Ga0070702_100022989 3300005615 Bacteria 3306
68 Ga0068861_100063611 3300005719 Bacteria 2836
69 Ga0068863_100015955 3300005841 Bacteria 7204
70 Ga0068863_100668688 3300005841 Bacteria 1031
71 Ga0068862_100032636 3300005844 Bacteria 4400
72 Ga0081538_10002399 3300005981 Bacteria 18385
73 Ga0081540_1000277 3300005983 Bacteria 53307
74 Ga0070717_10014044 3300006028 Bacteria 6155
75 Ga0070717_10113735 3300006028 Bacteria 2311
76 Ga0070717_10140368 3300006028 Bacteria 2084
77 Ga0070715_10009962 3300006163 Bacteria 3370
78 Ga0070716_100023461 3300006173 Bacteria 3273
79 Ga0070716_100043564 3300006173 Bacteria 2510
80 Ga0070712_100015282 3300006175 Bacteria 4938
81 Ga0070712_100072729 3300006175 Bacteria 2463
82 Ga0070712_100430249 3300006175 Bacteria 1095
83 Ga0097621_100474120 3300006237 Bacteria 1130
84 Ga0075428_100002682 3300006844 Bacteria 19348
85 Ga0075428_100037541 3300006844 Bacteria 5333
86 Ga0075430_100010463 3300006846 Bacteria 7855
87 Ga0075431_100106342 3300006847 Unclassified 2895
88 Ga0075431_100280648 3300006847 Bacteria 1686
89 Ga0075433_10000429 3300006852 Bacteria 26994
90 Ga0075434_100000669 3300006871 Bacteria 26608
91 Ga0075434_100351578 3300006871 Bacteria 1495
92 Ga0075434_100410836 3300006871 Bacteria 1375
93 Ga0075429_100026030 3300006880 Bacteria 5078
94 Ga0105240_10591321 3300009093 Bacteria 1223
95 Ga0111539_10000873 3300009094 Bacteria 39350
96 Ga0111539_10105313 3300009094 Bacteria 3309
97 Ga0114129_10068552 3300009147 Bacteria 4946
98 Ga0114129_10166859 3300009147 Bacteria 3004
99 Ga0105243_10291442 3300009148 Bacteria 1475
100 Ga0105241_10290926 3300009174 Bacteria 1399
101 Ga0105242_10018345 3300009176 Bacteria 5469
102 Ga0105248_10243045 3300009177 Bacteria 2026
103 Ga0105249_10606173 3300009553 Bacteria 1150
104 Ga0105249_10615791 3300009553 Bacteria 1141
105 Ga0105246_10352463 3300011119 Bacteria 1206
106 Ga0157338_1000959 3300012515 Bacteria 1930
107 Ga0157373_10273270 3300013100 Bacteria 1197
108 Ga0157369_10747711 3300013105 Bacteria 1006
109 Ga0157378_10171717 3300013297 Bacteria 2034
110 Ga0157378_10616200 3300013297 Bacteria 1098
111 Ga0163162_10261434 3300013306 Bacteria 1863
112 Ga0157375_10084907 3300013308 Bacteria 3215
113 Ga0157375_10286787 3300013308 Bacteria 1809
114 Ga0163163_10165777 3300014325 Bacteria 2255
115 Ga0157380_10179588 3300014326 Bacteria 1858
116 Ga0157380_10188248 3300014326 Bacteria 1820
117 Ga0157380_10284103 3300014326 Bacteria 1516
118 Ga0157380_10302363 3300014326 Bacteria 1474
119 Ga0157377_10035140 3300014745 Bacteria 2747
120 Ga0213875_10000339 3300021388 Bacteria 44124
121 Ga0213875_10022536 3300021388 Bacteria 3011
122 Ga0224712_10153265 3300022467 Bacteria 1023
123 Ga0224572_1003897 3300024225 Bacteria 2555
124 Ga0207692_10021421 3300025898 Bacteria 2957
125 Ga0207692_10049857 3300025898 Bacteria 2114
126 Ga0207692_10076485 3300025898 Bacteria 1778
127 Ga0207710_10035460 3300025900 Bacteria 2195
128 Ga0207647_10039146 3300025904 Bacteria 2994
129 Ga0207685_10015749 3300025905 Bacteria 2403
130 Ga0207699_10003017 3300025906 Bacteria 7999
131 Ga0207699_10024105 3300025906 Bacteria 3322
132 Ga0207643_10020924 3300025908 Bacteria 3591
133 Ga0207684_10016506 3300025910 Bacteria 6340
134 Ga0207684_10080892 3300025910 Bacteria 2764
135 Ga0207684_10158697 3300025910 Bacteria 1947
136 Ga0207654_10079151 3300025911 Bacteria 1974
137 Ga0207707_10137831 3300025912 Bacteria 2133
138 Ga0207695_10258397 3300025913 Bacteria 1640
139 Ga0207693_10009643 3300025915 Bacteria 7862
140 Ga0207693_10043421 3300025915 Bacteria 3537
141 Ga0207663_10035568 3300025916 Bacteria 2989
142 Ga0207663_10090623 3300025916 Bacteria 2027
143 Ga0207657_10028172 3300025919 Bacteria 5130
144 Ga0207649_10180254 3300025920 Bacteria 1478
145 Ga0207646_10034438 3300025922 Bacteria 4576
146 Ga0207646_10100074 3300025922 Bacteria 2598
147 Ga0207646_10104418 3300025922 Bacteria 2541
148 Ga0207646_10135177 3300025922 Bacteria 2220
149 Ga0207681_10177231 3300025923 Bacteria 1621
150 Ga0207694_10073364 3300025924 Bacteria 2677
151 Ga0207659_10099412 3300025926 Bacteria 2190
152 Ga0207700_10013707 3300025928 Bacteria 5287
153 Ga0207700_10023116 3300025928 Bacteria 4279
154 Ga0207700_10053625 3300025928 Bacteria 3022
155 Ga0207700_10064961 3300025928 Bacteria 2782
156 Ga0207700_10075076 3300025928 Bacteria 2618
157 Ga0207664_10010480 3300025929 Bacteria 6546
158 Ga0207664_10011656 3300025929 Bacteria 6261
159 Ga0207664_10021572 3300025929 Bacteria 4792
160 Ga0207664_10049554 3300025929 Bacteria 3307
161 Ga0207664_10131476 3300025929 Bacteria 2107
162 Ga0207664_10158816 3300025929 Bacteria 1927
163 Ga0207664_10339760 3300025929 Bacteria 1327
164 Ga0207706_10129292 3300025933 Bacteria 2221
165 Ga0207665_10018893 3300025939 Bacteria 4529
166 Ga0207691_10043562 3300025940 Bacteria 4135
167 Ga0207691_10254934 3300025940 Bacteria 1513
168 Ga0207689_10002372 3300025942 Bacteria 17589
169 Ga0207689_10029948 3300025942 Bacteria 4539
170 Ga0207661_10216337 3300025944 Bacteria 1691
171 Ga0207661_10615858 3300025944 Bacteria 997
172 Ga0207679_10329106 3300025945 Bacteria 1325
173 Ga0207651_10077270 3300025960 Bacteria 2383
174 Ga0207712_10012314 3300025961 Bacteria 5466
175 Ga0207668_10560730 3300025972 Bacteria 991
176 Ga0207640_10609634 3300025981 Bacteria 925
177 Ga0207658_10122387 3300025986 Bacteria 2077
178 Ga0207678_10020717 3300026067 Bacteria 5764
179 Ga0207678_10082375 3300026067 Bacteria 2753
180 Ga0207708_10055784 3300026075 Bacteria 3013
181 Ga0207674_10014831 3300026116 Bacteria 8595
182 Ga0207675_100025350 3300026118 Bacteria 5518
183 Ga0207675_100097074 3300026118 Bacteria 2775
184 Ga0207683_10006862 3300026121 Bacteria 9750
185 Ga0209981_1004044 3300027378 Bacteria 1912
186 Ga0209996_1004713 3300027395 Unclassified 1739
187 Ga0210000_1003244 3300027462 Bacteria 2339
188 Ga0209999_1001647 3300027543 Bacteria 3856
189 Ga0209982_1002929 3300027552 Bacteria 2410
190 Ga0209970_1002215 3300027614 Bacteria 3334
191 Ga0209983_1000239 3300027665 Bacteria 11133
192 Ga0209971_1000259 3300027682 Bacteria 14994
193 Ga0209971_1027048 3300027682 Bacteria 1372
194 Ga0209998_10001304 3300027717 Bacteria 6099
195 Ga0209974_10000208 3300027876 Bacteria 19001
196 Ga0209974_10024774 3300027876 Bacteria 1985
197 Ga0207428_10003142 3300027907 Bacteria 16190
198 Ga0268266_10122674 3300028379 Bacteria 2314
199 Ga0268265_10042024 3300028380 Bacteria 3388
200 Ga0265331_10054203 3300031250 Bacteria 1910
201 Ga0307405_10002750 3300031731 Bacteria 7881
202 Ga0307410_10118405 3300031852 Bacteria 1927
203 Ga0307410_10167602 3300031852 Bacteria 1652
204 Ga0307409_100417595 3300031995 Bacteria 1286
205 Ga0307414_10194222 3300032004 Bacteria 1645
206 Ga0307415_100073268 3300032126 Bacteria 2415
207 Ga0373926_0000391 3300035083 Bacteria 11217
208 Ga0373926_0002426 3300035083 Bacteria 5906
209 Ga0373928_0028514 3300035084 Bacteria 1222
210 Ga0373934_0000316 3300035086 Bacteria 16956
211 Ga0373934_0160989 3300035086 Bacteria 921
212 Ga0373940_0001032 3300035088 Bacteria 4793
213 Ga0373944_0002985 3300035089 Bacteria 4351
214 Ga0373952_0032288 3300035092 Bacteria 1168
215 Ga0373923_0000531 3300035111 Bacteria 9270
216 Ga0373923_0041437 3300035111 Bacteria 1898
217 Ga0373936_0001289 3300035113 Bacteria 9067
218 Ga0373936_0008531 3300035113 Bacteria 3859
219 Ga0373936_0012893 3300035113 Bacteria 3186
220 Ga0373936_0054310 3300035113 Bacteria 1625
221 Ga0373939_0010709 3300035114 Bacteria 2300
222 Ga0373945_0000251 3300035116 Bacteria 14979
223 Ga0373945_0001471 3300035116 Bacteria 7191
224 Ga0373945_0078833 3300035116 Bacteria 1259
225 Ga0373953_0002696 3300035117 Bacteria 5381
226 Ga0373953_0016115 3300035117 Bacteria 2723
227 Ga0373954_0128821 3300035118 Bacteria 1231
228 Ga0373954_0250257 3300035118 Bacteria 872
229 Ga0373956_0000827 3300035119 Bacteria 12857
230 Ga0373956_0008509 3300035119 Bacteria 4152
231 Ga0373956_0065370 3300035119 Bacteria 1652
232 Ga0373957_0001774 3300035120 Bacteria 5948
233 Ga0373957_0013298 3300035120 Bacteria 2790
234 Ga0373957_0048796 3300035120 Bacteria 1614
235 Ga0373960_0019591 3300035121 Bacteria 1779
236 Ga0373943_0000474 3300035170 Bacteria 17090
237 Ga0373943_0001385 3300035170 Bacteria 10923
238 Ga0373946_0000343 3300035171 Bacteria 15014
239 Ga0373946_0000943 3300035171 Bacteria 9958
240 Ga0373955_0005178 3300035172 Bacteria 5834
241 Ga0373955_0221710 3300035172 Bacteria 1129
242 Ga0373942_0011615 3300035207 Bacteria 2091
243 Ga0373924_0015239 3300035410 Bacteria 2919
244 Ga0373924_0022853 3300035410 Bacteria 2447
245 Ga0373931_0078964 3300035691 Bacteria 1811
246 Ga0373935_0000920 3300035692 Bacteria 15917
247 Ga0373935_0071641 3300035692 Bacteria 2236
248 Ga0373935_0179645 3300035692 Bacteria 1452
249 Ga0373927_0003038 3300035695 Bacteria 12170
250 Ga0373927_0004577 3300035695 Bacteria 9656
251 Ga0373933_0003895 3300035724 Bacteria 8232
252 Ga0373933_0009534 3300035724 Bacteria 5302
253 Ga0373933_0173581 3300035724 Bacteria 1372
254 Ga0373947_0000088 3300035725 Bacteria 46278
255 Ga0373947_0003414 3300035725 Bacteria 9402
256 Ga0373947_0045360 3300035725 Bacteria 2630
257 Ga0373937_0000180 3300036401 Bacteria 61995
258 Ga0373937_0070928 3300036401 Bacteria 3213
259 Ga0373937_0254780 3300036401 Bacteria 1654
260 Ga0373937_0393955 3300036401 Bacteria 1314
261 Ga0373925_0026185 3300037068 Bacteria 4266
262 Ga0373925_0102239 3300037068 Bacteria 2204
263 Ga0373925_0258472 3300037068 Bacteria 1398
264 Ga0373925_0359124 3300037068 Bacteria 1184
265 Ga0395900_0082357 3300037418 Bacteria 3306
266 Ga0395900_0244170 3300037418 Bacteria 1800
267 Ga0395898_0009579 3300037466 Bacteria 10172
268 Ga0395905_0000054 3300037471 Bacteria 210118
269 Ga0436364_0047432 3300037853 Bacteria 88437
270 Ga0436364_0496408 3300037853 Bacteria 1495
271 Ga0436364_0525485 3300037853 Bacteria 60710
272 Ga0436364_0869026 3300037853 Bacteria 4010
273 Ga0436364_0940200 3300037853 Bacteria 2086
274 Ga0436364_0984343 3300037853 Bacteria 19249
275 Ga0436364_1112250 3300037853 Bacteria 2838
276 Ga0436364_1196429 3300037853 Bacteria 1933
277 Ga0395901_0068328 3300038443 Bacteria 3701
278 Ga0436363_0558013 3300039450 Bacteria 936
279 Ga0436362_0089324 3300039453 Bacteria 888
280 Ga0436362_0687975 3300039453 Bacteria 1064
281 Ga0439439_0029327 3300041406 Bacteria 1396
282 Ga0451833_1361763 3300041491 Bacteria 2633
283 Ga0439442_036212 3300042002 Bacteria 1033
284 Ga0450923_001751 3300042125 Bacteria 2964
285 Ga0450923_002718 3300042125 Bacteria 2575
286 Ga0450894_023943 3300042131 Bacteria 832
287 Ga0450896_011282 3300042133 Bacteria 1257
288 Ga0450898_004498 3300042134 Bacteria 2065
289 Ga0439446_0012146 3300042156 Bacteria 2349
290 Ga0439446_0035578 3300042156 Bacteria 1453
291 Ga0450908_003484 3300042184 Bacteria 3061
292 Ga0450908_023168 3300042184 Bacteria 1087
293 Ga0439434_0008414 3300042435 Bacteria 3023
294 Ga0439434_0008508 3300042435 Bacteria 3010
295 Ga0450918_004494 3300042531 Bacteria 2539
296 Ga0453684_0236113 3300044712 Bacteria 2108
297 Ga0466968_0042049 3300044735 Bacteria 1931
298 Ga0466970_0187463 3300044765 Bacteria 1149
299 Ga0495592_0014628 3300046454 Bacteria 5956
300 Ga0495603_0134298 3300046455 Bacteria 1440
301 Ga0495629_0003040 3300046459 Bacteria 12749
302 Ga0495641_0002719 3300046461 Bacteria 13725
303 Ga0495651_0005482 3300046462 Bacteria 9678
304 Ga0495651_0020730 3300046462 Bacteria 5104
305 Ga0495651_0065590 3300046462 Bacteria 2772
306 Ga0495651_0199241 3300046462 Bacteria 1402
307 Ga0495653_0004467 3300046463 Bacteria 11296
308 Ga0495653_0007879 3300046463 Bacteria 8719
309 Ga0495653_0051340 3300046463 Bacteria 3166
310 Ga0495653_0078472 3300046463 Bacteria 2448
311 Ga0495653_0204352 3300046463 Bacteria 1338
312 Ga0495580_0046975 3300046472 Bacteria 3061
313 Ga0495582_0003279 3300046473 Bacteria 9089
314 Ga0495582_0036116 3300046473 Bacteria 2718
315 Ga0495639_0000521 3300046475 Bacteria 18044
316 Ga0495639_0106389 3300046475 Bacteria 1328
317 Ga0495662_0004634 3300046476 Bacteria 6898
318 Ga0495664_0056469 3300046477 Bacteria 2336
319 Ga0495664_0061321 3300046477 Bacteria 2239
320 Ga0495664_0104049 3300046477 Bacteria 1711
321 Ga0495664_0189920 3300046477 Bacteria 1245
322 Ga0495594_0012303 3300046499 Bacteria 4458
323 Ga0495608_0008274 3300046511 Bacteria 7301
324 Ga0495608_0012779 3300046511 Bacteria 5826
325 Ga0495608_0081090 3300046511 Bacteria 2108
326 Ga0495618_0004600 3300046514 Bacteria 8449
327 Ga0495618_0018811 3300046514 Bacteria 4244
328 Ga0495628_0103714 3300046516 Bacteria 2192
329 Ga0495630_0001083 3300046517 Bacteria 18767
330 Ga0495630_0274658 3300046517 Bacteria 1287
331 Ga0495630_0381203 3300046517 Bacteria 1080
332 Ga0495666_0008391 3300046526 Bacteria 5179
333 Ga0495652_0078376 3300046529 Bacteria 2735
334 Ga0495652_0178434 3300046529 Bacteria 1632
335 Ga0495652_0236253 3300046529 Bacteria 1363
336 Ga0495665_0005100 3300046531 Bacteria 7083
337 Ga0495665_0193734 3300046531 Bacteria 1054
338 Ga0495640_0008007 3300046533 Bacteria 8303
339 Ga0495640_0046982 3300046533 Bacteria 2988
340 Ga0495586_0004460 3300046535 Bacteria 7474
341 Ga0495587_0025170 3300046536 Bacteria 3638
342 Ga0495587_0050016 3300046536 Bacteria 2473
343 Ga0495587_0133764 3300046536 Bacteria 1417
344 Ga0495645_0012298 3300046543 Bacteria 6026
345 Ga0495645_0033424 3300046543 Bacteria 3752
346 Ga0495667_0001089 3300046559 Bacteria 17633
347 Ga0495667_0027510 3300046559 Bacteria 3831
348 Ga0495667_0042738 3300046559 Bacteria 3005
349 Ga0495667_0077589 3300046559 Bacteria 2160
350 Ga0495667_0110318 3300046559 Bacteria 1777
351 Ga0495634_0005196 3300046642 Bacteria 10055
352 Ga0495634_0035896 3300046642 Bacteria 3392
353 Ga0495634_0128513 3300046642 Bacteria 1617
354 Ga0495635_0000707 3300046663 Bacteria 21524
355 Ga0495635_0012626 3300046663 Bacteria 5923
356 Ga0495635_0030555 3300046663 Bacteria 3743
357 Ga0495635_0085701 3300046663 Bacteria 2155
358 Ga0495635_0201552 3300046663 Bacteria 1349
359 Ga0495588_0096795 3300046674 Bacteria 1548
360 Ga0495657_0004894 3300046675 Bacteria 10662
361 Ga0495657_0007618 3300046675 Bacteria 8339
362 Ga0495657_0011034 3300046675 Bacteria 6774
363 Ga0495657_0090542 3300046675 Bacteria 1963
364 Ga0495657_0326248 3300046675 Bacteria 911
365 Ga0495599_0059795 3300046678 Bacteria 2383
366 Ga0495599_0141395 3300046678 Bacteria 1493
367 Ga0495646_0012761 3300046680 Bacteria 5340
368 Ga0495646_0130044 3300046680 Bacteria 1418
369 Ga0495658_0002090 3300046683 Bacteria 10139
370 Ga0495658_0272525 3300046683 Bacteria 1067
371 Ga0495613_0002231 3300046689 Bacteria 14660
372 Ga0495613_0129364 3300046689 Bacteria 1809
373 Ga0495624_0002287 3300046690 Bacteria 14597
374 Ga0495624_0008545 3300046690 Bacteria 7131
375 Ga0495600_0001323 3300046809 Bacteria 13675
376 Ga0495600_0038966 3300046809 Bacteria 3094
377 Ga0495600_0082689 3300046809 Bacteria 2095
378 Ga0495600_0146857 3300046809 Bacteria 1528
379 Ga0495600_0228549 3300046809 Bacteria 1188
380 Ga0495581_0004079 3300047315 Bacteria 8409
381 Ga0495581_0062392 3300047315 Bacteria 2153
382 Ga0495674_0001949 3300047319 Bacteria 20356
383 Ga0495674_0009683 3300047319 Bacteria 9146
384 Ga0495676_0002065 3300047321 Bacteria 17675
385 Ga0495680_0020930 3300047322 Bacteria 5486
386 Ga0495680_0027812 3300047322 Bacteria 4640
387 Ga0495680_0050861 3300047322 Bacteria 3238
388 Ga0495680_0053543 3300047322 Bacteria 3139
389 Ga0495680_0263096 3300047322 Bacteria 1219
390 Ga0495675_0043151 3300047444 Bacteria 2874
391 Ga0495684_0005068 3300047471 Bacteria 10277
392 Ga0495684_0019290 3300047471 Bacteria 5249
393 Ga0495593_0002200 3300047673 Bacteria 11670
394 Ga0495602_0104056 3300048088 Bacteria 2323
395 Ga0495602_0139128 3300048088 Bacteria 1924
396 Ga0495602_0155993 3300048088 Bacteria 1787
397 Ga0495614_0030287 3300048089 Bacteria 2328
398 Ga0496101_0593099 3300048904 Bacteria 876
399 Ga0496102_0323122 3300048905 Bacteria 1453
400 Ga0496103_0016745 3300048906 Bacteria 4378
401 Ga0496103_0034480 3300048906 Bacteria 3095
402 Ga0496104_0041261 3300048907 Bacteria 4326
403 Ga0496105_0063578 3300048908 Bacteria 3044
404 Ga0496105_0583130 3300048908 Bacteria 870
405 Ga0496106_0041598 3300048909 Bacteria 3444
406 Ga0496106_0077966 3300048909 Bacteria 2541
407 Ga0496109_0102827 3300048912 Bacteria 2651
408 Ga0496110_0056455 3300048913 Bacteria 3455
409 Ga0496110_0163516 3300048913 Bacteria 2018
410 Ga0496110_0349004 3300048913 Bacteria 1348
411 Ga0496111_0015590 3300048914 Bacteria 5222
412 Ga0496112_0299637 3300048915 Bacteria 1553
413 Ga0496112_0542965 3300048915 Bacteria 1096
414 Ga0496113_0174169 3300048916 Bacteria 1704
415 Ga0496114_0092358 3300048917 Bacteria 2571
416 Ga0496115_0056762 3300048918 Bacteria 3147
417 Ga0496122_0034451 3300048925 Bacteria 4144
418 Ga0496126_0306320 3300048929 Bacteria 1309
419 Ga0501031_0020866 3300049568 Bacteria 4271
420 Ga0501032_0061622 3300049569 Bacteria 2514
421 Ga0501036_0007089 3300049572 Bacteria 9118
422 Ga0501036_0092163 3300049572 Bacteria 2560
423 Ga0501036_0199909 3300049572 Bacteria 1681
424 Ga0501037_0028535 3300049573 Bacteria 4123
425 Ga0501038_0373767 3300049574 Bacteria 1107
426 Ga0501039_0003379 3300049575 Bacteria 11930
427 Ga0501039_0009735 3300049575 Bacteria 7324
428 Ga0501040_0154821 3300049576 Bacteria 1618
429 Ga0501040_0315555 3300049576 Bacteria 1118
430 Ga0501040_0451528 3300049576 Bacteria 925
431 Ga0501041_0025143 3300049577 Bacteria 3579
432 Ga0501041_0124718 3300049577 Bacteria 1602
433 Ga0501042_0023075 3300049578 Bacteria 4349
434 Ga0501042_0061404 3300049578 Bacteria 2685
435 Ga0501042_0438472 3300049578 Archaea 947
436 Ga0501046_0024143 3300049580 Bacteria 4993
437 Ga0501048_0094858 3300049582 Bacteria 2104
438 Ga0501048_0162136 3300049582 Bacteria 1583
439 Ga0501067_0026576 3300049583 Bacteria 3205
440 Ga0501068_0023000 3300049584 Bacteria 3651
441 Ga0501068_0056477 3300049584 Bacteria 2380
442 Ga0501071_0076552 3300049587 Bacteria 2444
443 Ga0501071_0164533 3300049587 Bacteria 1659
444 Ga0501071_0335838 3300049587 Archaea 1149
445 Ga0501072_0026685 3300049588 Bacteria 4504
446 Ga0501072_0064189 3300049588 Bacteria 2896
447 Ga0501072_0067672 3300049588 Bacteria 2818
448 Ga0501072_0401141 3300049588 Bacteria 1088
449 Ga0501073_0034943 3300049589 Bacteria 3574
450 Ga0501075_0063357 3300049591 Bacteria 2787
451 Ga0501076_0016571 3300049592 Bacteria 5587
452 Ga0501076_0017631 3300049592 Bacteria 5428
453 Ga0501076_0040393 3300049592 Bacteria 3667
454 Ga0501077_0019339 3300049593 Bacteria 4308
455 Ga0501079_0125030 3300049741 Bacteria 2001
456 Ga0501079_0219732 3300049741 Bacteria 1484
457 Ga0501079_0338083 3300049741 Bacteria 1179
458 Ga0501080_0339103 3300049742 Bacteria 1358
459 Ga0501080_0427431 3300049742 Bacteria 1189
460 Ga0501081_0015566 3300049743 Bacteria 5020
461 Ga0501081_0158971 3300049743 Bacteria 1627
462 Ga0501035_0241082 3300049822 Bacteria 1538
463 Ga0501044_0160440 3300049823 Bacteria 2226
464 Ga0501044_0534331 3300049823 Bacteria 1071
465 Ga0501045_0020030 3300049824 Bacteria 4776
466 Ga0501045_0024859 3300049824 Bacteria 4302
467 Ga0501045_0198340 3300049824 Bacteria 1495
468 nmdc:mga05p37_43426_c1 3300050507 Bacteria 5530
469 nmdc:mga05p37_90833_c1 3300050507 Bacteria 3763
470 nmdc:mga08y16_1112087_c1 3300050511 Bacteria 765
471 nmdc:mga08y16_61238_c1 3300050511 Bacteria 3930
472 nmdc:mga0n895_243696_c1 3300050512 Bacteria 1824
473 nmdc:mga0n895_3107_c1 3300050512 Bacteria 13229
474 nmdc:mga0rr50_5308_c1 3300050513 Bacteria 7665
475 nmdc:mga08x19_155804_c1 3300050514 Bacteria 1549
476 nmdc:mga0a205_3727_c1 3300050515 Bacteria 13646
477 Ga0495612_0006898 3300053078 Bacteria 4647
478 Ga0495619_0005208 3300053085 Bacteria 8241
479 Ga0495619_0563926 3300053085 Bacteria 781
480 Ga0500604_0069789 3300053151 Bacteria 1118
481 Ga0501084_0074739 3300054114 Bacteria 2838
482 Ga0501084_0146268 3300054114 Bacteria 1990
483 Ga0501084_0189313 3300054114 Bacteria 1736
484 Ga0501084_0292648 3300054114 Bacteria 1375
485 Ga0501082_0015267 3300060353 Bacteria 6615
486 Ga0501082_0049675 3300060353 Bacteria 3618
487 Ga0501082_0091593 3300060353 Bacteria 2625
488 Ga0530510_0018762 3300061734 Bacteria 4906
489 Ga0530510_0057704 3300061734 Bacteria 2806
490 2583153374 2582580736 Bacteria 5325865
491 2920108646 2920107658 Bacteria 10042636
492 8055161929 8055157932 Bacteria 6429399
493 Ga0213875_10000155
494 JGI25407J50210_10009821
495 JGI26141J51220_1001313
496 Ga0065712_10140626
497 Ga0070676_10107500
498 Ga0070690_100304820
499 Ga0068869_100010235
500 Ga0068869_100170789
501 Ga0070680_100176428
502 Ga0070661_100139101
503 Ga0070669_100068582
504 Ga0070669_100243169
505 Ga0070669_100428608
506 Ga0070675_100093682
507 Ga0070671_100244842
508 Ga0070673_100044728
509 Ga0070703_10012418
510 Ga0070709_10008360
511 Ga0070709_10246952
512 Ga0070714_100000316
513 Ga0070714_100079849
514 Ga0070714_100149188
515 Ga0070713_100018076
516 Ga0070713_100046285
517 Ga0070713_100212368
518 Ga0070713_100570241
519 Ga0070710_10020779
520 Ga0070710_10198080
521 Ga0070711_100137324
522 Ga0070700_100181871
523 Ga0070694_100009482
524 Ga0070708_100017529
525 Ga0070708_100190813
526 Ga0070708_100306549
527 Ga0070663_100314875
528 Ga0070662_100123802
529 Ga0070681_10156047
530 Ga0068867_100221789
531 Ga0070706_100049026
532 Ga0070706_100089318
533 Ga0070706_100100957
534 Ga0070707_100011933
535 Ga0070707_100021834
536 Ga0070707_100130524
537 Ga0070707_100202971
538 Ga0070707_100282917
539 Ga0070698_100001869
540 Ga0070698_100005603
541 Ga0070698_100006730
542 Ga0070698_100027373
543 Ga0070698_100118812
544 Ga0070699_100001708
545 Ga0070699_100003323
546 Ga0070679_100115597
547 Ga0070679_100138339
548 Ga0070684_100010753
549 Ga0070684_100488813
550 Ga0070697_100024352
551 Ga0070672_100056857
552 Ga0070672_100063587
553 Ga0070695_100158818
554 Ga0070665_100154070
555 Ga0070704_100017118
556 Ga0070704_100454554
557 Ga0070664_100011889
558 Ga0068854_100136913
559 Ga0070702_100022989
560 Ga0068861_100063611
561 Ga0068863_100015955
562 Ga0068863_100668688
563 Ga0068862_100032636
564 Ga0081538_10002399
565 Ga0081540_1000277
566 Ga0070717_10014044
567 Ga0070717_10113735
568 Ga0070717_10140368
569 Ga0070715_10009962
570 Ga0070716_100023461
571 Ga0070716_100043564
572 Ga0070712_100015282
573 Ga0070712_100072729
574 Ga0070712_100430249
575 Ga0097621_100474120
576 Ga0075428_100002682
577 Ga0075428_100037541
578 Ga0075430_100010463
579 Ga0075431_100106342
580 Ga0075431_100280648
581 Ga0075433_10000429
582 Ga0075434_100000669
583 Ga0075434_100351578
584 Ga0075434_100410836
585 Ga0075429_100026030
586 Ga0105240_10591321
587 Ga0111539_10000873
588 Ga0111539_10105313
589 Ga0114129_10068552
590 Ga0114129_10166859
591 Ga0105243_10291442
592 Ga0105241_10290926
593 Ga0105242_10018345
594 Ga0105248_10243045
595 Ga0105249_10606173
596 Ga0105249_10615791
597 Ga0105246_10352463
598 Ga0157338_1000959
599 Ga0157373_10273270
600 Ga0157369_10747711
601 Ga0157378_10171717
602 Ga0157378_10616200
603 Ga0163162_10261434
604 Ga0157375_10084907
605 Ga0157375_10286787
606 Ga0163163_10165777
607 Ga0157380_10179588
608 Ga0157380_10188248
609 Ga0157380_10284103
610 Ga0157380_10302363
611 Ga0157377_10035140
612 Ga0213875_10000339
613 Ga0213875_10022536
614 Ga0224712_10153265
615 Ga0224572_1003897
616 Ga0207692_10021421
617 Ga0207692_10049857
618 Ga0207692_10076485
619 Ga0207710_10035460
620 Ga0207647_10039146
621 Ga0207685_10015749
622 Ga0207699_10003017
623 Ga0207699_10024105
624 Ga0207643_10020924
625 Ga0207684_10016506
626 Ga0207684_10080892
627 Ga0207684_10158697
628 Ga0207654_10079151
629 Ga0207707_10137831
630 Ga0207695_10258397
631 Ga0207693_10009643
632 Ga0207693_10043421
633 Ga0207663_10035568
634 Ga0207663_10090623
635 Ga0207657_10028172
636 Ga0207649_10180254
637 Ga0207646_10034438
638 Ga0207646_10100074
639 Ga0207646_10104418
640 Ga0207646_10135177
641 Ga0207681_10177231
642 Ga0207694_10073364
643 Ga0207659_10099412
644 Ga0207700_10013707
645 Ga0207700_10023116
646 Ga0207700_10053625
647 Ga0207700_10064961
648 Ga0207700_10075076
649 Ga0207664_10010480
650 Ga0207664_10011656
651 Ga0207664_10021572
652 Ga0207664_10049554
653 Ga0207664_10131476
654 Ga0207664_10158816
655 Ga0207664_10339760
656 Ga0207706_10129292
657 Ga0207665_10018893
658 Ga0207691_10043562
659 Ga0207691_10254934
660 Ga0207689_10002372
661 Ga0207689_10029948
662 Ga0207661_10216337
663 Ga0207661_10615858
664 Ga0207679_10329106
665 Ga0207651_10077270
666 Ga0207712_10012314
667 Ga0207668_10560730
668 Ga0207640_10609634
669 Ga0207658_10122387
670 Ga0207678_10020717
671 Ga0207678_10082375
672 Ga0207708_10055784
673 Ga0207674_10014831
674 Ga0207675_100025350
675 Ga0207675_100097074
676 Ga0207683_10006862
677 Ga0209981_1004044
678 Ga0209996_1004713
679 Ga0210000_1003244
680 Ga0209999_1001647
681 Ga0209982_1002929
682 Ga0209970_1002215
683 Ga0209983_1000239
684 Ga0209971_1000259
685 Ga0209971_1027048
686 Ga0209998_10001304
687 Ga0209974_10000208
688 Ga0209974_10024774
689 Ga0207428_10003142
690 Ga0268266_10122674
691 Ga0268265_10042024
692 Ga0265331_10054203
693 Ga0307405_10002750
694 Ga0307410_10118405
695 Ga0307410_10167602
696 Ga0307409_100417595
697 Ga0307414_10194222
698 Ga0307415_100073268
699 Ga0373926_0000391
700 Ga0373926_0002426
701 Ga0373928_0028514
702 Ga0373934_0000316
703 Ga0373934_0160989
704 Ga0373940_0001032
705 Ga0373944_0002985
706 Ga0373952_0032288
707 Ga0373923_0000531
708 Ga0373923_0041437
709 Ga0373936_0001289
710 Ga0373936_0008531
711 Ga0373936_0012893
712 Ga0373936_0054310
713 Ga0373939_0010709
714 Ga0373945_0000251
715 Ga0373945_0001471
716 Ga0373945_0078833
717 Ga0373953_0002696
718 Ga0373953_0016115
719 Ga0373954_0128821
720 Ga0373954_0250257
721 Ga0373956_0000827
722 Ga0373956_0008509
723 Ga0373956_0065370
724 Ga0373957_0001774
725 Ga0373957_0013298
726 Ga0373957_0048796
727 Ga0373960_0019591
728 Ga0373943_0000474
729 Ga0373943_0001385
730 Ga0373946_0000343
731 Ga0373946_0000943
732 Ga0373955_0005178
733 Ga0373955_0221710
734 Ga0373942_0011615
735 Ga0373924_0015239
736 Ga0373924_0022853
737 Ga0373931_0078964
738 Ga0373935_0000920
739 Ga0373935_0071641
740 Ga0373935_0179645
741 Ga0373927_0003038
742 Ga0373927_0004577
743 Ga0373933_0003895
744 Ga0373933_0009534
745 Ga0373933_0173581
746 Ga0373947_0000088
747 Ga0373947_0003414
748 Ga0373947_0045360
749 Ga0373937_0000180
750 Ga0373937_0070928
751 Ga0373937_0254780
752 Ga0373937_0393955
753 Ga0373925_0026185
754 Ga0373925_0102239
755 Ga0373925_0258472
756 Ga0373925_0359124
757 Ga0395900_0082357
758 Ga0395900_0244170
759 Ga0395898_0009579
760 Ga0395905_0000054
761 Ga0436364_0047432
762 Ga0436364_0496408
763 Ga0436364_0525485
764 Ga0436364_0869026
765 Ga0436364_0940200
766 Ga0436364_0984343
767 Ga0436364_1112250
768 Ga0436364_1196429
769 Ga0395901_0068328
770 Ga0436363_0558013
771 Ga0436362_0089324
772 Ga0436362_0687975
773 Ga0439439_0029327
774 Ga0451833_1361763
775 Ga0439442_036212
776 Ga0450923_001751
777 Ga0450923_002718
778 Ga0450894_023943
779 Ga0450896_011282
780 Ga0450898_004498
781 Ga0439446_0012146
782 Ga0439446_0035578
783 Ga0450908_003484
784 Ga0450908_023168
785 Ga0439434_0008414
786 Ga0439434_0008508
787 Ga0450918_004494
788 Ga0453684_0236113
789 Ga0466968_0042049
790 Ga0466970_0187463
791 Ga0495592_0014628
792 Ga0495603_0134298
793 Ga0495629_0003040
794 Ga0495641_0002719
795 Ga0495651_0005482
796 Ga0495651_0020730
797 Ga0495651_0065590
798 Ga0495651_0199241
799 Ga0495653_0004467
800 Ga0495653_0007879
801 Ga0495653_0051340
802 Ga0495653_0078472
803 Ga0495653_0204352
804 Ga0495580_0046975
805 Ga0495582_0003279
806 Ga0495582_0036116
807 Ga0495639_0000521
808 Ga0495639_0106389
809 Ga0495662_0004634
810 Ga0495664_0056469
811 Ga0495664_0061321
812 Ga0495664_0104049
813 Ga0495664_0189920
814 Ga0495594_0012303
815 Ga0495608_0008274
816 Ga0495608_0012779
817 Ga0495608_0081090
818 Ga0495618_0004600
819 Ga0495618_0018811
820 Ga0495628_0103714
821 Ga0495630_0001083
822 Ga0495630_0274658
823 Ga0495630_0381203
824 Ga0495666_0008391
825 Ga0495652_0078376
826 Ga0495652_0178434
827 Ga0495652_0236253
828 Ga0495665_0005100
829 Ga0495665_0193734
830 Ga0495640_0008007
831 Ga0495640_0046982
832 Ga0495586_0004460
833 Ga0495587_0025170
834 Ga0495587_0050016
835 Ga0495587_0133764
836 Ga0495645_0012298
837 Ga0495645_0033424
838 Ga0495667_0001089
839 Ga0495667_0027510
840 Ga0495667_0042738
841 Ga0495667_0077589
842 Ga0495667_0110318
843 Ga0495634_0005196
844 Ga0495634_0035896
845 Ga0495634_0128513
846 Ga0495635_0000707
847 Ga0495635_0012626
848 Ga0495635_0030555
849 Ga0495635_0085701
850 Ga0495635_0201552
851 Ga0495588_0096795
852 Ga0495657_0004894
853 Ga0495657_0007618
854 Ga0495657_0011034
855 Ga0495657_0090542
856 Ga0495657_0326248
857 Ga0495599_0059795
858 Ga0495599_0141395
859 Ga0495646_0012761
860 Ga0495646_0130044
861 Ga0495658_0002090
862 Ga0495658_0272525
863 Ga0495613_0002231
864 Ga0495613_0129364
865 Ga0495624_0002287
866 Ga0495624_0008545
867 Ga0495600_0001323
868 Ga0495600_0038966
869 Ga0495600_0082689
870 Ga0495600_0146857
871 Ga0495600_0228549
872 Ga0495581_0004079
873 Ga0495581_0062392
874 Ga0495674_0001949
875 Ga0495674_0009683
876 Ga0495676_0002065
877 Ga0495680_0020930
878 Ga0495680_0027812
879 Ga0495680_0050861
880 Ga0495680_0053543
881 Ga0495680_0263096
882 Ga0495675_0043151
883 Ga0495684_0005068
884 Ga0495684_0019290
885 Ga0495593_0002200
886 Ga0495602_0104056
887 Ga0495602_0139128
888 Ga0495602_0155993
889 Ga0495614_0030287
890 Ga0496101_0593099
891 Ga0496102_0323122
892 Ga0496103_0016745
893 Ga0496103_0034480
894 Ga0496104_0041261
895 Ga0496105_0063578
896 Ga0496105_0583130
897 Ga0496106_0041598
898 Ga0496106_0077966
899 Ga0496109_0102827
900 Ga0496110_0056455
901 Ga0496110_0163516
902 Ga0496110_0349004
903 Ga0496111_0015590
904 Ga0496112_0299637
905 Ga0496112_0542965
906 Ga0496113_0174169
907 Ga0496114_0092358
908 Ga0496115_0056762
909 Ga0496122_0034451
910 Ga0496126_0306320
911 Ga0501031_0020866
912 Ga0501032_0061622
913 Ga0501036_0007089
914 Ga0501036_0092163
915 Ga0501036_0199909
916 Ga0501037_0028535
917 Ga0501038_0373767
918 Ga0501039_0003379
919 Ga0501039_0009735
920 Ga0501040_0154821
921 Ga0501040_0315555
922 Ga0501040_0451528
923 Ga0501041_0025143
924 Ga0501041_0124718
925 Ga0501042_0023075
926 Ga0501042_0061404
927 Ga0501042_0438472
928 Ga0501046_0024143
929 Ga0501048_0094858
930 Ga0501048_0162136
931 Ga0501067_0026576
932 Ga0501068_0023000
933 Ga0501068_0056477
934 Ga0501071_0076552
935 Ga0501071_0164533
936 Ga0501071_0335838
937 Ga0501072_0026685
938 Ga0501072_0064189
939 Ga0501072_0067672
940 Ga0501072_0401141
941 Ga0501073_0034943
942 Ga0501075_0063357
943 Ga0501076_0016571
944 Ga0501076_0017631
945 Ga0501076_0040393
946 Ga0501077_0019339
947 Ga0501079_0125030
948 Ga0501079_0219732
949 Ga0501079_0338083
950 Ga0501080_0339103
951 Ga0501080_0427431
952 Ga0501081_0015566
953 Ga0501081_0158971
954 Ga0501035_0241082
955 Ga0501044_0160440
956 Ga0501044_0534331
957 Ga0501045_0020030
958 Ga0501045_0024859
959 Ga0501045_0198340
960 nmdc:mga05p37_43426_c1
961 nmdc:mga05p37_90833_c1
962 nmdc:mga08y16_1112087_c1
963 nmdc:mga08y16_61238_c1
964 nmdc:mga0n895_243696_c1
965 nmdc:mga0n895_3107_c1
966 nmdc:mga0rr50_5308_c1
967 nmdc:mga08x19_155804_c1
968 nmdc:mga0a205_3727_c1
969 Ga0495612_0006898
970 Ga0495619_0005208
971 Ga0495619_0563926
972 Ga0500604_0069789
973 Ga0501084_0074739
974 Ga0501084_0146268
975 Ga0501084_0189313
976 Ga0501084_0292648
977 Ga0501082_0015267
978 Ga0501082_0049675
979 Ga0501082_0091593
980 Ga0530510_0018762
981 Ga0530510_0057704
982 2583153374
983 2920108646
984 8055161929

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02548

Pantoate_transf

Ketopantoate hydroxymethyltransferase

37

293

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1oy0-assembly1.cif.gz_A the crystal structure of the first enzyme of pantothenate biosynthetic pathway, ketopantoate hydroxymethyltransferase from mycobacterium tuberculosis shows a decameric assembly and terminal helix-swapping 0.9724 1 259
1oy0-assembly1.cif.gz_A the crystal structure of the first enzyme of pantothenate biosynthetic pathway, ketopantoate hydroxymethyltransferase from mycobacterium tuberculosis shows a decameric assembly and terminal helix-swapping 0.9569 1 259
1o66-assembly1.cif.gz_E crystal structure of 3-methyl-2-oxobutanoate hydroxymethyltransferase 0.8867 1 256
1o66-assembly1.cif.gz_B crystal structure of 3-methyl-2-oxobutanoate hydroxymethyltransferase 0.8791 1 256
3ez4-assembly1.cif.gz_D crystal structure of 3-methyl-2-oxobutanoate hydroxymethyltransferase from burkholderia pseudomallei 0.8759 1 260
ID Description Score Start End Superfamily
af_Q5ABB3_27_304_3.20.20.60 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9789 1 262 3.20.20.60
af_Q9AWZ7_81_360_3.20.20.60 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9758 1 262 3.20.20.60
af_Q5ABB3_27_304_3.20.20.60 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9752 1 262 3.20.20.60
af_Q2FV21_2_270_3.20.20.60 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9729 1 261 3.20.20.60
1oy0A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9724 1 259 3.20.20.60
ID Description Score Start End GO Terms
AF-A0A2N2F8I0-F1-model_v4 3-methyl-2-oxobutanoate hydroxymethyltransferase (EC 2.1.2.11) 0.9941 1 114 GO:0000287
GO:0003864
GO:0005737
GO:0008168
GO:0015940
GO:0032259
AF-A0A0S4QZC2-F1-model_v4 3-methyl-2-oxobutanoate hydroxymethyltransferase (EC 2.1.2.11) (Ketopantoate hydroxymethyltransferase) (KPHMT) 0.9934 2 261 GO:0000287
GO:0003864
GO:0005737
GO:0008168
GO:0015940
GO:0032259
AF-E5XR57-F1-model_v4 3-methyl-2-oxobutanoate hydroxymethyltransferase (EC 2.1.2.11) (Ketopantoate hydroxymethyltransferase) (KPHMT) 0.9934 1 261 GO:0000287
GO:0003864
GO:0005737
GO:0008168
GO:0015940
GO:0032259
AF-A0A660Q1U0-F1-model_v4 3-methyl-2-oxobutanoate hydroxymethyltransferase (EC 2.1.2.11) 0.9933 1 115 GO:0000287
GO:0003864
GO:0008168
GO:0015940
GO:0032259
AF-A0A7W9Q683-F1-model_v4 3-methyl-2-oxobutanoate hydroxymethyltransferase (EC 2.1.2.11) (Ketopantoate hydroxymethyltransferase) (KPHMT) 0.9931 1 262 GO:0000287
GO:0003864
GO:0005737
GO:0008168
GO:0015940
GO:0032259

Map