F454267

General Info

Members Datasets Scaffolds Average Seq Length
492 246 482 229

Family's Representative Sequence

Representative Sequence 3300014968|Ga0157379_10228800|Ga0157379_102288002
Length 273
Sequence VKHILVVDDEPRIAEIARDYLERAGYRVTVASNGVDALAIARTRQPDLLVLDLGLPQMDGLDVTRALRRQSNVPIIMLTARVDESDTLIGLELGADDYVTKPFSPKELVARVRAVFRRVDEAPERGGVIRAGGVTLDKPRMDVSVDDRHVDLTATEFELLATLARQPGRVFTRGQLLDAIRGEAVESFDRAIDAHIKNLRRKLEPDPRNPRYVLTVHGVGYKFVDILCNPLIIPQTSPSLCSCVRGPRRSSGRSWRCKRPAAAPVRTTAQTRG

Samples

Sample ID Description Type Environment
1 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
2 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
3 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
4 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
5 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
6 2739367663 Pedobacter sp. YR510 Isolate Unclassified
7 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
8 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
9 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
10 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
11 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
12 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
67 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
68 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
69 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
70 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
71 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
72 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
149 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
153 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
154 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
155 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
156 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
157 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
158 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
159 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
160 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
161 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
162 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
163 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
164 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
165 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
166 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
167 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
168 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
169 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
170 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
171 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
172 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
173 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
174 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
175 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
176 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
177 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
178 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
179 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
180 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
181 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
182 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
183 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
184 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
185 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
186 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
187 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
188 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
189 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
190 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
191 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
192 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
193 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
194 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
195 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
196 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
197 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
198 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
199 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
200 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
201 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
202 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
203 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
204 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
205 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
206 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
207 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
208 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
209 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
210 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
211 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
212 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
213 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
214 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
215 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
216 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
217 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
218 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
219 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
220 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
221 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
222 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
223 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
224 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
225 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
226 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
227 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
228 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
229 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
230 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
231 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
232 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
233 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
234 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
235 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
236 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
237 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
238 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
239 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
240 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
241 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
242 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
243 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
244 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
245 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
246 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.97
Metatranscriptomes 0
Isolates 2.03

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.49
Nodule 0
Rhizoplane 5.28
Rhizosphere 86.38
Stem 0
Stem Tuber 0
Unclassified 2.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10016562 3300002459 Bacteria 1520
2 Ga0055541_1000921 3300003841 Bacteria 7025
3 Ga0058692_1000128 3300003856 Bacteria 48036
4 Ga0065712_10003711 3300005290 Bacteria 6003
5 Ga0065715_10099610 3300005293 Bacteria 3390
6 Ga0065715_10249122 3300005293 Bacteria 1173
7 Ga0065715_10361679 3300005293 Bacteria 934
8 Ga0065707_10026392 3300005295 Bacteria 1198
9 Ga0065707_10458283 3300005295 Bacteria 794
10 Ga0070676_10007110 3300005328 Bacteria 5994
11 Ga0070676_10046925 3300005328 Bacteria 2521
12 Ga0070683_100001129 3300005329 Bacteria 20187
13 Ga0070690_100056763 3300005330 Bacteria 2511
14 Ga0070690_100323279 3300005330 Bacteria 1112
15 Ga0070670_100153540 3300005331 Bacteria 1993
16 Ga0070670_100176157 3300005331 Bacteria 1856
17 Ga0070677_10039894 3300005333 Bacteria 1845
18 Ga0070666_10082537 3300005335 Bacteria 2198
19 Ga0070666_10093575 3300005335 Bacteria 2066
20 Ga0070666_10266729 3300005335 Bacteria 1215
21 Ga0070680_100151638 3300005336 Bacteria 1946
22 Ga0070682_100009570 3300005337 Bacteria 5485
23 Ga0070682_100013077 3300005337 Bacteria 4768
24 Ga0070682_100027740 3300005337 Bacteria 3399
25 Ga0068868_100457399 3300005338 Bacteria 1111
26 Ga0070661_100058001 3300005344 Bacteria 2837
27 Ga0070668_100037437 3300005347 Bacteria 3704
28 Ga0070668_100364701 3300005347 Bacteria 1226
29 Ga0070669_100067057 3300005353 Bacteria 2646
30 Ga0070669_100068483 3300005353 Bacteria 2620
31 Ga0070669_100158391 3300005353 Bacteria 1757
32 Ga0070675_100089304 3300005354 Bacteria 2580
33 Ga0070671_100048786 3300005355 Bacteria 3522
34 Ga0070671_100084277 3300005355 Bacteria 2658
35 Ga0070674_100125138 3300005356 Bacteria 1908
36 Ga0070674_100395974 3300005356 Bacteria 1127
37 Ga0070673_100062947 3300005364 Bacteria 2950
38 Ga0070659_100186866 3300005366 Bacteria 1702
39 Ga0070667_100282718 3300005367 Bacteria 1490
40 Ga0070701_10018259 3300005438 Bacteria 3294
41 Ga0070705_100070876 3300005440 Bacteria 2106
42 Ga0070700_100012124 3300005441 Bacteria 4798
43 Ga0070694_100002461 3300005444 Bacteria 10933
44 Ga0070694_100034137 3300005444 Bacteria 3353
45 Ga0070694_100246540 3300005444 Bacteria 1350
46 Ga0070708_100320923 3300005445 Bacteria 1459
47 Ga0070678_100151471 3300005456 Bacteria 1868
48 Ga0070662_100090479 3300005457 Bacteria 2297
49 Ga0070662_100305748 3300005457 Bacteria 1293
50 Ga0068867_100005156 3300005459 Bacteria 9226
51 Ga0070706_100288006 3300005467 Bacteria 1533
52 Ga0070698_100062615 3300005471 Bacteria 3753
53 Ga0070698_100239614 3300005471 Bacteria 1747
54 Ga0070699_100133970 3300005518 Bacteria 2185
55 Ga0070684_100000586 3300005535 Bacteria 25062
56 Ga0070684_100014631 3300005535 Bacteria 6363
57 Ga0070697_100160116 3300005536 Bacteria 1901
58 Ga0070672_100040467 3300005543 Bacteria 3576
59 Ga0070672_100310073 3300005543 Bacteria 1339
60 Ga0070672_100426975 3300005543 Bacteria 1139
61 Ga0070672_100844654 3300005543 Bacteria 807
62 Ga0070686_100000831 3300005544 Bacteria 17877
63 Ga0070686_100136802 3300005544 Bacteria 1701
64 Ga0070695_100010483 3300005545 Bacteria 5533
65 Ga0070695_100111143 3300005545 Bacteria 1860
66 Ga0070696_100002548 3300005546 Bacteria 12070
67 Ga0070696_100026147 3300005546 Bacteria 3970
68 Ga0070696_100189753 3300005546 Bacteria 1529
69 Ga0070693_100005083 3300005547 Bacteria 6286
70 Ga0070704_100033593 3300005549 Bacteria 3470
71 Ga0070704_100089053 3300005549 Bacteria 2295
72 Ga0070704_100094666 3300005549 Bacteria 2235
73 Ga0070704_100129364 3300005549 Bacteria 1954
74 Ga0068855_100127244 3300005563 Bacteria 2912
75 Ga0068855_100498210 3300005563 Bacteria 1324
76 Ga0070664_100003464 3300005564 Bacteria 12741
77 Ga0070664_100715341 3300005564 Bacteria 934
78 Ga0068857_100816824 3300005577 Bacteria 891
79 Ga0068854_100067466 3300005578 Bacteria 2606
80 Ga0070702_100046258 3300005615 Bacteria 2466
81 Ga0068852_101028385 3300005616 Bacteria 843
82 Ga0068859_100051609 3300005617 Bacteria 4134
83 Ga0068859_100522101 3300005617 Bacteria 1282
84 Ga0068859_100559669 3300005617 Bacteria 1238
85 Ga0068864_100186587 3300005618 Bacteria 1898
86 Ga0068864_100257551 3300005618 Bacteria 1622
87 Ga0068861_100006307 3300005719 Bacteria 8073
88 Ga0068861_100167192 3300005719 Bacteria 1819
89 Ga0068863_100023252 3300005841 Bacteria 5923
90 Ga0068863_100912499 3300005841 Bacteria 879
91 Ga0068858_100254314 3300005842 Bacteria 1669
92 Ga0068860_101102976 3300005843 Bacteria 813
93 Ga0068862_100012433 3300005844 Bacteria 7043
94 Ga0068862_100019281 3300005844 Bacteria 5691
95 Ga0068862_100086535 3300005844 Bacteria 2725
96 Ga0068862_100136640 3300005844 Bacteria 2173
97 Ga0068862_100279847 3300005844 Bacteria 1529
98 Ga0068862_101080438 3300005844 Bacteria 797
99 Ga0081538_10052923 3300005981 Bacteria 2420
100 Ga0075368_10006466 3300006042 Bacteria 4094
101 Ga0075368_10014451 3300006042 Bacteria 2916
102 Ga0075368_10143571 3300006042 Bacteria 995
103 Ga0075364_10067628 3300006051 Bacteria 2349
104 Ga0075364_10070184 3300006051 Bacteria 2306
105 Ga0075432_10089504 3300006058 Bacteria 1125
106 Ga0075367_10040707 3300006178 Bacteria 2714
107 Ga0075367_10107125 3300006178 Bacteria 1713
108 Ga0075367_10352523 3300006178 Bacteria 929
109 Ga0075366_10004695 3300006195 Bacteria 7353
110 Ga0075366_10011572 3300006195 Bacteria 4984
111 Ga0075366_10016080 3300006195 Bacteria 4296
112 Ga0075366_10219054 3300006195 Bacteria 1159
113 Ga0075370_10076538 3300006353 Bacteria 1919
114 Ga0075428_100001713 3300006844 Bacteria 23426
115 Ga0075428_100007896 3300006844 Bacteria 11795
116 Ga0075428_100035133 3300006844 Bacteria 5525
117 Ga0075428_100041905 3300006844 Bacteria 5034
118 Ga0075428_100056674 3300006844 Bacteria 4291
119 Ga0075428_100082739 3300006844 Bacteria 3502
120 Ga0075428_100204613 3300006844 Bacteria 2133
121 Ga0075428_100430165 3300006844 Bacteria 1414
122 Ga0075428_100659236 3300006844 Bacteria 1116
123 Ga0075428_101296353 3300006844 Bacteria 766
124 Ga0075430_100011218 3300006846 Bacteria 7599
125 Ga0075430_100042982 3300006846 Bacteria 3821
126 Ga0075430_100044807 3300006846 Bacteria 3739
127 Ga0075430_100102363 3300006846 Bacteria 2391
128 Ga0075431_100006444 3300006847 Bacteria 11655
129 Ga0075431_100060816 3300006847 Bacteria 3898
130 Ga0075431_100082874 3300006847 Bacteria 3311
131 Ga0075431_100097351 3300006847 Bacteria 3038
132 Ga0075431_100415420 3300006847 Bacteria 1345
133 Ga0075431_100635610 3300006847 Bacteria 1049
134 Ga0075433_10000648 3300006852 Bacteria 23403
135 Ga0075433_10082214 3300006852 Bacteria 2840
136 Ga0075434_100000721 3300006871 Bacteria 25889
137 Ga0075434_100011731 3300006871 Bacteria 8277
138 Ga0075434_100012138 3300006871 Bacteria 8158
139 Ga0075434_100087137 3300006871 Bacteria 3123
140 Ga0075434_100354855 3300006871 Bacteria 1487
141 Ga0075434_100651275 3300006871 Bacteria 1072
142 Ga0075434_100719944 3300006871 Bacteria 1015
143 Ga0075434_101199427 3300006871 Bacteria 771
144 Ga0075429_100016987 3300006880 Bacteria 6293
145 Ga0075429_100057027 3300006880 Bacteria 3400
146 Ga0075429_100057634 3300006880 Bacteria 3382
147 Ga0075429_100789704 3300006880 Bacteria 831
148 Ga0068865_100186987 3300006881 Bacteria 1599
149 Ga0068865_100347971 3300006881 Bacteria 1200
150 Ga0075436_100001714 3300006914 Bacteria 15015
151 Ga0075436_100026167 3300006914 Bacteria 4017
152 Ga0075436_100063724 3300006914 Bacteria 2547
153 Ga0075436_100413984 3300006914 Bacteria 978
154 Ga0075436_100439376 3300006914 Bacteria 949
155 Ga0097620_100051609 3300006931 Bacteria 4134
156 Ga0097620_100522101 3300006931 Bacteria 1282
157 Ga0097620_100559697 3300006931 Bacteria 1238
158 Ga0075435_100000194 3300007076 Bacteria 36738
159 Ga0075435_100014302 3300007076 Bacteria 5927
160 Ga0075435_100034736 3300007076 Bacteria 3997
161 Ga0075435_100048938 3300007076 Bacteria 3397
162 Ga0075435_100066269 3300007076 Bacteria 2937
163 Ga0075435_100075373 3300007076 Bacteria 2762
164 Ga0075435_100075874 3300007076 Bacteria 2754
165 Ga0075435_100123746 3300007076 Bacteria 2160
166 Ga0075435_100350812 3300007076 Bacteria 1265
167 Ga0099794_10157334 3300007265 Bacteria 1155
168 Ga0105240_10143538 3300009093 Bacteria 2852
169 Ga0111539_10003496 3300009094 Bacteria 20721
170 Ga0111539_10012297 3300009094 Bacteria 10727
171 Ga0111539_10015082 3300009094 Bacteria 9631
172 Ga0111539_10028441 3300009094 Bacteria 6819
173 Ga0111539_10058660 3300009094 Bacteria 4566
174 Ga0111539_10081307 3300009094 Bacteria 3811
175 Ga0111539_10106882 3300009094 Bacteria 3283
176 Ga0111539_10120490 3300009094 Bacteria 3074
177 Ga0111539_10141696 3300009094 Bacteria 2814
178 Ga0111539_10244636 3300009094 Bacteria 2088
179 Ga0111539_10299996 3300009094 Bacteria 1870
180 Ga0105245_10252552 3300009098 Bacteria 1714
181 Ga0114129_10001894 3300009147 Bacteria 28518
182 Ga0114129_10002646 3300009147 Bacteria 24923
183 Ga0114129_10008232 3300009147 Bacteria 14867
184 Ga0114129_10011164 3300009147 Bacteria 12805
185 Ga0114129_10017826 3300009147 Bacteria 10110
186 Ga0114129_10019384 3300009147 Bacteria 9687
187 Ga0114129_10027741 3300009147 Bacteria 8017
188 Ga0114129_10040050 3300009147 Bacteria 6608
189 Ga0114129_10049705 3300009147 Bacteria 5891
190 Ga0114129_10079577 3300009147 Bacteria 4557
191 Ga0114129_10107750 3300009147 Bacteria 3847
192 Ga0114129_10109253 3300009147 Bacteria 3818
193 Ga0114129_10181533 3300009147 Bacteria 2863
194 Ga0114129_10337183 3300009147 Bacteria 2001
195 Ga0114129_10419546 3300009147 Bacteria 1760
196 Ga0114129_10604545 3300009147 Bacteria 1420
197 Ga0114129_10846638 3300009147 Bacteria 1163
198 Ga0105243_10007218 3300009148 Bacteria 8539
199 Ga0105241_10665990 3300009174 Bacteria 947
200 Ga0105248_10037353 3300009177 Bacteria 5434
201 Ga0105248_10075879 3300009177 Bacteria 3778
202 Ga0105238_10834720 3300009551 Bacteria 938
203 Ga0105249_10014767 3300009553 Bacteria 6902
204 Ga0105249_10076416 3300009553 Bacteria 3104
205 Ga0105249_10181220 3300009553 Bacteria 2049
206 Ga0105249_10403160 3300009553 Bacteria 1398
207 Ga0105249_10818639 3300009553 Bacteria 996
208 Ga0105239_10397736 3300010375 Bacteria 1559
209 Ga0105246_10016936 3300011119 Bacteria 4627
210 Ga0105246_10141803 3300011119 Bacteria 1808
211 Ga0157378_10004825 3300013297 Bacteria 11816
212 Ga0157375_10043926 3300013308 Bacteria 4337
213 Ga0157375_10109162 3300013308 Bacteria 2863
214 Ga0157375_10682420 3300013308 Bacteria 1182
215 Ga0163163_10430384 3300014325 Bacteria 1379
216 Ga0163163_10929338 3300014325 Bacteria 933
217 Ga0157380_10006984 3300014326 Bacteria 7991
218 Ga0157380_10142197 3300014326 Bacteria 2063
219 Ga0157380_10346367 3300014326 Bacteria 1388
220 Ga0157380_10697394 3300014326 Bacteria 1020
221 Ga0157380_10969838 3300014326 Bacteria 881
222 Ga0157377_10204608 3300014745 Bacteria 1255
223 Ga0157379_10228800 3300014968 Bacteria 1685
224 Ga0157376_10095942 3300014969 Bacteria 2580
225 Ga0157376_10330210 3300014969 Bacteria 1453
226 Ga0163161_10479118 3300017792 Bacteria 1010
227 Ga0209566_100300 3300025225 Bacteria 44962
228 Ga0207697_10019981 3300025315 Bacteria 2743
229 Ga0207697_10254654 3300025315 Bacteria 777
230 Ga0207682_10043316 3300025893 Bacteria 1842
231 Ga0207680_10004399 3300025903 Bacteria 6681
232 Ga0207680_10151917 3300025903 Bacteria 1544
233 Ga0207645_10006786 3300025907 Bacteria 8174
234 Ga0207643_10062750 3300025908 Bacteria 2123
235 Ga0207684_10287940 3300025910 Bacteria 1417
236 Ga0207707_10402752 3300025912 Bacteria 1174
237 Ga0207695_10375767 3300025913 Bacteria 1307
238 Ga0207660_10114007 3300025917 Bacteria 2038
239 Ga0207649_10030489 3300025920 Bacteria 3195
240 Ga0207646_10383444 3300025922 Bacteria 1270
241 Ga0207681_10071697 3300025923 Bacteria 2417
242 Ga0207681_10656661 3300025923 Bacteria 870
243 Ga0207694_10453436 3300025924 Bacteria 1071
244 Ga0207650_10030255 3300025925 Bacteria 3898
245 Ga0207650_10109608 3300025925 Bacteria 2135
246 Ga0207659_10015920 3300025926 Bacteria 4885
247 Ga0207659_10163787 3300025926 Bacteria 1748
248 Ga0207659_10182193 3300025926 Bacteria 1665
249 Ga0207644_10167889 3300025931 Bacteria 1711
250 Ga0207690_10041392 3300025932 Bacteria 3019
251 Ga0207706_10066478 3300025933 Bacteria 3173
252 Ga0207706_10181050 3300025933 Bacteria 1851
253 Ga0207706_10317062 3300025933 Bacteria 1357
254 Ga0207686_10281396 3300025934 Bacteria 1228
255 Ga0207709_10055938 3300025935 Bacteria 2440
256 Ga0207670_10193456 3300025936 Bacteria 1540
257 Ga0207669_10089292 3300025937 Bacteria 2001
258 Ga0207704_10350641 3300025938 Bacteria 1149
259 Ga0207691_10016063 3300025940 Bacteria 7112
260 Ga0207691_10072118 3300025940 Bacteria 3115
261 Ga0207691_10732981 3300025940 Bacteria 833
262 Ga0207711_10033593 3300025941 Bacteria 4342
263 Ga0207711_10037902 3300025941 Bacteria 4098
264 Ga0207711_10052838 3300025941 Bacteria 3484
265 Ga0207661_10026955 3300025944 Bacteria 4385
266 Ga0207679_10303525 3300025945 Bacteria 1377
267 Ga0207667_10424804 3300025949 Bacteria 1352
268 Ga0207651_10126500 3300025960 Bacteria 1948
269 Ga0207651_10144918 3300025960 Bacteria 1840
270 Ga0207651_10553202 3300025960 Bacteria 1001
271 Ga0207712_10027589 3300025961 Bacteria 3792
272 Ga0207712_10371749 3300025961 Bacteria 1194
273 Ga0207712_10596139 3300025961 Bacteria 955
274 Ga0207668_10068322 3300025972 Bacteria 2526
275 Ga0207640_10038589 3300025981 Bacteria 3016
276 Ga0207640_10046360 3300025981 Bacteria 2796
277 Ga0207658_10239660 3300025986 Bacteria 1536
278 Ga0207677_10144493 3300026023 Bacteria 1826
279 Ga0207677_10220837 3300026023 Bacteria 1520
280 Ga0207677_10281175 3300026023 Bacteria 1366
281 Ga0207677_10368607 3300026023 Bacteria 1209
282 Ga0207703_10014415 3300026035 Bacteria 6164
283 Ga0207678_10044661 3300026067 Bacteria 3832
284 Ga0207708_10133683 3300026075 Bacteria 1941
285 Ga0207708_10350043 3300026075 Bacteria 1212
286 Ga0207641_10000787 3300026088 Bacteria 33852
287 Ga0207641_10538138 3300026088 Bacteria 1138
288 Ga0207641_10832257 3300026088 Bacteria 914
289 Ga0207648_10006036 3300026089 Bacteria 12081
290 Ga0207648_10348737 3300026089 Bacteria 1334
291 Ga0207676_10061980 3300026095 Bacteria 2964
292 Ga0207676_10169240 3300026095 Bacteria 1902
293 Ga0207676_10203977 3300026095 Bacteria 1749
294 Ga0207674_10408761 3300026116 Bacteria 1312
295 Ga0207675_100031461 3300026118 Bacteria 4942
296 Ga0207675_100072492 3300026118 Bacteria 3221
297 Ga0207675_100191832 3300026118 Bacteria 1960
298 Ga0207675_100293359 3300026118 Bacteria 1582
299 Ga0207675_100426721 3300026118 Bacteria 1310
300 Ga0207675_100467597 3300026118 Bacteria 1252
301 Ga0207683_10294516 3300026121 Bacteria 1484
302 Ga0209371_1000002 3300027312 Bacteria 1551985
303 Ga0209371_1000109 3300027312 Bacteria 141217
304 Ga0209813_10091501 3300027866 Bacteria 1022
305 Ga0207428_10000569 3300027907 Bacteria 43728
306 Ga0207428_10008813 3300027907 Bacteria 9095
307 Ga0207428_10010324 3300027907 Bacteria 8348
308 Ga0207428_10016271 3300027907 Bacteria 6403
309 Ga0207428_10027496 3300027907 Bacteria 4735
310 Ga0207428_10484143 3300027907 Bacteria 900
311 Ga0268265_10015651 3300028380 Bacteria 5193
312 Ga0268265_10068627 3300028380 Bacteria 2750
313 Ga0268265_10474492 3300028380 Bacteria 1173
314 Ga0268264_10754949 3300028381 Bacteria 969
315 Ga0307517_10012397 3300028786 Bacteria 11705
316 Ga0268256_1000002 3300030500 Bacteria 1535763
317 Ga0265332_10075004 3300031238 Bacteria 1438
318 Ga0265339_10000105 3300031249 Bacteria 68586
319 Ga0265316_10001844 3300031344 Bacteria 22283
320 Ga0307408_100007671 3300031548 Bacteria 7135
321 Ga0307408_100393543 3300031548 Bacteria 1188
322 Ga0316575_10126225 3300031665 Bacteria 1048
323 Ga0265314_10000002 3300031711 Bacteria 2092193
324 Ga0316576_10016511 3300031727 Bacteria 4988
325 Ga0316577_10007339 3300031733 Bacteria 5879
326 Ga0316577_10076038 3300031733 Bacteria 1875
327 Ga0307406_10022262 3300031901 Bacteria 3758
328 Ga0307412_10015038 3300031911 Bacteria 4577
329 Ga0307412_10017018 3300031911 Bacteria 4345
330 Ga0307409_100884860 3300031995 Bacteria 906
331 Ga0307416_100724123 3300032002 Bacteria 1086
332 Ga0307411_10077291 3300032005 Bacteria 2278
333 Ga0307415_100553953 3300032126 Bacteria 1015
334 Ga0307415_100636746 3300032126 Bacteria 954
335 Ga0373930_0022427 3300034816 Bacteria 1248
336 Ga0373950_0001574 3300034818 Bacteria 3003
337 Ga0373938_0001334 3300034957 Bacteria 3962
338 Ga0373928_0000747 3300035084 Bacteria 6364
339 Ga0373929_0002475 3300035085 Bacteria 3395
340 Ga0373940_0031184 3300035088 Bacteria 1421
341 Ga0373949_0002243 3300035090 Bacteria 5048
342 Ga0373952_0001940 3300035092 Bacteria 3748
343 Ga0373939_0001590 3300035114 Bacteria 5489
344 Ga0373941_0001410 3300035115 Bacteria 5065
345 Ga0373941_0083762 3300035115 Bacteria 1082
346 Ga0373960_0000217 3300035121 Bacteria 10554
347 Ga0373942_0001105 3300035207 Bacteria 7178
348 Ga0373961_0068218 3300035241 Bacteria 1094
349 Ga0316574_0014975 3300035398 Bacteria 4492
350 Ga0373947_0167359 3300035725 Bacteria 1425
351 Ga0316582_0057966 3300036647 Bacteria 2475
352 Ga0316582_0204448 3300036647 Bacteria 1348
353 Ga0316582_0343150 3300036647 Bacteria 1027
354 Ga0373925_0150188 3300037068 Bacteria 1829
355 Ga0373925_0214522 3300037068 Bacteria 1534
356 Ga0400490_37142 3300038726 Bacteria 1275
357 Ga0400485_11367 3300038735 Bacteria 22273
358 Ga0400486_17557 3300038742 Bacteria 1491
359 Ga0400486_19491 3300038742 Bacteria 18683
360 Ga0400483_183368 3300039062 Bacteria 2734
361 Ga0400489_48110 3300039093 Bacteria 7465
362 Ga0400487_07019 3300039110 Bacteria 5905
363 Ga0439431_0020719 3300041997 Bacteria 1573
364 Ga0439441_037187 3300042001 Bacteria 964
365 Ga0439434_0045787 3300042435 Bacteria 1350
366 Ga0439464_0003148 3300042439 Bacteria 4140
367 Ga0451577_0366440 3300042876 Bacteria 1307
368 Ga0453684_0000640 3300044712 Bacteria 126342
369 Ga0453684_0016890 3300044712 Bacteria 11357
370 Ga0453684_0386456 3300044712 Bacteria 1570
371 Ga0451576_0035389 3300045051 Bacteria 5298
372 Ga0451576_0070276 3300045051 Bacteria 3644
373 Ga0451576_0207118 3300045051 Bacteria 2048
374 Ga0495603_0042804 3300046455 Bacteria 2706
375 Ga0495629_0036298 3300046459 Bacteria 3480
376 Ga0495666_0000647 3300046526 Bacteria 15640
377 Ga0495665_0000343 3300046531 Bacteria 23520
378 Ga0495588_0090142 3300046674 Bacteria 1606
379 Ga0495658_0104503 3300046683 Bacteria 1695
380 Ga0495669_0302826 3300046684 Bacteria 771
381 Ga0495581_0064431 3300047315 Bacteria 2117
382 Ga0495674_0012568 3300047319 Bacteria 7976
383 Ga0495676_0013598 3300047321 Bacteria 7308
384 Ga0496100_0052021 3300048903 Bacteria 2661
385 Ga0496101_0027364 3300048904 Bacteria 3972
386 Ga0496102_0219323 3300048905 Bacteria 1793
387 Ga0496102_0629768 3300048905 Bacteria 996
388 Ga0496104_0033099 3300048907 Bacteria 4812
389 Ga0496105_0027302 3300048908 Bacteria 4662
390 Ga0496106_0044866 3300048909 Bacteria 3319
391 Ga0496106_0393092 3300048909 Bacteria 1114
392 Ga0496106_0516665 3300048909 Bacteria 959
393 Ga0496107_0111757 3300048910 Bacteria 2008
394 Ga0496108_0000512 3300048911 Bacteria 30311
395 Ga0496109_0068453 3300048912 Bacteria 3254
396 Ga0496109_0225734 3300048912 Bacteria 1762
397 Ga0496110_0021439 3300048913 Bacteria 5471
398 Ga0496110_0514795 3300048913 Bacteria 1089
399 Ga0496111_0055113 3300048914 Bacteria 2875
400 Ga0496112_0003921 3300048915 Bacteria 12456
401 Ga0496112_0398204 3300048915 Bacteria 1317
402 Ga0496113_0144851 3300048916 Bacteria 1871
403 Ga0496114_0127233 3300048917 Bacteria 2197
404 Ga0496115_0526855 3300048918 Bacteria 947
405 Ga0496116_0138005 3300048919 Bacteria 1377
406 Ga0496121_0152485 3300048924 Bacteria 1699
407 Ga0501068_0041640 3300049584 Bacteria 2761
408 Ga0501076_0379613 3300049592 Bacteria 1162
409 Ga0501279_014934 3300049775 Bacteria 1072
410 nmdc:mga00v17_302925_c1 3300050491 Bacteria 1038
411 nmdc:mga0k408_1542_c1 3300050493 Bacteria 12447
412 nmdc:mga0k408_9782_c1 3300050493 Bacteria 5176
413 nmdc:mga06z11_10606_c1 3300050494 Bacteria 3935
414 nmdc:mga04h51_13456_c1 3300050495 Bacteria 2316
415 nmdc:mga04h51_85868_c1 3300050495 Bacteria 1125
416 nmdc:mga07m45_18659_c1 3300050496 Bacteria 3750
417 nmdc:mga07m45_9623_c1 3300050496 Bacteria 5023
418 nmdc:mga05p37_13913_c1 3300050507 Bacteria 9643
419 nmdc:mga05p37_20502_c2 3300050507 Bacteria 5690
420 nmdc:mga05p37_250897_c1 3300050507 Bacteria 2123
421 nmdc:mga05p37_291644_c1 3300050507 Bacteria 1942
422 nmdc:mga05p37_4241_c1 3300050507 Bacteria 16747
423 nmdc:mga05p37_49374_c1 3300050507 Bacteria 5175
424 nmdc:mga05p37_644758_c1 3300050507 Bacteria 1187
425 nmdc:mga05p37_6919_c1 3300050507 Bacteria 13369
426 nmdc:mga05p37_74683_c1 3300050507 Bacteria 4172
427 nmdc:mga05p37_802289_c1 3300050507 Bacteria 1030
428 nmdc:mga05p37_81042_c1 3300050507 Bacteria 3998
429 nmdc:mga05p37_94195_c1 3300050507 Bacteria 3690
430 nmdc:mga09592_143381_c1 3300050508 Bacteria 2060
431 nmdc:mga09592_15773_c1 3300050508 Bacteria 6173
432 nmdc:mga09592_199963_c1 3300050508 Bacteria 1730
433 nmdc:mga09592_20053_c1 3300050508 Bacteria 5494
434 nmdc:mga09592_26467_c1 3300050508 Bacteria 4806
435 nmdc:mga0qj67_48815_c1 3300050509 Bacteria 3344
436 nmdc:mga0qj67_56449_c1 3300050509 Bacteria 3112
437 nmdc:mga0qj67_5697_c1 3300050509 Bacteria 9110
438 nmdc:mga06r32_127057_c1 3300050510 Bacteria 2519
439 nmdc:mga06r32_236644_c1 3300050510 Bacteria 1814
440 nmdc:mga06r32_25516_c1 3300050510 Bacteria 5498
441 nmdc:mga06r32_4645_c1 3300050510 Bacteria 12324
442 nmdc:mga06r32_53285_c1 3300050510 Bacteria 3876
443 nmdc:mga06r32_58541_c1 3300050510 Bacteria 3703
444 nmdc:mga06r32_622476_c1 3300050510 Bacteria 1049
445 nmdc:mga08y16_12595_c1 3300050511 Bacteria 8896
446 nmdc:mga08y16_15145_c1 3300050511 Bacteria 8107
447 nmdc:mga08y16_15920_c1 3300050511 Bacteria 7904
448 nmdc:mga08y16_46327_c1 3300050511 Bacteria 4552
449 nmdc:mga08y16_637952_c1 3300050511 Bacteria 1070
450 nmdc:mga08y16_69609_c1 3300050511 Bacteria 3668
451 nmdc:mga08y16_697596_c1 3300050511 Bacteria 1015
452 nmdc:mga08y16_79616_c1 3300050511 Bacteria 3415
453 nmdc:mga0n895_104230_c1 3300050512 Bacteria 2849
454 nmdc:mga0n895_1127571_c1 3300050512 Bacteria 761
455 nmdc:mga0n895_25758_c1 3300050512 Bacteria 5562
456 nmdc:mga0n895_30_c1 3300050512 Bacteria 84416
457 nmdc:mga0n895_366494_c1 3300050512 Bacteria 1459
458 nmdc:mga0n895_45771_c1 3300050512 Bacteria 4272
459 nmdc:mga0n895_707129_c1 3300050512 Bacteria 1003
460 nmdc:mga0n895_798130_c1 3300050512 Bacteria 935
461 nmdc:mga0n895_83666_c1 3300050512 Bacteria 3183
462 nmdc:mga0n895_88098_c1 3300050512 Bacteria 3103
463 nmdc:mga0rr50_103976_c1 3300050513 Bacteria 2236
464 nmdc:mga0rr50_2_c1 3300050513 Bacteria 373938
465 nmdc:mga0rr50_35288_c1 3300050513 Bacteria 3590
466 nmdc:mga0rr50_42901_c1 3300050513 Bacteria 3307
467 nmdc:mga0rr50_555960_c1 3300050513 Bacteria 977
468 nmdc:mga0rr50_867708_c1 3300050513 Bacteria 770
469 nmdc:mga08x19_126191_c1 3300050514 Bacteria 1719
470 nmdc:mga08x19_230_c1 3300050514 Bacteria 42633
471 nmdc:mga08x19_407531_c1 3300050514 Bacteria 954
472 nmdc:mga08x19_41654_c1 3300050514 Bacteria 2925
473 nmdc:mga08x19_6107_c1 3300050514 Bacteria 7122
474 nmdc:mga0a205_312029_c1 3300050515 Bacteria 1445
475 nmdc:mga0a205_422249_c1 3300050515 Bacteria 1195
476 nmdc:mga0a205_441956_c1 3300050515 Bacteria 1161
477 nmdc:mga0a205_547354_c1 3300050515 Bacteria 1013
478 nmdc:mga0a205_761_c1 3300050515 Bacteria 26018
479 Ga0500646_0180938 3300053090 Bacteria 714
480 Ga0500650_0000050 3300053098 Bacteria 39314
481 Ga0500616_0218147 3300053153 Bacteria 834
482 Ga0530510_0119701 3300061734 Bacteria 1932

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2739367663 2739648180 216
2 3300028786 Ga0307517_10012397 Ga0307517_100123979 218
3 3300005290 Ga0065712_10003711 Ga0065712_100037114 220
4 3300005329 Ga0070683_100001129 Ga0070683_1000011294 220
5 3300005331 Ga0070670_100176157 Ga0070670_1001761573 220
6 3300005335 Ga0070666_10082537 Ga0070666_100825373 220
7 3300005344 Ga0070661_100058001 Ga0070661_1000580013 220
8 3300005535 Ga0070684_100000586 Ga0070684_10000058613 220
9 3300005543 Ga0070672_100844654 Ga0070672_1008446541 220
10 3300013308 Ga0157375_10109162 Ga0157375_101091626 220
11 3300014325 Ga0163163_10929338 Ga0163163_109293381 220
12 3300025315 Ga0207697_10019981 Ga0207697_100199813 220
13 3300025903 Ga0207680_10151917 Ga0207680_101519171 220
14 3300025920 Ga0207649_10030489 Ga0207649_100304892 220
15 3300025925 Ga0207650_10109608 Ga0207650_101096082 220
16 3300025926 Ga0207659_10163787 Ga0207659_101637872 220
17 3300025940 Ga0207691_10732981 Ga0207691_107329811 220
18 3300025941 Ga0207711_10037902 Ga0207711_100379023 220
19 3300025944 Ga0207661_10026955 Ga0207661_100269553 220
20 3300026095 Ga0207676_10169240 Ga0207676_101692401 220
21 3300032126 Ga0307415_100636746 Ga0307415_1006367461 220
22 3300005471 Ga0070698_100239614 Ga0070698_1002396142 221
23 3300041997 Ga0439431_0020719 Ga0439431_0020719_139_828 221
24 3300042435 Ga0439434_0045787 Ga0439434_0045787_324_1013 221
25 3300045051 Ga0451576_0070276 Ga0451576_0070276_863_1552 221
26 3300014969 Ga0157376_10095942 Ga0157376_100959422 222
27 3300031911 Ga0307412_10015038 Ga0307412_100150385 222
28 3300037068 Ga0373925_0150188 Ga0373925_0150188_505_1203 222
29 3300006871 Ga0075434_101199427 Ga0075434_1011994271 223
30 3300006844 Ga0075428_101296353 Ga0075428_1012963531 224
31 3300005330 Ga0070690_100323279 Ga0070690_1003232792 225
32 3300005335 Ga0070666_10266729 Ga0070666_102667291 225
33 3300005338 Ga0068868_100457399 Ga0068868_1004573991 225
34 3300005543 Ga0070672_100040467 Ga0070672_1000404674 225
35 3300005549 Ga0070704_100033593 Ga0070704_1000335934 225
36 3300005617 Ga0068859_100051609 Ga0068859_1000516094 225
37 3300005617 Ga0068859_100559669 Ga0068859_1005596692 225
38 3300005841 Ga0068863_100023252 Ga0068863_1000232526 225
39 3300005842 Ga0068858_100254314 Ga0068858_1002543142 225
40 3300005844 Ga0068862_100012433 Ga0068862_1000124337 225
41 3300005844 Ga0068862_100279847 Ga0068862_1002798471 225
42 3300006042 Ga0075368_10143571 Ga0075368_101435712 225
43 3300006195 Ga0075366_10004695 Ga0075366_100046951 225
44 3300006844 Ga0075428_100001713 Ga0075428_1000017138 225
45 3300006846 Ga0075430_100011218 Ga0075430_1000112186 225
46 3300006847 Ga0075431_100082874 Ga0075431_1000828742 225
47 3300006847 Ga0075431_100635610 Ga0075431_1006356102 225
48 3300006852 Ga0075433_10000648 Ga0075433_1000064825 225
49 3300006852 Ga0075433_10082214 Ga0075433_100822142 225
50 3300006871 Ga0075434_100000721 Ga0075434_10000072116 225
51 3300006871 Ga0075434_100011731 Ga0075434_1000117314 225
52 3300006871 Ga0075434_100012138 Ga0075434_1000121385 225
53 3300006871 Ga0075434_100651275 Ga0075434_1006512752 225
54 3300006871 Ga0075434_100719944 Ga0075434_1007199442 225
55 3300006880 Ga0075429_100016987 Ga0075429_1000169874 225
56 3300006914 Ga0075436_100001714 Ga0075436_1000017143 225
57 3300006914 Ga0075436_100026167 Ga0075436_1000261672 225
58 3300006914 Ga0075436_100063724 Ga0075436_1000637243 225
59 3300006914 Ga0075436_100413984 Ga0075436_1004139842 225
60 3300006914 Ga0075436_100439376 Ga0075436_1004393762 225
61 3300006931 Ga0097620_100051609 Ga0097620_1000516092 225
62 3300006931 Ga0097620_100559697 Ga0097620_1005596971 225
63 3300007076 Ga0075435_100000194 Ga0075435_10000019417 225
64 3300007076 Ga0075435_100014302 Ga0075435_1000143023 225
65 3300007076 Ga0075435_100034736 Ga0075435_1000347364 225
66 3300007076 Ga0075435_100066269 Ga0075435_1000662693 225
67 3300007076 Ga0075435_100075373 Ga0075435_1000753733 225
68 3300007076 Ga0075435_100350812 Ga0075435_1003508122 225
69 3300007265 Ga0099794_10157334 Ga0099794_101573341 225
70 3300009094 Ga0111539_10003496 Ga0111539_100034969 225
71 3300009094 Ga0111539_10058660 Ga0111539_100586603 225
72 3300009147 Ga0114129_10001894 Ga0114129_100018949 225
73 3300009147 Ga0114129_10008232 Ga0114129_100082323 225
74 3300009147 Ga0114129_10040050 Ga0114129_100400502 225
75 3300009147 Ga0114129_10049705 Ga0114129_100497053 225
76 3300009147 Ga0114129_10107750 Ga0114129_101077503 225
77 3300009147 Ga0114129_10181533 Ga0114129_101815332 225
78 3300009147 Ga0114129_10846638 Ga0114129_108466382 225
79 3300009177 Ga0105248_10037353 Ga0105248_100373532 225
80 3300013308 Ga0157375_10682420 Ga0157375_106824201 225
81 3300014326 Ga0157380_10697394 Ga0157380_106973942 225
82 3300025903 Ga0207680_10004399 Ga0207680_100043997 225
83 3300025934 Ga0207686_10281396 Ga0207686_102813962 225
84 3300025936 Ga0207670_10193456 Ga0207670_101934562 225
85 3300025938 Ga0207704_10350641 Ga0207704_103506412 225
86 3300025940 Ga0207691_10016063 Ga0207691_100160637 225
87 3300025941 Ga0207711_10033593 Ga0207711_100335934 225
88 3300026023 Ga0207677_10220837 Ga0207677_102208372 225
89 3300026035 Ga0207703_10014415 Ga0207703_100144154 225
90 3300026075 Ga0207708_10350043 Ga0207708_103500432 225
91 3300026088 Ga0207641_10000787 Ga0207641_1000078728 225
92 3300026089 Ga0207648_10348737 Ga0207648_103487372 225
93 3300026118 Ga0207675_100467597 Ga0207675_1004675972 225
94 3300027866 Ga0209813_10091501 Ga0209813_100915012 225
95 3300027907 Ga0207428_10000569 Ga0207428_1000056933 225
96 3300027907 Ga0207428_10027496 Ga0207428_100274965 225
97 3300028380 Ga0268265_10015651 Ga0268265_100156514 225
98 3300031548 Ga0307408_100007671 Ga0307408_1000076715 225
99 3300031548 Ga0307408_100393543 Ga0307408_1003935432 225
100 3300031911 Ga0307412_10017018 Ga0307412_100170183 225
101 3300035115 Ga0373941_0083762 Ga0373941_0083762_240_977 225
102 3300042001 Ga0439441_037187 Ga0439441_037187_37_714 225
103 3300042439 Ga0439464_0003148 Ga0439464_0003148_1341_2018 225
104 3300042876 Ga0451577_0366440 Ga0451577_0366440_157_834 225
105 3300044712 Ga0453684_0016890 Ga0453684_0016890_8502_9179 225
106 3300044712 Ga0453684_0386456 Ga0453684_0386456_585_1262 225
107 3300046684 Ga0495669_0302826 Ga0495669_0302826_11_748 225
108 3300048909 Ga0496106_0393092 Ga0496106_0393092_415_1101 225
109 3300048912 Ga0496109_0225734 Ga0496109_0225734_154_831 225
110 3300048913 Ga0496110_0514795 Ga0496110_0514795_81_818 225
111 3300048915 Ga0496112_0398204 Ga0496112_0398204_456_1136 225
112 3300050493 nmdc:mga0k408_1542_c1 nmdc:mga0k408_1542_c1_2565_3242 225
113 3300050495 nmdc:mga04h51_85868_c1 nmdc:mga04h51_85868_c1_277_954 225
114 3300050496 nmdc:mga07m45_9623_c1 nmdc:mga07m45_9623_c1_318_995 225
115 3300050507 nmdc:mga05p37_291644_c1 nmdc:mga05p37_291644_c1_14_691 225
116 3300050507 nmdc:mga05p37_4241_c1 nmdc:mga05p37_4241_c1_9024_9701 225
117 3300050507 nmdc:mga05p37_49374_c1 nmdc:mga05p37_49374_c1_1496_2173 225
118 3300050507 nmdc:mga05p37_644758_c1 nmdc:mga05p37_644758_c1_238_915 225
119 3300050507 nmdc:mga05p37_74683_c1 nmdc:mga05p37_74683_c1_276_953 225
120 3300050507 nmdc:mga05p37_802289_c1 nmdc:mga05p37_802289_c1_343_1020 225
121 3300050507 nmdc:mga05p37_94195_c1 nmdc:mga05p37_94195_c1_118_804 225
122 3300050508 nmdc:mga09592_15773_c1 nmdc:mga09592_15773_c1_3095_3772 225
123 3300050509 nmdc:mga0qj67_5697_c1 nmdc:mga0qj67_5697_c1_6878_7555 225
124 3300050510 nmdc:mga06r32_58541_c1 nmdc:mga06r32_58541_c1_1651_2328 225
125 3300050510 nmdc:mga06r32_622476_c1 nmdc:mga06r32_622476_c1_348_1025 225
126 3300050511 nmdc:mga08y16_12595_c1 nmdc:mga08y16_12595_c1_3570_4310 225
127 3300050511 nmdc:mga08y16_15920_c1 nmdc:mga08y16_15920_c1_4668_5345 225
128 3300050512 nmdc:mga0n895_104230_c1 nmdc:mga0n895_104230_c1_1282_1959 225
129 3300050512 nmdc:mga0n895_25758_c1 nmdc:mga0n895_25758_c1_2403_3080 225
130 3300050512 nmdc:mga0n895_30_c1 nmdc:mga0n895_30_c1_75874_76551 225
131 3300050512 nmdc:mga0n895_366494_c1 nmdc:mga0n895_366494_c1_24_701 225
132 3300050512 nmdc:mga0n895_45771_c1 nmdc:mga0n895_45771_c1_3430_4107 225
133 3300050512 nmdc:mga0n895_798130_c1 nmdc:mga0n895_798130_c1_47_724 225
134 3300050512 nmdc:mga0n895_83666_c1 nmdc:mga0n895_83666_c1_1914_2645 225
135 3300050513 nmdc:mga0rr50_2_c1 nmdc:mga0rr50_2_c1_236627_237304 225
136 3300050513 nmdc:mga0rr50_42901_c1 nmdc:mga0rr50_42901_c1_267_944 225
137 3300050514 nmdc:mga08x19_126191_c1 nmdc:mga08x19_126191_c1_34_711 225
138 3300050514 nmdc:mga08x19_230_c1 nmdc:mga08x19_230_c1_15850_16527 225
139 3300050514 nmdc:mga08x19_41654_c1 nmdc:mga08x19_41654_c1_1768_2445 225
140 3300050514 nmdc:mga08x19_6107_c1 nmdc:mga08x19_6107_c1_1967_2644 225
141 3300050515 nmdc:mga0a205_312029_c1 nmdc:mga0a205_312029_c1_14_691 225
142 3300050515 nmdc:mga0a205_547354_c1 nmdc:mga0a205_547354_c1_125_802 225
143 3300050515 nmdc:mga0a205_761_c1 nmdc:mga0a205_761_c1_18020_18697 225
144 3300005293 Ga0065715_10099610 Ga0065715_100996103 226
145 3300005293 Ga0065715_10249122 Ga0065715_102491221 226
146 3300005293 Ga0065715_10361679 Ga0065715_103616792 226
147 3300005295 Ga0065707_10026392 Ga0065707_100263922 226
148 3300005295 Ga0065707_10458283 Ga0065707_104582831 226
149 3300005328 Ga0070676_10007110 Ga0070676_100071106 226
150 3300005328 Ga0070676_10046925 Ga0070676_100469253 226
151 3300005331 Ga0070670_100153540 Ga0070670_1001535402 226
152 3300005333 Ga0070677_10039894 Ga0070677_100398942 226
153 3300005336 Ga0070680_100151638 Ga0070680_1001516382 226
154 3300005347 Ga0070668_100037437 Ga0070668_1000374372 226
155 3300005347 Ga0070668_100364701 Ga0070668_1003647011 226
156 3300005353 Ga0070669_100067057 Ga0070669_1000670573 226
157 3300005353 Ga0070669_100068483 Ga0070669_1000684832 226
158 3300005353 Ga0070669_100158391 Ga0070669_1001583912 226
159 3300005354 Ga0070675_100089304 Ga0070675_1000893042 226
160 3300005355 Ga0070671_100084277 Ga0070671_1000842773 226
161 3300005356 Ga0070674_100125138 Ga0070674_1001251382 226
162 3300005356 Ga0070674_100395974 Ga0070674_1003959742 226
163 3300005364 Ga0070673_100062947 Ga0070673_1000629473 226
164 3300005367 Ga0070667_100282718 Ga0070667_1002827182 226
165 3300005438 Ga0070701_10018259 Ga0070701_100182593 226
166 3300005440 Ga0070705_100070876 Ga0070705_1000708762 226
167 3300005441 Ga0070700_100012124 Ga0070700_1000121242 226
168 3300005444 Ga0070694_100034137 Ga0070694_1000341373 226
169 3300005444 Ga0070694_100246540 Ga0070694_1002465401 226
170 3300005445 Ga0070708_100320923 Ga0070708_1003209232 226
171 3300005456 Ga0070678_100151471 Ga0070678_1001514713 226
172 3300005457 Ga0070662_100090479 Ga0070662_1000904792 226
173 3300005457 Ga0070662_100305748 Ga0070662_1003057482 226
174 3300005459 Ga0068867_100005156 Ga0068867_10000515611 226
175 3300005467 Ga0070706_100288006 Ga0070706_1002880062 226
176 3300005471 Ga0070698_100062615 Ga0070698_1000626152 226
177 3300005518 Ga0070699_100133970 Ga0070699_1001339702 226
178 3300005543 Ga0070672_100310073 Ga0070672_1003100732 226
179 3300005543 Ga0070672_100426975 Ga0070672_1004269751 226
180 3300005544 Ga0070686_100136802 Ga0070686_1001368022 226
181 3300005545 Ga0070695_100010483 Ga0070695_1000104838 226
182 3300005546 Ga0070696_100002548 Ga0070696_1000025488 226
183 3300005546 Ga0070696_100026147 Ga0070696_1000261472 226
184 3300005549 Ga0070704_100089053 Ga0070704_1000890532 226
185 3300005563 Ga0068855_100127244 Ga0068855_1001272442 226
186 3300005564 Ga0070664_100003464 Ga0070664_1000034643 226
187 3300005564 Ga0070664_100715341 Ga0070664_1007153411 226
188 3300005577 Ga0068857_100816824 Ga0068857_1008168241 226
189 3300005615 Ga0070702_100046258 Ga0070702_1000462582 226
190 3300005617 Ga0068859_100522101 Ga0068859_1005221012 226
191 3300005618 Ga0068864_100186587 Ga0068864_1001865872 226
192 3300005618 Ga0068864_100257551 Ga0068864_1002575511 226
193 3300005719 Ga0068861_100006307 Ga0068861_10000630710 226
194 3300005719 Ga0068861_100167192 Ga0068861_1001671923 226
195 3300005841 Ga0068863_100912499 Ga0068863_1009124991 226
196 3300005844 Ga0068862_100019281 Ga0068862_1000192811 226
197 3300005844 Ga0068862_100086535 Ga0068862_1000865352 226
198 3300005844 Ga0068862_100136640 Ga0068862_1001366403 226
199 3300005844 Ga0068862_101080438 Ga0068862_1010804381 226
200 3300005981 Ga0081538_10052923 Ga0081538_100529232 226
201 3300006042 Ga0075368_10006466 Ga0075368_100064666 226
202 3300006042 Ga0075368_10014451 Ga0075368_100144512 226
203 3300006051 Ga0075364_10067628 Ga0075364_100676283 226
204 3300006051 Ga0075364_10070184 Ga0075364_100701843 226
205 3300006058 Ga0075432_10089504 Ga0075432_100895042 226
206 3300006178 Ga0075367_10040707 Ga0075367_100407073 226
207 3300006178 Ga0075367_10107125 Ga0075367_101071252 226
208 3300006178 Ga0075367_10352523 Ga0075367_103525231 226
209 3300006195 Ga0075366_10011572 Ga0075366_100115723 226
210 3300006195 Ga0075366_10219054 Ga0075366_102190542 226
211 3300006353 Ga0075370_10076538 Ga0075370_100765382 226
212 3300006844 Ga0075428_100007896 Ga0075428_1000078962 226
213 3300006844 Ga0075428_100035133 Ga0075428_1000351336 226
214 3300006844 Ga0075428_100056674 Ga0075428_1000566744 226
215 3300006844 Ga0075428_100082739 Ga0075428_1000827392 226
216 3300006844 Ga0075428_100204613 Ga0075428_1002046133 226
217 3300006844 Ga0075428_100659236 Ga0075428_1006592362 226
218 3300006846 Ga0075430_100042982 Ga0075430_1000429823 226
219 3300006846 Ga0075430_100044807 Ga0075430_1000448072 226
220 3300006847 Ga0075431_100006444 Ga0075431_1000064446 226
221 3300006847 Ga0075431_100060816 Ga0075431_1000608165 226
222 3300006847 Ga0075431_100097351 Ga0075431_1000973512 226
223 3300006847 Ga0075431_100415420 Ga0075431_1004154202 226
224 3300006880 Ga0075429_100057027 Ga0075429_1000570273 226
225 3300006880 Ga0075429_100057634 Ga0075429_1000576342 226
226 3300006880 Ga0075429_100789704 Ga0075429_1007897041 226
227 3300006881 Ga0068865_100186987 Ga0068865_1001869872 226
228 3300006881 Ga0068865_100347971 Ga0068865_1003479712 226
229 3300006931 Ga0097620_100522101 Ga0097620_1005221012 226
230 3300007076 Ga0075435_100075874 Ga0075435_1000758742 226
231 3300007076 Ga0075435_100123746 Ga0075435_1001237462 226
232 3300009094 Ga0111539_10012297 Ga0111539_100122973 226
233 3300009094 Ga0111539_10015082 Ga0111539_100150829 226
234 3300009094 Ga0111539_10028441 Ga0111539_100284415 226
235 3300009094 Ga0111539_10081307 Ga0111539_100813074 226
236 3300009094 Ga0111539_10106882 Ga0111539_101068823 226
237 3300009094 Ga0111539_10120490 Ga0111539_101204902 226
238 3300009094 Ga0111539_10141696 Ga0111539_101416962 226
239 3300009094 Ga0111539_10244636 Ga0111539_102446362 226
240 3300009094 Ga0111539_10299996 Ga0111539_102999962 226
241 3300009098 Ga0105245_10252552 Ga0105245_102525522 226
242 3300009147 Ga0114129_10011164 Ga0114129_1001116412 226
243 3300009147 Ga0114129_10017826 Ga0114129_100178265 226
244 3300009147 Ga0114129_10019384 Ga0114129_100193845 226
245 3300009147 Ga0114129_10027741 Ga0114129_100277413 226
246 3300009147 Ga0114129_10079577 Ga0114129_100795776 226
247 3300009147 Ga0114129_10109253 Ga0114129_101092533 226
248 3300009147 Ga0114129_10419546 Ga0114129_104195462 226
249 3300009147 Ga0114129_10604545 Ga0114129_106045452 226
250 3300009148 Ga0105243_10007218 Ga0105243_100072182 226
251 3300009177 Ga0105248_10075879 Ga0105248_100758793 226
252 3300009551 Ga0105238_10834720 Ga0105238_108347201 226
253 3300009553 Ga0105249_10014767 Ga0105249_100147675 226
254 3300009553 Ga0105249_10076416 Ga0105249_100764163 226
255 3300009553 Ga0105249_10181220 Ga0105249_101812203 226
256 3300009553 Ga0105249_10403160 Ga0105249_104031602 226
257 3300009553 Ga0105249_10818639 Ga0105249_108186392 226
258 3300010375 Ga0105239_10397736 Ga0105239_103977362 226
259 3300011119 Ga0105246_10016936 Ga0105246_100169363 226
260 3300011119 Ga0105246_10141803 Ga0105246_101418033 226
261 3300013297 Ga0157378_10004825 Ga0157378_100048258 226
262 3300013308 Ga0157375_10043926 Ga0157375_100439264 226
263 3300014325 Ga0163163_10430384 Ga0163163_104303841 226
264 3300014326 Ga0157380_10006984 Ga0157380_1000698410 226
265 3300014326 Ga0157380_10142197 Ga0157380_101421973 226
266 3300014326 Ga0157380_10346367 Ga0157380_103463671 226
267 3300014326 Ga0157380_10969838 Ga0157380_109698381 226
268 3300014745 Ga0157377_10204608 Ga0157377_102046082 226
269 3300017792 Ga0163161_10479118 Ga0163161_104791182 226
270 3300025315 Ga0207697_10254654 Ga0207697_102546541 226
271 3300025893 Ga0207682_10043316 Ga0207682_100433161 226
272 3300025907 Ga0207645_10006786 Ga0207645_100067867 226
273 3300025908 Ga0207643_10062750 Ga0207643_100627502 226
274 3300025910 Ga0207684_10287940 Ga0207684_102879402 226
275 3300025912 Ga0207707_10402752 Ga0207707_104027522 226
276 3300025917 Ga0207660_10114007 Ga0207660_101140072 226
277 3300025922 Ga0207646_10383444 Ga0207646_103834442 226
278 3300025923 Ga0207681_10071697 Ga0207681_100716972 226
279 3300025923 Ga0207681_10656661 Ga0207681_106566612 226
280 3300025924 Ga0207694_10453436 Ga0207694_104534361 226
281 3300025925 Ga0207650_10030255 Ga0207650_100302552 226
282 3300025926 Ga0207659_10015920 Ga0207659_100159202 226
283 3300025926 Ga0207659_10182193 Ga0207659_101821933 226
284 3300025932 Ga0207690_10041392 Ga0207690_100413922 226
285 3300025933 Ga0207706_10066478 Ga0207706_100664783 226
286 3300025933 Ga0207706_10181050 Ga0207706_101810502 226
287 3300025933 Ga0207706_10317062 Ga0207706_103170622 226
288 3300025935 Ga0207709_10055938 Ga0207709_100559382 226
289 3300025937 Ga0207669_10089292 Ga0207669_100892923 226
290 3300025940 Ga0207691_10072118 Ga0207691_100721184 226
291 3300025941 Ga0207711_10052838 Ga0207711_100528383 226
292 3300025945 Ga0207679_10303525 Ga0207679_103035252 226
293 3300025960 Ga0207651_10126500 Ga0207651_101265003 226
294 3300025960 Ga0207651_10144918 Ga0207651_101449181 226
295 3300025960 Ga0207651_10553202 Ga0207651_105532021 226
296 3300025961 Ga0207712_10027589 Ga0207712_100275892 226
297 3300025961 Ga0207712_10371749 Ga0207712_103717492 226
298 3300025961 Ga0207712_10596139 Ga0207712_105961392 226
299 3300025972 Ga0207668_10068322 Ga0207668_100683223 226
300 3300025986 Ga0207658_10239660 Ga0207658_102396602 226
301 3300026023 Ga0207677_10144493 Ga0207677_101444932 226
302 3300026023 Ga0207677_10281175 Ga0207677_102811752 226
303 3300026067 Ga0207678_10044661 Ga0207678_100446612 226
304 3300026075 Ga0207708_10133683 Ga0207708_101336832 226
305 3300026088 Ga0207641_10538138 Ga0207641_105381382 226
306 3300026088 Ga0207641_10832257 Ga0207641_108322571 226
307 3300026089 Ga0207648_10006036 Ga0207648_100060366 226
308 3300026095 Ga0207676_10061980 Ga0207676_100619803 226
309 3300026095 Ga0207676_10203977 Ga0207676_102039772 226
310 3300026116 Ga0207674_10408761 Ga0207674_104087612 226
311 3300026118 Ga0207675_100031461 Ga0207675_1000314616 226
312 3300026118 Ga0207675_100072492 Ga0207675_1000724925 226
313 3300026118 Ga0207675_100191832 Ga0207675_1001918323 226
314 3300026118 Ga0207675_100293359 Ga0207675_1002933592 226
315 3300026118 Ga0207675_100426721 Ga0207675_1004267212 226
316 3300026121 Ga0207683_10294516 Ga0207683_102945162 226
317 3300027907 Ga0207428_10008813 Ga0207428_100088136 226
318 3300027907 Ga0207428_10010324 Ga0207428_100103243 226
319 3300027907 Ga0207428_10016271 Ga0207428_100162715 226
320 3300027907 Ga0207428_10484143 Ga0207428_104841432 226
321 3300028380 Ga0268265_10068627 Ga0268265_100686272 226
322 3300028380 Ga0268265_10474492 Ga0268265_104744922 226
323 3300028381 Ga0268264_10754949 Ga0268264_107549492 226
324 3300031901 Ga0307406_10022262 Ga0307406_100222624 226
325 3300031995 Ga0307409_100884860 Ga0307409_1008848602 226
326 3300032002 Ga0307416_100724123 Ga0307416_1007241232 226
327 3300032005 Ga0307411_10077291 Ga0307411_100772913 226
328 3300032126 Ga0307415_100553953 Ga0307415_1005539532 226
329 3300035725 Ga0373947_0167359 Ga0373947_0167359_668_1348 226
330 3300037068 Ga0373925_0214522 Ga0373925_0214522_741_1421 226
331 3300044712 Ga0453684_0000640 Ga0453684_0000640_85149_85835 226
332 3300045051 Ga0451576_0207118 Ga0451576_0207118_1277_1966 226
333 3300046455 Ga0495603_0042804 Ga0495603_0042804_1694_2374 226
334 3300046683 Ga0495658_0104503 Ga0495658_0104503_779_1459 226
335 3300048903 Ga0496100_0052021 Ga0496100_0052021_56_736 226
336 3300048904 Ga0496101_0027364 Ga0496101_0027364_941_1621 226
337 3300048907 Ga0496104_0033099 Ga0496104_0033099_1877_2557 226
338 3300048908 Ga0496105_0027302 Ga0496105_0027302_2690_3370 226
339 3300048909 Ga0496106_0044866 Ga0496106_0044866_369_1049 226
340 3300048910 Ga0496107_0111757 Ga0496107_0111757_1298_1978 226
341 3300048911 Ga0496108_0000512 Ga0496108_0000512_8867_9547 226
342 3300048912 Ga0496109_0068453 Ga0496109_0068453_1039_1719 226
343 3300048913 Ga0496110_0021439 Ga0496110_0021439_1598_2278 226
344 3300048914 Ga0496111_0055113 Ga0496111_0055113_1596_2276 226
345 3300048915 Ga0496112_0003921 Ga0496112_0003921_502_1182 226
346 3300048916 Ga0496113_0144851 Ga0496113_0144851_521_1201 226
347 3300048917 Ga0496114_0127233 Ga0496114_0127233_919_1599 226
348 3300048918 Ga0496115_0526855 Ga0496115_0526855_37_717 226
349 3300049584 Ga0501068_0041640 Ga0501068_0041640_176_856 226
350 3300050491 nmdc:mga00v17_302925_c1 nmdc:mga00v17_302925_c1_223_903 226
351 3300050493 nmdc:mga0k408_9782_c1 nmdc:mga0k408_9782_c1_3042_3722 226
352 3300050494 nmdc:mga06z11_10606_c1 nmdc:mga06z11_10606_c1_3047_3727 226
353 3300050495 nmdc:mga04h51_13456_c1 nmdc:mga04h51_13456_c1_551_1234 226
354 3300050496 nmdc:mga07m45_18659_c1 nmdc:mga07m45_18659_c1_399_1079 226
355 3300050507 nmdc:mga05p37_13913_c1 nmdc:mga05p37_13913_c1_1001_1681 226
356 3300050507 nmdc:mga05p37_20502_c2 nmdc:mga05p37_20502_c2_4158_4838 226
357 3300050507 nmdc:mga05p37_81042_c1 nmdc:mga05p37_81042_c1_836_1603 226
358 3300050508 nmdc:mga09592_143381_c1 nmdc:mga09592_143381_c1_651_1331 226
359 3300050508 nmdc:mga09592_20053_c1 nmdc:mga09592_20053_c1_1011_1691 226
360 3300050508 nmdc:mga09592_26467_c1 nmdc:mga09592_26467_c1_1567_2247 226
361 3300050509 nmdc:mga0qj67_48815_c1 nmdc:mga0qj67_48815_c1_1484_2164 226
362 3300050510 nmdc:mga06r32_127057_c1 nmdc:mga06r32_127057_c1_248_928 226
363 3300050510 nmdc:mga06r32_236644_c1 nmdc:mga06r32_236644_c1_459_1139 226
364 3300050510 nmdc:mga06r32_25516_c1 nmdc:mga06r32_25516_c1_3181_3861 226
365 3300050510 nmdc:mga06r32_4645_c1 nmdc:mga06r32_4645_c1_6913_7593 226
366 3300050510 nmdc:mga06r32_53285_c1 nmdc:mga06r32_53285_c1_2485_3165 226
367 3300050511 nmdc:mga08y16_15145_c1 nmdc:mga08y16_15145_c1_5456_6136 226
368 3300050511 nmdc:mga08y16_46327_c1 nmdc:mga08y16_46327_c1_616_1296 226
369 3300050511 nmdc:mga08y16_69609_c1 nmdc:mga08y16_69609_c1_1804_2484 226
370 3300050511 nmdc:mga08y16_697596_c1 nmdc:mga08y16_697596_c1_45_725 226
371 3300050511 nmdc:mga08y16_79616_c1 nmdc:mga08y16_79616_c1_1331_2011 226
372 3300050512 nmdc:mga0n895_707129_c1 nmdc:mga0n895_707129_c1_211_891 226
373 3300050513 nmdc:mga0rr50_103976_c1 nmdc:mga0rr50_103976_c1_1005_1694 226
374 3300050513 nmdc:mga0rr50_867708_c1 nmdc:mga0rr50_867708_c1_22_702 226
375 3300050515 nmdc:mga0a205_422249_c1 nmdc:mga0a205_422249_c1_131_811 226
376 3300050515 nmdc:mga0a205_441956_c1 nmdc:mga0a205_441956_c1_120_848 226
377 3300053090 Ga0500646_0180938 Ga0500646_0180938_13_693 226
378 3300005330 Ga0070690_100056763 Ga0070690_1000567631 227
379 3300005335 Ga0070666_10093575 Ga0070666_100935751 227
380 3300005337 Ga0070682_100009570 Ga0070682_1000095703 227
381 3300005337 Ga0070682_100013077 Ga0070682_1000130775 227
382 3300005355 Ga0070671_100048786 Ga0070671_1000487862 227
383 3300005536 Ga0070697_100160116 Ga0070697_1001601162 227
384 3300005544 Ga0070686_100000831 Ga0070686_1000008319 227
385 3300005545 Ga0070695_100111143 Ga0070695_1001111432 227
386 3300005549 Ga0070704_100094666 Ga0070704_1000946663 227
387 3300005563 Ga0068855_100498210 Ga0068855_1004982102 227
388 3300005578 Ga0068854_100067466 Ga0068854_1000674661 227
389 3300005616 Ga0068852_101028385 Ga0068852_1010283851 227
390 3300005843 Ga0068860_101102976 Ga0068860_1011029762 227
391 3300006195 Ga0075366_10016080 Ga0075366_100160802 227
392 3300006844 Ga0075428_100430165 Ga0075428_1004301652 227
393 3300006871 Ga0075434_100087137 Ga0075434_1000871373 227
394 3300007076 Ga0075435_100048938 Ga0075435_1000489383 227
395 3300009093 Ga0105240_10143538 Ga0105240_101435382 227
396 3300009174 Ga0105241_10665990 Ga0105241_106659901 227
397 3300014969 Ga0157376_10330210 Ga0157376_103302102 227
398 3300025913 Ga0207695_10375767 Ga0207695_103757672 227
399 3300025931 Ga0207644_10167889 Ga0207644_101678892 227
400 3300025949 Ga0207667_10424804 Ga0207667_104248042 227
401 3300025981 Ga0207640_10038589 Ga0207640_100385892 227
402 3300025981 Ga0207640_10046360 Ga0207640_100463602 227
403 3300031238 Ga0265332_10075004 Ga0265332_100750041 227
404 3300031249 Ga0265339_10000105 Ga0265339_1000010546 227
405 3300031344 Ga0265316_10001844 Ga0265316_100018443 227
406 3300031711 Ga0265314_10000002 Ga0265314_10000002735 227
407 3300034816 Ga0373930_0022427 Ga0373930_0022427_549_1232 227
408 3300034818 Ga0373950_0001574 Ga0373950_0001574_217_957 227
409 3300034957 Ga0373938_0001334 Ga0373938_0001334_578_1318 227
410 3300035084 Ga0373928_0000747 Ga0373928_0000747_158_898 227
411 3300035085 Ga0373929_0002475 Ga0373929_0002475_609_1349 227
412 3300035088 Ga0373940_0031184 Ga0373940_0031184_154_894 227
413 3300035090 Ga0373949_0002243 Ga0373949_0002243_265_948 227
414 3300035092 Ga0373952_0001940 Ga0373952_0001940_521_1204 227
415 3300035114 Ga0373939_0001590 Ga0373939_0001590_2219_2959 227
416 3300035115 Ga0373941_0001410 Ga0373941_0001410_660_1343 227
417 3300035121 Ga0373960_0000217 Ga0373960_0000217_5604_6344 227
418 3300035207 Ga0373942_0001105 Ga0373942_0001105_4302_5042 227
419 3300035241 Ga0373961_0068218 Ga0373961_0068218_341_1081 227
420 3300036647 Ga0316582_0343150 Ga0316582_0343150_151_906 227
421 3300045051 Ga0451576_0035389 Ga0451576_0035389_1934_2617 227
422 3300048905 Ga0496102_0629768 Ga0496102_0629768_216_899 227
423 3300048909 Ga0496106_0516665 Ga0496106_0516665_139_822 227
424 3300049592 Ga0501076_0379613 Ga0501076_0379613_213_902 227
425 3300050508 nmdc:mga09592_199963_c1 nmdc:mga09592_199963_c1_642_1409 227
426 3300050511 nmdc:mga08y16_637952_c1 nmdc:mga08y16_637952_c1_118_828 227
427 3300050512 nmdc:mga0n895_1127571_c1 nmdc:mga0n895_1127571_c1_63_749 227
428 3300050512 nmdc:mga0n895_88098_c1 nmdc:mga0n895_88098_c1_1465_2148 227
429 3300050513 nmdc:mga0rr50_35288_c1 nmdc:mga0rr50_35288_c1_2403_3086 227
430 3300050513 nmdc:mga0rr50_555960_c1 nmdc:mga0rr50_555960_c1_215_961 227
431 3300061734 Ga0530510_0119701 Ga0530510_0119701_1161_1844 227
432 iso_pu_bacteria 2971410472 2971417591 227
433 3300005337 Ga0070682_100027740 Ga0070682_1000277403 228
434 3300005366 Ga0070659_100186866 Ga0070659_1001868662 228
435 3300005547 Ga0070693_100005083 Ga0070693_1000050834 228
436 3300005549 Ga0070704_100129364 Ga0070704_1001293641 228
437 3300006844 Ga0075428_100041905 Ga0075428_1000419053 228
438 3300006846 Ga0075430_100102363 Ga0075430_1001023632 228
439 3300006871 Ga0075434_100354855 Ga0075434_1003548552 228
440 3300036647 Ga0316582_0204448 Ga0316582_0204448_401_1087 228
441 3300048905 Ga0496102_0219323 Ga0496102_0219323_401_1087 228
442 3300048924 Ga0496121_0152485 Ga0496121_0152485_628_1383 228
443 3300050509 nmdc:mga0qj67_56449_c1 nmdc:mga0qj67_56449_c1_1171_1863 228
444 3300050514 nmdc:mga08x19_407531_c1 nmdc:mga08x19_407531_c1_80_766 228
445 3300005444 Ga0070694_100002461 Ga0070694_10000246110 229
446 3300005535 Ga0070684_100014631 Ga0070684_1000146312 229
447 3300005546 Ga0070696_100189753 Ga0070696_1001897532 229
448 3300009147 Ga0114129_10002646 Ga0114129_1000264620 229
449 3300009147 Ga0114129_10337183 Ga0114129_103371832 229
450 3300050507 nmdc:mga05p37_250897_c1 nmdc:mga05p37_250897_c1_352_1041 229
451 3300050507 nmdc:mga05p37_6919_c1 nmdc:mga05p37_6919_c1_187_918 229
452 3300014968 Ga0157379_10228800 Ga0157379_102288002 230
453 3300026023 Ga0207677_10368607 Ga0207677_103686072 230
454 3300036647 Ga0316582_0057966 Ga0316582_0057966_16_738 230
455 3300049775 Ga0501279_014934 Ga0501279_014934_111_923 230
456 3300053153 Ga0500616_0218147 Ga0500616_0218147_88_810 230
457 3300003841 Ga0055541_1000921 Ga0055541_10009216 231
458 3300025225 Ga0209566_100300 Ga0209566_10030034 231
459 3300048919 Ga0496116_0138005 Ga0496116_0138005_584_1339 231
460 iso_pu_bacteria 2857453340 2857459432 231
461 iso_pu_bacteria 8056533031 8056536312 231
462 iso_pu_bacteria 2600255256 2601532467 232
463 iso_pu_bacteria 2600255257 2601537837 232
464 iso_pu_bacteria 2600255310 2601756507 232
465 iso_pu_bacteria 2600255311 2601763012 232
466 iso_pu_bacteria 2602042046 2603638085 232
467 iso_pu_bacteria 2814123068 2814696633 232
468 3300003856 Ga0058692_1000128 Ga0058692_100012820 234
469 3300027312 Ga0209371_1000002 Ga0209371_1000002273 234
470 3300027312 Ga0209371_1000109 Ga0209371_100010955 234
471 3300030500 Ga0268256_1000002 Ga0268256_10000021191 234
472 3300031727 Ga0316576_10016511 Ga0316576_100165112 235
473 3300031733 Ga0316577_10007339 Ga0316577_100073395 235
474 3300031733 Ga0316577_10076038 Ga0316577_100760382 235
475 3300038726 Ga0400490_37142 Ga0400490_37142_540_1253 235
476 3300038735 Ga0400485_11367 Ga0400485_11367_17797_18510 235
477 3300038742 Ga0400486_17557 Ga0400486_17557_111_824 235
478 3300038742 Ga0400486_19491 Ga0400486_19491_6700_7413 235
479 3300039062 Ga0400483_183368 Ga0400483_183368_1218_1931 235
480 3300039093 Ga0400489_48110 Ga0400489_48110_3172_3885 235
481 3300039110 Ga0400487_07019 Ga0400487_07019_3243_3956 235
482 3300046459 Ga0495629_0036298 Ga0495629_0036298_752_1555 236
483 3300046526 Ga0495666_0000647 Ga0495666_0000647_7816_8619 236
484 3300046531 Ga0495665_0000343 Ga0495665_0000343_16100_16903 236
485 3300046674 Ga0495588_0090142 Ga0495588_0090142_448_1251 236
486 3300047315 Ga0495581_0064431 Ga0495581_0064431_843_1646 236
487 3300047319 Ga0495674_0012568 Ga0495674_0012568_6824_7627 236
488 3300047321 Ga0495676_0013598 Ga0495676_0013598_1928_2731 236
489 3300002459 JGI24751J29686_10016562 JGI24751J29686_100165623 237
490 3300031665 Ga0316575_10126225 Ga0316575_101262252 237
491 3300035398 Ga0316574_0014975 Ga0316574_0014975_573_1310 237
492 3300053098 Ga0500650_0000050 Ga0500650_0000050_6659_7372 237

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

4

113

0.99

PF00486

Trans_reg_C

Transcriptional regulatory protein, C terminal

147

223

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8fk2-assembly1.cif.gz_B the n-terminal vicr from streptococcus mutans 0.9769 4 123
1nxt-assembly1.cif.gz_A-2 micarec ph 4.0 0.9699 4 121
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.9689 4 121
3nnn-assembly1.cif.gz_B bef3 activated drrd receiver domain 0.9683 3 120
6is2-assembly1.cif.gz_A crystal structure of staphylococcus aureus response regulator arlr receiver domain in complex with mg 0.9674 2 121
ID Description Score Start End Superfamily
af_Q9KJN4_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.991 4 82 3.40.50.2300
af_P76340_1_79_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9757 5 82 3.40.50.2300
af_Q2FY79_1_81_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9734 3 82 3.40.50.2300
af_P69228_9_89_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9697 2 82 3.40.50.2300
5hm6B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9653 3 120 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A0D8SQB7-F1-model_v4 deleted 0.9813 1 131
AF-A0A1H1MHS3-F1-model_v4 Response regulator receiver domain-containing protein 0.9751 3 119 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A2V8RBR2-F1-model_v4 DNA-binding response regulator 0.9708 1 124 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A7X6ZL16-F1-model_v4 Response regulator 0.9692 3 120 GO:0000160
AF-A0A353VD63-F1-model_v4 Sigma-54-dependent Fis family transcriptional regulator 0.9692 3 128 GO:0000160
GO:0005524
GO:0006355
GO:0016887
GO:0043565

Feature Viewer

pLDDT pTM Quality
86.24 0.67 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map