F454267
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 492 | 246 | 482 | 229 |
Family's Representative Sequence
| Representative Sequence | 3300014968|Ga0157379_10228800|Ga0157379_102288002 |
| Length | 273 |
| Sequence | VKHILVVDDEPRIAEIARDYLERAGYRVTVASNGVDALAIARTRQPDLLVLDLGLPQMDGLDVTRALRRQSNVPIIMLTARVDESDTLIGLELGADDYVTKPFSPKELVARVRAVFRRVDEAPERGGVIRAGGVTLDKPRMDVSVDDRHVDLTATEFELLATLARQPGRVFTRGQLLDAIRGEAVESFDRAIDAHIKNLRRKLEPDPRNPRYVLTVHGVGYKFVDILCNPLIIPQTSPSLCSCVRGPRRSSGRSWRCKRPAAAPVRTTAQTRG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2600255256 | Enterobacter sp. NFIX08 | Isolate | Rhizoplane |
| 2 | 2600255257 | Enterobacter sp. NFIX03 | Isolate | Rhizoplane |
| 3 | 2600255310 | Enterobacter sp. NFIX06 | Isolate | Rhizoplane |
| 4 | 2600255311 | Enterobacter sp. NFIX04 | Isolate | Rhizoplane |
| 5 | 2602042046 | Enterobacter sp. NFIX09 | Isolate | Rhizoplane |
| 6 | 2739367663 | Pedobacter sp. YR510 | Isolate | Unclassified |
| 7 | 2814123068 | Kosakonia radicincitans GXGL-4A | Isolate | Rhizosphere |
| 8 | 2857453340 | Paenibacillus sp. R-74130 | Isolate | Unclassified |
| 9 | 2971410472 | Paenibacillus oryzisoli 1ZS3-15 | Isolate | Unclassified |
| 10 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 11 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 12 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 13 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 14 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 59 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 60 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 61 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 62 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 65 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 66 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 67 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 68 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 69 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 70 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 71 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 72 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 73 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 74 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 75 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 76 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 77 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 78 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 79 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 80 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 81 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 83 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 84 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 150 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 153 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 154 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 155 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 156 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 157 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 158 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 159 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 160 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 161 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 162 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 163 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 164 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 165 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 166 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 167 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 168 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 169 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 170 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 171 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 172 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 173 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 174 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 175 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 176 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 177 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 178 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 179 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 180 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 181 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 182 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 183 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 184 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 185 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 186 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 187 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 188 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 189 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 190 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 191 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 192 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 193 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 194 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 195 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 196 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 197 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 198 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 209 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 210 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 211 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 212 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 213 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 214 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 215 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 216 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 217 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 218 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 219 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 220 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 221 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 222 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 223 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 224 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 225 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 228 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 229 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 230 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 231 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 232 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 233 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 234 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 235 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 236 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 237 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 238 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 239 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 240 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 241 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 242 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 243 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 244 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 245 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 246 | 8056533031 | Paenibacillus qinlingensis TEGT-2 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.97 |
| Metatranscriptomes | 0 |
| Isolates | 2.03 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.49 |
| Nodule | 0 |
| Rhizoplane | 5.28 |
| Rhizosphere | 86.38 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.85 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24751J29686_10016562 | 3300002459 | Bacteria | 1520 |
| 2 | Ga0055541_1000921 | 3300003841 | Bacteria | 7025 |
| 3 | Ga0058692_1000128 | 3300003856 | Bacteria | 48036 |
| 4 | Ga0065712_10003711 | 3300005290 | Bacteria | 6003 |
| 5 | Ga0065715_10099610 | 3300005293 | Bacteria | 3390 |
| 6 | Ga0065715_10249122 | 3300005293 | Bacteria | 1173 |
| 7 | Ga0065715_10361679 | 3300005293 | Bacteria | 934 |
| 8 | Ga0065707_10026392 | 3300005295 | Bacteria | 1198 |
| 9 | Ga0065707_10458283 | 3300005295 | Bacteria | 794 |
| 10 | Ga0070676_10007110 | 3300005328 | Bacteria | 5994 |
| 11 | Ga0070676_10046925 | 3300005328 | Bacteria | 2521 |
| 12 | Ga0070683_100001129 | 3300005329 | Bacteria | 20187 |
| 13 | Ga0070690_100056763 | 3300005330 | Bacteria | 2511 |
| 14 | Ga0070690_100323279 | 3300005330 | Bacteria | 1112 |
| 15 | Ga0070670_100153540 | 3300005331 | Bacteria | 1993 |
| 16 | Ga0070670_100176157 | 3300005331 | Bacteria | 1856 |
| 17 | Ga0070677_10039894 | 3300005333 | Bacteria | 1845 |
| 18 | Ga0070666_10082537 | 3300005335 | Bacteria | 2198 |
| 19 | Ga0070666_10093575 | 3300005335 | Bacteria | 2066 |
| 20 | Ga0070666_10266729 | 3300005335 | Bacteria | 1215 |
| 21 | Ga0070680_100151638 | 3300005336 | Bacteria | 1946 |
| 22 | Ga0070682_100009570 | 3300005337 | Bacteria | 5485 |
| 23 | Ga0070682_100013077 | 3300005337 | Bacteria | 4768 |
| 24 | Ga0070682_100027740 | 3300005337 | Bacteria | 3399 |
| 25 | Ga0068868_100457399 | 3300005338 | Bacteria | 1111 |
| 26 | Ga0070661_100058001 | 3300005344 | Bacteria | 2837 |
| 27 | Ga0070668_100037437 | 3300005347 | Bacteria | 3704 |
| 28 | Ga0070668_100364701 | 3300005347 | Bacteria | 1226 |
| 29 | Ga0070669_100067057 | 3300005353 | Bacteria | 2646 |
| 30 | Ga0070669_100068483 | 3300005353 | Bacteria | 2620 |
| 31 | Ga0070669_100158391 | 3300005353 | Bacteria | 1757 |
| 32 | Ga0070675_100089304 | 3300005354 | Bacteria | 2580 |
| 33 | Ga0070671_100048786 | 3300005355 | Bacteria | 3522 |
| 34 | Ga0070671_100084277 | 3300005355 | Bacteria | 2658 |
| 35 | Ga0070674_100125138 | 3300005356 | Bacteria | 1908 |
| 36 | Ga0070674_100395974 | 3300005356 | Bacteria | 1127 |
| 37 | Ga0070673_100062947 | 3300005364 | Bacteria | 2950 |
| 38 | Ga0070659_100186866 | 3300005366 | Bacteria | 1702 |
| 39 | Ga0070667_100282718 | 3300005367 | Bacteria | 1490 |
| 40 | Ga0070701_10018259 | 3300005438 | Bacteria | 3294 |
| 41 | Ga0070705_100070876 | 3300005440 | Bacteria | 2106 |
| 42 | Ga0070700_100012124 | 3300005441 | Bacteria | 4798 |
| 43 | Ga0070694_100002461 | 3300005444 | Bacteria | 10933 |
| 44 | Ga0070694_100034137 | 3300005444 | Bacteria | 3353 |
| 45 | Ga0070694_100246540 | 3300005444 | Bacteria | 1350 |
| 46 | Ga0070708_100320923 | 3300005445 | Bacteria | 1459 |
| 47 | Ga0070678_100151471 | 3300005456 | Bacteria | 1868 |
| 48 | Ga0070662_100090479 | 3300005457 | Bacteria | 2297 |
| 49 | Ga0070662_100305748 | 3300005457 | Bacteria | 1293 |
| 50 | Ga0068867_100005156 | 3300005459 | Bacteria | 9226 |
| 51 | Ga0070706_100288006 | 3300005467 | Bacteria | 1533 |
| 52 | Ga0070698_100062615 | 3300005471 | Bacteria | 3753 |
| 53 | Ga0070698_100239614 | 3300005471 | Bacteria | 1747 |
| 54 | Ga0070699_100133970 | 3300005518 | Bacteria | 2185 |
| 55 | Ga0070684_100000586 | 3300005535 | Bacteria | 25062 |
| 56 | Ga0070684_100014631 | 3300005535 | Bacteria | 6363 |
| 57 | Ga0070697_100160116 | 3300005536 | Bacteria | 1901 |
| 58 | Ga0070672_100040467 | 3300005543 | Bacteria | 3576 |
| 59 | Ga0070672_100310073 | 3300005543 | Bacteria | 1339 |
| 60 | Ga0070672_100426975 | 3300005543 | Bacteria | 1139 |
| 61 | Ga0070672_100844654 | 3300005543 | Bacteria | 807 |
| 62 | Ga0070686_100000831 | 3300005544 | Bacteria | 17877 |
| 63 | Ga0070686_100136802 | 3300005544 | Bacteria | 1701 |
| 64 | Ga0070695_100010483 | 3300005545 | Bacteria | 5533 |
| 65 | Ga0070695_100111143 | 3300005545 | Bacteria | 1860 |
| 66 | Ga0070696_100002548 | 3300005546 | Bacteria | 12070 |
| 67 | Ga0070696_100026147 | 3300005546 | Bacteria | 3970 |
| 68 | Ga0070696_100189753 | 3300005546 | Bacteria | 1529 |
| 69 | Ga0070693_100005083 | 3300005547 | Bacteria | 6286 |
| 70 | Ga0070704_100033593 | 3300005549 | Bacteria | 3470 |
| 71 | Ga0070704_100089053 | 3300005549 | Bacteria | 2295 |
| 72 | Ga0070704_100094666 | 3300005549 | Bacteria | 2235 |
| 73 | Ga0070704_100129364 | 3300005549 | Bacteria | 1954 |
| 74 | Ga0068855_100127244 | 3300005563 | Bacteria | 2912 |
| 75 | Ga0068855_100498210 | 3300005563 | Bacteria | 1324 |
| 76 | Ga0070664_100003464 | 3300005564 | Bacteria | 12741 |
| 77 | Ga0070664_100715341 | 3300005564 | Bacteria | 934 |
| 78 | Ga0068857_100816824 | 3300005577 | Bacteria | 891 |
| 79 | Ga0068854_100067466 | 3300005578 | Bacteria | 2606 |
| 80 | Ga0070702_100046258 | 3300005615 | Bacteria | 2466 |
| 81 | Ga0068852_101028385 | 3300005616 | Bacteria | 843 |
| 82 | Ga0068859_100051609 | 3300005617 | Bacteria | 4134 |
| 83 | Ga0068859_100522101 | 3300005617 | Bacteria | 1282 |
| 84 | Ga0068859_100559669 | 3300005617 | Bacteria | 1238 |
| 85 | Ga0068864_100186587 | 3300005618 | Bacteria | 1898 |
| 86 | Ga0068864_100257551 | 3300005618 | Bacteria | 1622 |
| 87 | Ga0068861_100006307 | 3300005719 | Bacteria | 8073 |
| 88 | Ga0068861_100167192 | 3300005719 | Bacteria | 1819 |
| 89 | Ga0068863_100023252 | 3300005841 | Bacteria | 5923 |
| 90 | Ga0068863_100912499 | 3300005841 | Bacteria | 879 |
| 91 | Ga0068858_100254314 | 3300005842 | Bacteria | 1669 |
| 92 | Ga0068860_101102976 | 3300005843 | Bacteria | 813 |
| 93 | Ga0068862_100012433 | 3300005844 | Bacteria | 7043 |
| 94 | Ga0068862_100019281 | 3300005844 | Bacteria | 5691 |
| 95 | Ga0068862_100086535 | 3300005844 | Bacteria | 2725 |
| 96 | Ga0068862_100136640 | 3300005844 | Bacteria | 2173 |
| 97 | Ga0068862_100279847 | 3300005844 | Bacteria | 1529 |
| 98 | Ga0068862_101080438 | 3300005844 | Bacteria | 797 |
| 99 | Ga0081538_10052923 | 3300005981 | Bacteria | 2420 |
| 100 | Ga0075368_10006466 | 3300006042 | Bacteria | 4094 |
| 101 | Ga0075368_10014451 | 3300006042 | Bacteria | 2916 |
| 102 | Ga0075368_10143571 | 3300006042 | Bacteria | 995 |
| 103 | Ga0075364_10067628 | 3300006051 | Bacteria | 2349 |
| 104 | Ga0075364_10070184 | 3300006051 | Bacteria | 2306 |
| 105 | Ga0075432_10089504 | 3300006058 | Bacteria | 1125 |
| 106 | Ga0075367_10040707 | 3300006178 | Bacteria | 2714 |
| 107 | Ga0075367_10107125 | 3300006178 | Bacteria | 1713 |
| 108 | Ga0075367_10352523 | 3300006178 | Bacteria | 929 |
| 109 | Ga0075366_10004695 | 3300006195 | Bacteria | 7353 |
| 110 | Ga0075366_10011572 | 3300006195 | Bacteria | 4984 |
| 111 | Ga0075366_10016080 | 3300006195 | Bacteria | 4296 |
| 112 | Ga0075366_10219054 | 3300006195 | Bacteria | 1159 |
| 113 | Ga0075370_10076538 | 3300006353 | Bacteria | 1919 |
| 114 | Ga0075428_100001713 | 3300006844 | Bacteria | 23426 |
| 115 | Ga0075428_100007896 | 3300006844 | Bacteria | 11795 |
| 116 | Ga0075428_100035133 | 3300006844 | Bacteria | 5525 |
| 117 | Ga0075428_100041905 | 3300006844 | Bacteria | 5034 |
| 118 | Ga0075428_100056674 | 3300006844 | Bacteria | 4291 |
| 119 | Ga0075428_100082739 | 3300006844 | Bacteria | 3502 |
| 120 | Ga0075428_100204613 | 3300006844 | Bacteria | 2133 |
| 121 | Ga0075428_100430165 | 3300006844 | Bacteria | 1414 |
| 122 | Ga0075428_100659236 | 3300006844 | Bacteria | 1116 |
| 123 | Ga0075428_101296353 | 3300006844 | Bacteria | 766 |
| 124 | Ga0075430_100011218 | 3300006846 | Bacteria | 7599 |
| 125 | Ga0075430_100042982 | 3300006846 | Bacteria | 3821 |
| 126 | Ga0075430_100044807 | 3300006846 | Bacteria | 3739 |
| 127 | Ga0075430_100102363 | 3300006846 | Bacteria | 2391 |
| 128 | Ga0075431_100006444 | 3300006847 | Bacteria | 11655 |
| 129 | Ga0075431_100060816 | 3300006847 | Bacteria | 3898 |
| 130 | Ga0075431_100082874 | 3300006847 | Bacteria | 3311 |
| 131 | Ga0075431_100097351 | 3300006847 | Bacteria | 3038 |
| 132 | Ga0075431_100415420 | 3300006847 | Bacteria | 1345 |
| 133 | Ga0075431_100635610 | 3300006847 | Bacteria | 1049 |
| 134 | Ga0075433_10000648 | 3300006852 | Bacteria | 23403 |
| 135 | Ga0075433_10082214 | 3300006852 | Bacteria | 2840 |
| 136 | Ga0075434_100000721 | 3300006871 | Bacteria | 25889 |
| 137 | Ga0075434_100011731 | 3300006871 | Bacteria | 8277 |
| 138 | Ga0075434_100012138 | 3300006871 | Bacteria | 8158 |
| 139 | Ga0075434_100087137 | 3300006871 | Bacteria | 3123 |
| 140 | Ga0075434_100354855 | 3300006871 | Bacteria | 1487 |
| 141 | Ga0075434_100651275 | 3300006871 | Bacteria | 1072 |
| 142 | Ga0075434_100719944 | 3300006871 | Bacteria | 1015 |
| 143 | Ga0075434_101199427 | 3300006871 | Bacteria | 771 |
| 144 | Ga0075429_100016987 | 3300006880 | Bacteria | 6293 |
| 145 | Ga0075429_100057027 | 3300006880 | Bacteria | 3400 |
| 146 | Ga0075429_100057634 | 3300006880 | Bacteria | 3382 |
| 147 | Ga0075429_100789704 | 3300006880 | Bacteria | 831 |
| 148 | Ga0068865_100186987 | 3300006881 | Bacteria | 1599 |
| 149 | Ga0068865_100347971 | 3300006881 | Bacteria | 1200 |
| 150 | Ga0075436_100001714 | 3300006914 | Bacteria | 15015 |
| 151 | Ga0075436_100026167 | 3300006914 | Bacteria | 4017 |
| 152 | Ga0075436_100063724 | 3300006914 | Bacteria | 2547 |
| 153 | Ga0075436_100413984 | 3300006914 | Bacteria | 978 |
| 154 | Ga0075436_100439376 | 3300006914 | Bacteria | 949 |
| 155 | Ga0097620_100051609 | 3300006931 | Bacteria | 4134 |
| 156 | Ga0097620_100522101 | 3300006931 | Bacteria | 1282 |
| 157 | Ga0097620_100559697 | 3300006931 | Bacteria | 1238 |
| 158 | Ga0075435_100000194 | 3300007076 | Bacteria | 36738 |
| 159 | Ga0075435_100014302 | 3300007076 | Bacteria | 5927 |
| 160 | Ga0075435_100034736 | 3300007076 | Bacteria | 3997 |
| 161 | Ga0075435_100048938 | 3300007076 | Bacteria | 3397 |
| 162 | Ga0075435_100066269 | 3300007076 | Bacteria | 2937 |
| 163 | Ga0075435_100075373 | 3300007076 | Bacteria | 2762 |
| 164 | Ga0075435_100075874 | 3300007076 | Bacteria | 2754 |
| 165 | Ga0075435_100123746 | 3300007076 | Bacteria | 2160 |
| 166 | Ga0075435_100350812 | 3300007076 | Bacteria | 1265 |
| 167 | Ga0099794_10157334 | 3300007265 | Bacteria | 1155 |
| 168 | Ga0105240_10143538 | 3300009093 | Bacteria | 2852 |
| 169 | Ga0111539_10003496 | 3300009094 | Bacteria | 20721 |
| 170 | Ga0111539_10012297 | 3300009094 | Bacteria | 10727 |
| 171 | Ga0111539_10015082 | 3300009094 | Bacteria | 9631 |
| 172 | Ga0111539_10028441 | 3300009094 | Bacteria | 6819 |
| 173 | Ga0111539_10058660 | 3300009094 | Bacteria | 4566 |
| 174 | Ga0111539_10081307 | 3300009094 | Bacteria | 3811 |
| 175 | Ga0111539_10106882 | 3300009094 | Bacteria | 3283 |
| 176 | Ga0111539_10120490 | 3300009094 | Bacteria | 3074 |
| 177 | Ga0111539_10141696 | 3300009094 | Bacteria | 2814 |
| 178 | Ga0111539_10244636 | 3300009094 | Bacteria | 2088 |
| 179 | Ga0111539_10299996 | 3300009094 | Bacteria | 1870 |
| 180 | Ga0105245_10252552 | 3300009098 | Bacteria | 1714 |
| 181 | Ga0114129_10001894 | 3300009147 | Bacteria | 28518 |
| 182 | Ga0114129_10002646 | 3300009147 | Bacteria | 24923 |
| 183 | Ga0114129_10008232 | 3300009147 | Bacteria | 14867 |
| 184 | Ga0114129_10011164 | 3300009147 | Bacteria | 12805 |
| 185 | Ga0114129_10017826 | 3300009147 | Bacteria | 10110 |
| 186 | Ga0114129_10019384 | 3300009147 | Bacteria | 9687 |
| 187 | Ga0114129_10027741 | 3300009147 | Bacteria | 8017 |
| 188 | Ga0114129_10040050 | 3300009147 | Bacteria | 6608 |
| 189 | Ga0114129_10049705 | 3300009147 | Bacteria | 5891 |
| 190 | Ga0114129_10079577 | 3300009147 | Bacteria | 4557 |
| 191 | Ga0114129_10107750 | 3300009147 | Bacteria | 3847 |
| 192 | Ga0114129_10109253 | 3300009147 | Bacteria | 3818 |
| 193 | Ga0114129_10181533 | 3300009147 | Bacteria | 2863 |
| 194 | Ga0114129_10337183 | 3300009147 | Bacteria | 2001 |
| 195 | Ga0114129_10419546 | 3300009147 | Bacteria | 1760 |
| 196 | Ga0114129_10604545 | 3300009147 | Bacteria | 1420 |
| 197 | Ga0114129_10846638 | 3300009147 | Bacteria | 1163 |
| 198 | Ga0105243_10007218 | 3300009148 | Bacteria | 8539 |
| 199 | Ga0105241_10665990 | 3300009174 | Bacteria | 947 |
| 200 | Ga0105248_10037353 | 3300009177 | Bacteria | 5434 |
| 201 | Ga0105248_10075879 | 3300009177 | Bacteria | 3778 |
| 202 | Ga0105238_10834720 | 3300009551 | Bacteria | 938 |
| 203 | Ga0105249_10014767 | 3300009553 | Bacteria | 6902 |
| 204 | Ga0105249_10076416 | 3300009553 | Bacteria | 3104 |
| 205 | Ga0105249_10181220 | 3300009553 | Bacteria | 2049 |
| 206 | Ga0105249_10403160 | 3300009553 | Bacteria | 1398 |
| 207 | Ga0105249_10818639 | 3300009553 | Bacteria | 996 |
| 208 | Ga0105239_10397736 | 3300010375 | Bacteria | 1559 |
| 209 | Ga0105246_10016936 | 3300011119 | Bacteria | 4627 |
| 210 | Ga0105246_10141803 | 3300011119 | Bacteria | 1808 |
| 211 | Ga0157378_10004825 | 3300013297 | Bacteria | 11816 |
| 212 | Ga0157375_10043926 | 3300013308 | Bacteria | 4337 |
| 213 | Ga0157375_10109162 | 3300013308 | Bacteria | 2863 |
| 214 | Ga0157375_10682420 | 3300013308 | Bacteria | 1182 |
| 215 | Ga0163163_10430384 | 3300014325 | Bacteria | 1379 |
| 216 | Ga0163163_10929338 | 3300014325 | Bacteria | 933 |
| 217 | Ga0157380_10006984 | 3300014326 | Bacteria | 7991 |
| 218 | Ga0157380_10142197 | 3300014326 | Bacteria | 2063 |
| 219 | Ga0157380_10346367 | 3300014326 | Bacteria | 1388 |
| 220 | Ga0157380_10697394 | 3300014326 | Bacteria | 1020 |
| 221 | Ga0157380_10969838 | 3300014326 | Bacteria | 881 |
| 222 | Ga0157377_10204608 | 3300014745 | Bacteria | 1255 |
| 223 | Ga0157379_10228800 | 3300014968 | Bacteria | 1685 |
| 224 | Ga0157376_10095942 | 3300014969 | Bacteria | 2580 |
| 225 | Ga0157376_10330210 | 3300014969 | Bacteria | 1453 |
| 226 | Ga0163161_10479118 | 3300017792 | Bacteria | 1010 |
| 227 | Ga0209566_100300 | 3300025225 | Bacteria | 44962 |
| 228 | Ga0207697_10019981 | 3300025315 | Bacteria | 2743 |
| 229 | Ga0207697_10254654 | 3300025315 | Bacteria | 777 |
| 230 | Ga0207682_10043316 | 3300025893 | Bacteria | 1842 |
| 231 | Ga0207680_10004399 | 3300025903 | Bacteria | 6681 |
| 232 | Ga0207680_10151917 | 3300025903 | Bacteria | 1544 |
| 233 | Ga0207645_10006786 | 3300025907 | Bacteria | 8174 |
| 234 | Ga0207643_10062750 | 3300025908 | Bacteria | 2123 |
| 235 | Ga0207684_10287940 | 3300025910 | Bacteria | 1417 |
| 236 | Ga0207707_10402752 | 3300025912 | Bacteria | 1174 |
| 237 | Ga0207695_10375767 | 3300025913 | Bacteria | 1307 |
| 238 | Ga0207660_10114007 | 3300025917 | Bacteria | 2038 |
| 239 | Ga0207649_10030489 | 3300025920 | Bacteria | 3195 |
| 240 | Ga0207646_10383444 | 3300025922 | Bacteria | 1270 |
| 241 | Ga0207681_10071697 | 3300025923 | Bacteria | 2417 |
| 242 | Ga0207681_10656661 | 3300025923 | Bacteria | 870 |
| 243 | Ga0207694_10453436 | 3300025924 | Bacteria | 1071 |
| 244 | Ga0207650_10030255 | 3300025925 | Bacteria | 3898 |
| 245 | Ga0207650_10109608 | 3300025925 | Bacteria | 2135 |
| 246 | Ga0207659_10015920 | 3300025926 | Bacteria | 4885 |
| 247 | Ga0207659_10163787 | 3300025926 | Bacteria | 1748 |
| 248 | Ga0207659_10182193 | 3300025926 | Bacteria | 1665 |
| 249 | Ga0207644_10167889 | 3300025931 | Bacteria | 1711 |
| 250 | Ga0207690_10041392 | 3300025932 | Bacteria | 3019 |
| 251 | Ga0207706_10066478 | 3300025933 | Bacteria | 3173 |
| 252 | Ga0207706_10181050 | 3300025933 | Bacteria | 1851 |
| 253 | Ga0207706_10317062 | 3300025933 | Bacteria | 1357 |
| 254 | Ga0207686_10281396 | 3300025934 | Bacteria | 1228 |
| 255 | Ga0207709_10055938 | 3300025935 | Bacteria | 2440 |
| 256 | Ga0207670_10193456 | 3300025936 | Bacteria | 1540 |
| 257 | Ga0207669_10089292 | 3300025937 | Bacteria | 2001 |
| 258 | Ga0207704_10350641 | 3300025938 | Bacteria | 1149 |
| 259 | Ga0207691_10016063 | 3300025940 | Bacteria | 7112 |
| 260 | Ga0207691_10072118 | 3300025940 | Bacteria | 3115 |
| 261 | Ga0207691_10732981 | 3300025940 | Bacteria | 833 |
| 262 | Ga0207711_10033593 | 3300025941 | Bacteria | 4342 |
| 263 | Ga0207711_10037902 | 3300025941 | Bacteria | 4098 |
| 264 | Ga0207711_10052838 | 3300025941 | Bacteria | 3484 |
| 265 | Ga0207661_10026955 | 3300025944 | Bacteria | 4385 |
| 266 | Ga0207679_10303525 | 3300025945 | Bacteria | 1377 |
| 267 | Ga0207667_10424804 | 3300025949 | Bacteria | 1352 |
| 268 | Ga0207651_10126500 | 3300025960 | Bacteria | 1948 |
| 269 | Ga0207651_10144918 | 3300025960 | Bacteria | 1840 |
| 270 | Ga0207651_10553202 | 3300025960 | Bacteria | 1001 |
| 271 | Ga0207712_10027589 | 3300025961 | Bacteria | 3792 |
| 272 | Ga0207712_10371749 | 3300025961 | Bacteria | 1194 |
| 273 | Ga0207712_10596139 | 3300025961 | Bacteria | 955 |
| 274 | Ga0207668_10068322 | 3300025972 | Bacteria | 2526 |
| 275 | Ga0207640_10038589 | 3300025981 | Bacteria | 3016 |
| 276 | Ga0207640_10046360 | 3300025981 | Bacteria | 2796 |
| 277 | Ga0207658_10239660 | 3300025986 | Bacteria | 1536 |
| 278 | Ga0207677_10144493 | 3300026023 | Bacteria | 1826 |
| 279 | Ga0207677_10220837 | 3300026023 | Bacteria | 1520 |
| 280 | Ga0207677_10281175 | 3300026023 | Bacteria | 1366 |
| 281 | Ga0207677_10368607 | 3300026023 | Bacteria | 1209 |
| 282 | Ga0207703_10014415 | 3300026035 | Bacteria | 6164 |
| 283 | Ga0207678_10044661 | 3300026067 | Bacteria | 3832 |
| 284 | Ga0207708_10133683 | 3300026075 | Bacteria | 1941 |
| 285 | Ga0207708_10350043 | 3300026075 | Bacteria | 1212 |
| 286 | Ga0207641_10000787 | 3300026088 | Bacteria | 33852 |
| 287 | Ga0207641_10538138 | 3300026088 | Bacteria | 1138 |
| 288 | Ga0207641_10832257 | 3300026088 | Bacteria | 914 |
| 289 | Ga0207648_10006036 | 3300026089 | Bacteria | 12081 |
| 290 | Ga0207648_10348737 | 3300026089 | Bacteria | 1334 |
| 291 | Ga0207676_10061980 | 3300026095 | Bacteria | 2964 |
| 292 | Ga0207676_10169240 | 3300026095 | Bacteria | 1902 |
| 293 | Ga0207676_10203977 | 3300026095 | Bacteria | 1749 |
| 294 | Ga0207674_10408761 | 3300026116 | Bacteria | 1312 |
| 295 | Ga0207675_100031461 | 3300026118 | Bacteria | 4942 |
| 296 | Ga0207675_100072492 | 3300026118 | Bacteria | 3221 |
| 297 | Ga0207675_100191832 | 3300026118 | Bacteria | 1960 |
| 298 | Ga0207675_100293359 | 3300026118 | Bacteria | 1582 |
| 299 | Ga0207675_100426721 | 3300026118 | Bacteria | 1310 |
| 300 | Ga0207675_100467597 | 3300026118 | Bacteria | 1252 |
| 301 | Ga0207683_10294516 | 3300026121 | Bacteria | 1484 |
| 302 | Ga0209371_1000002 | 3300027312 | Bacteria | 1551985 |
| 303 | Ga0209371_1000109 | 3300027312 | Bacteria | 141217 |
| 304 | Ga0209813_10091501 | 3300027866 | Bacteria | 1022 |
| 305 | Ga0207428_10000569 | 3300027907 | Bacteria | 43728 |
| 306 | Ga0207428_10008813 | 3300027907 | Bacteria | 9095 |
| 307 | Ga0207428_10010324 | 3300027907 | Bacteria | 8348 |
| 308 | Ga0207428_10016271 | 3300027907 | Bacteria | 6403 |
| 309 | Ga0207428_10027496 | 3300027907 | Bacteria | 4735 |
| 310 | Ga0207428_10484143 | 3300027907 | Bacteria | 900 |
| 311 | Ga0268265_10015651 | 3300028380 | Bacteria | 5193 |
| 312 | Ga0268265_10068627 | 3300028380 | Bacteria | 2750 |
| 313 | Ga0268265_10474492 | 3300028380 | Bacteria | 1173 |
| 314 | Ga0268264_10754949 | 3300028381 | Bacteria | 969 |
| 315 | Ga0307517_10012397 | 3300028786 | Bacteria | 11705 |
| 316 | Ga0268256_1000002 | 3300030500 | Bacteria | 1535763 |
| 317 | Ga0265332_10075004 | 3300031238 | Bacteria | 1438 |
| 318 | Ga0265339_10000105 | 3300031249 | Bacteria | 68586 |
| 319 | Ga0265316_10001844 | 3300031344 | Bacteria | 22283 |
| 320 | Ga0307408_100007671 | 3300031548 | Bacteria | 7135 |
| 321 | Ga0307408_100393543 | 3300031548 | Bacteria | 1188 |
| 322 | Ga0316575_10126225 | 3300031665 | Bacteria | 1048 |
| 323 | Ga0265314_10000002 | 3300031711 | Bacteria | 2092193 |
| 324 | Ga0316576_10016511 | 3300031727 | Bacteria | 4988 |
| 325 | Ga0316577_10007339 | 3300031733 | Bacteria | 5879 |
| 326 | Ga0316577_10076038 | 3300031733 | Bacteria | 1875 |
| 327 | Ga0307406_10022262 | 3300031901 | Bacteria | 3758 |
| 328 | Ga0307412_10015038 | 3300031911 | Bacteria | 4577 |
| 329 | Ga0307412_10017018 | 3300031911 | Bacteria | 4345 |
| 330 | Ga0307409_100884860 | 3300031995 | Bacteria | 906 |
| 331 | Ga0307416_100724123 | 3300032002 | Bacteria | 1086 |
| 332 | Ga0307411_10077291 | 3300032005 | Bacteria | 2278 |
| 333 | Ga0307415_100553953 | 3300032126 | Bacteria | 1015 |
| 334 | Ga0307415_100636746 | 3300032126 | Bacteria | 954 |
| 335 | Ga0373930_0022427 | 3300034816 | Bacteria | 1248 |
| 336 | Ga0373950_0001574 | 3300034818 | Bacteria | 3003 |
| 337 | Ga0373938_0001334 | 3300034957 | Bacteria | 3962 |
| 338 | Ga0373928_0000747 | 3300035084 | Bacteria | 6364 |
| 339 | Ga0373929_0002475 | 3300035085 | Bacteria | 3395 |
| 340 | Ga0373940_0031184 | 3300035088 | Bacteria | 1421 |
| 341 | Ga0373949_0002243 | 3300035090 | Bacteria | 5048 |
| 342 | Ga0373952_0001940 | 3300035092 | Bacteria | 3748 |
| 343 | Ga0373939_0001590 | 3300035114 | Bacteria | 5489 |
| 344 | Ga0373941_0001410 | 3300035115 | Bacteria | 5065 |
| 345 | Ga0373941_0083762 | 3300035115 | Bacteria | 1082 |
| 346 | Ga0373960_0000217 | 3300035121 | Bacteria | 10554 |
| 347 | Ga0373942_0001105 | 3300035207 | Bacteria | 7178 |
| 348 | Ga0373961_0068218 | 3300035241 | Bacteria | 1094 |
| 349 | Ga0316574_0014975 | 3300035398 | Bacteria | 4492 |
| 350 | Ga0373947_0167359 | 3300035725 | Bacteria | 1425 |
| 351 | Ga0316582_0057966 | 3300036647 | Bacteria | 2475 |
| 352 | Ga0316582_0204448 | 3300036647 | Bacteria | 1348 |
| 353 | Ga0316582_0343150 | 3300036647 | Bacteria | 1027 |
| 354 | Ga0373925_0150188 | 3300037068 | Bacteria | 1829 |
| 355 | Ga0373925_0214522 | 3300037068 | Bacteria | 1534 |
| 356 | Ga0400490_37142 | 3300038726 | Bacteria | 1275 |
| 357 | Ga0400485_11367 | 3300038735 | Bacteria | 22273 |
| 358 | Ga0400486_17557 | 3300038742 | Bacteria | 1491 |
| 359 | Ga0400486_19491 | 3300038742 | Bacteria | 18683 |
| 360 | Ga0400483_183368 | 3300039062 | Bacteria | 2734 |
| 361 | Ga0400489_48110 | 3300039093 | Bacteria | 7465 |
| 362 | Ga0400487_07019 | 3300039110 | Bacteria | 5905 |
| 363 | Ga0439431_0020719 | 3300041997 | Bacteria | 1573 |
| 364 | Ga0439441_037187 | 3300042001 | Bacteria | 964 |
| 365 | Ga0439434_0045787 | 3300042435 | Bacteria | 1350 |
| 366 | Ga0439464_0003148 | 3300042439 | Bacteria | 4140 |
| 367 | Ga0451577_0366440 | 3300042876 | Bacteria | 1307 |
| 368 | Ga0453684_0000640 | 3300044712 | Bacteria | 126342 |
| 369 | Ga0453684_0016890 | 3300044712 | Bacteria | 11357 |
| 370 | Ga0453684_0386456 | 3300044712 | Bacteria | 1570 |
| 371 | Ga0451576_0035389 | 3300045051 | Bacteria | 5298 |
| 372 | Ga0451576_0070276 | 3300045051 | Bacteria | 3644 |
| 373 | Ga0451576_0207118 | 3300045051 | Bacteria | 2048 |
| 374 | Ga0495603_0042804 | 3300046455 | Bacteria | 2706 |
| 375 | Ga0495629_0036298 | 3300046459 | Bacteria | 3480 |
| 376 | Ga0495666_0000647 | 3300046526 | Bacteria | 15640 |
| 377 | Ga0495665_0000343 | 3300046531 | Bacteria | 23520 |
| 378 | Ga0495588_0090142 | 3300046674 | Bacteria | 1606 |
| 379 | Ga0495658_0104503 | 3300046683 | Bacteria | 1695 |
| 380 | Ga0495669_0302826 | 3300046684 | Bacteria | 771 |
| 381 | Ga0495581_0064431 | 3300047315 | Bacteria | 2117 |
| 382 | Ga0495674_0012568 | 3300047319 | Bacteria | 7976 |
| 383 | Ga0495676_0013598 | 3300047321 | Bacteria | 7308 |
| 384 | Ga0496100_0052021 | 3300048903 | Bacteria | 2661 |
| 385 | Ga0496101_0027364 | 3300048904 | Bacteria | 3972 |
| 386 | Ga0496102_0219323 | 3300048905 | Bacteria | 1793 |
| 387 | Ga0496102_0629768 | 3300048905 | Bacteria | 996 |
| 388 | Ga0496104_0033099 | 3300048907 | Bacteria | 4812 |
| 389 | Ga0496105_0027302 | 3300048908 | Bacteria | 4662 |
| 390 | Ga0496106_0044866 | 3300048909 | Bacteria | 3319 |
| 391 | Ga0496106_0393092 | 3300048909 | Bacteria | 1114 |
| 392 | Ga0496106_0516665 | 3300048909 | Bacteria | 959 |
| 393 | Ga0496107_0111757 | 3300048910 | Bacteria | 2008 |
| 394 | Ga0496108_0000512 | 3300048911 | Bacteria | 30311 |
| 395 | Ga0496109_0068453 | 3300048912 | Bacteria | 3254 |
| 396 | Ga0496109_0225734 | 3300048912 | Bacteria | 1762 |
| 397 | Ga0496110_0021439 | 3300048913 | Bacteria | 5471 |
| 398 | Ga0496110_0514795 | 3300048913 | Bacteria | 1089 |
| 399 | Ga0496111_0055113 | 3300048914 | Bacteria | 2875 |
| 400 | Ga0496112_0003921 | 3300048915 | Bacteria | 12456 |
| 401 | Ga0496112_0398204 | 3300048915 | Bacteria | 1317 |
| 402 | Ga0496113_0144851 | 3300048916 | Bacteria | 1871 |
| 403 | Ga0496114_0127233 | 3300048917 | Bacteria | 2197 |
| 404 | Ga0496115_0526855 | 3300048918 | Bacteria | 947 |
| 405 | Ga0496116_0138005 | 3300048919 | Bacteria | 1377 |
| 406 | Ga0496121_0152485 | 3300048924 | Bacteria | 1699 |
| 407 | Ga0501068_0041640 | 3300049584 | Bacteria | 2761 |
| 408 | Ga0501076_0379613 | 3300049592 | Bacteria | 1162 |
| 409 | Ga0501279_014934 | 3300049775 | Bacteria | 1072 |
| 410 | nmdc:mga00v17_302925_c1 | 3300050491 | Bacteria | 1038 |
| 411 | nmdc:mga0k408_1542_c1 | 3300050493 | Bacteria | 12447 |
| 412 | nmdc:mga0k408_9782_c1 | 3300050493 | Bacteria | 5176 |
| 413 | nmdc:mga06z11_10606_c1 | 3300050494 | Bacteria | 3935 |
| 414 | nmdc:mga04h51_13456_c1 | 3300050495 | Bacteria | 2316 |
| 415 | nmdc:mga04h51_85868_c1 | 3300050495 | Bacteria | 1125 |
| 416 | nmdc:mga07m45_18659_c1 | 3300050496 | Bacteria | 3750 |
| 417 | nmdc:mga07m45_9623_c1 | 3300050496 | Bacteria | 5023 |
| 418 | nmdc:mga05p37_13913_c1 | 3300050507 | Bacteria | 9643 |
| 419 | nmdc:mga05p37_20502_c2 | 3300050507 | Bacteria | 5690 |
| 420 | nmdc:mga05p37_250897_c1 | 3300050507 | Bacteria | 2123 |
| 421 | nmdc:mga05p37_291644_c1 | 3300050507 | Bacteria | 1942 |
| 422 | nmdc:mga05p37_4241_c1 | 3300050507 | Bacteria | 16747 |
| 423 | nmdc:mga05p37_49374_c1 | 3300050507 | Bacteria | 5175 |
| 424 | nmdc:mga05p37_644758_c1 | 3300050507 | Bacteria | 1187 |
| 425 | nmdc:mga05p37_6919_c1 | 3300050507 | Bacteria | 13369 |
| 426 | nmdc:mga05p37_74683_c1 | 3300050507 | Bacteria | 4172 |
| 427 | nmdc:mga05p37_802289_c1 | 3300050507 | Bacteria | 1030 |
| 428 | nmdc:mga05p37_81042_c1 | 3300050507 | Bacteria | 3998 |
| 429 | nmdc:mga05p37_94195_c1 | 3300050507 | Bacteria | 3690 |
| 430 | nmdc:mga09592_143381_c1 | 3300050508 | Bacteria | 2060 |
| 431 | nmdc:mga09592_15773_c1 | 3300050508 | Bacteria | 6173 |
| 432 | nmdc:mga09592_199963_c1 | 3300050508 | Bacteria | 1730 |
| 433 | nmdc:mga09592_20053_c1 | 3300050508 | Bacteria | 5494 |
| 434 | nmdc:mga09592_26467_c1 | 3300050508 | Bacteria | 4806 |
| 435 | nmdc:mga0qj67_48815_c1 | 3300050509 | Bacteria | 3344 |
| 436 | nmdc:mga0qj67_56449_c1 | 3300050509 | Bacteria | 3112 |
| 437 | nmdc:mga0qj67_5697_c1 | 3300050509 | Bacteria | 9110 |
| 438 | nmdc:mga06r32_127057_c1 | 3300050510 | Bacteria | 2519 |
| 439 | nmdc:mga06r32_236644_c1 | 3300050510 | Bacteria | 1814 |
| 440 | nmdc:mga06r32_25516_c1 | 3300050510 | Bacteria | 5498 |
| 441 | nmdc:mga06r32_4645_c1 | 3300050510 | Bacteria | 12324 |
| 442 | nmdc:mga06r32_53285_c1 | 3300050510 | Bacteria | 3876 |
| 443 | nmdc:mga06r32_58541_c1 | 3300050510 | Bacteria | 3703 |
| 444 | nmdc:mga06r32_622476_c1 | 3300050510 | Bacteria | 1049 |
| 445 | nmdc:mga08y16_12595_c1 | 3300050511 | Bacteria | 8896 |
| 446 | nmdc:mga08y16_15145_c1 | 3300050511 | Bacteria | 8107 |
| 447 | nmdc:mga08y16_15920_c1 | 3300050511 | Bacteria | 7904 |
| 448 | nmdc:mga08y16_46327_c1 | 3300050511 | Bacteria | 4552 |
| 449 | nmdc:mga08y16_637952_c1 | 3300050511 | Bacteria | 1070 |
| 450 | nmdc:mga08y16_69609_c1 | 3300050511 | Bacteria | 3668 |
| 451 | nmdc:mga08y16_697596_c1 | 3300050511 | Bacteria | 1015 |
| 452 | nmdc:mga08y16_79616_c1 | 3300050511 | Bacteria | 3415 |
| 453 | nmdc:mga0n895_104230_c1 | 3300050512 | Bacteria | 2849 |
| 454 | nmdc:mga0n895_1127571_c1 | 3300050512 | Bacteria | 761 |
| 455 | nmdc:mga0n895_25758_c1 | 3300050512 | Bacteria | 5562 |
| 456 | nmdc:mga0n895_30_c1 | 3300050512 | Bacteria | 84416 |
| 457 | nmdc:mga0n895_366494_c1 | 3300050512 | Bacteria | 1459 |
| 458 | nmdc:mga0n895_45771_c1 | 3300050512 | Bacteria | 4272 |
| 459 | nmdc:mga0n895_707129_c1 | 3300050512 | Bacteria | 1003 |
| 460 | nmdc:mga0n895_798130_c1 | 3300050512 | Bacteria | 935 |
| 461 | nmdc:mga0n895_83666_c1 | 3300050512 | Bacteria | 3183 |
| 462 | nmdc:mga0n895_88098_c1 | 3300050512 | Bacteria | 3103 |
| 463 | nmdc:mga0rr50_103976_c1 | 3300050513 | Bacteria | 2236 |
| 464 | nmdc:mga0rr50_2_c1 | 3300050513 | Bacteria | 373938 |
| 465 | nmdc:mga0rr50_35288_c1 | 3300050513 | Bacteria | 3590 |
| 466 | nmdc:mga0rr50_42901_c1 | 3300050513 | Bacteria | 3307 |
| 467 | nmdc:mga0rr50_555960_c1 | 3300050513 | Bacteria | 977 |
| 468 | nmdc:mga0rr50_867708_c1 | 3300050513 | Bacteria | 770 |
| 469 | nmdc:mga08x19_126191_c1 | 3300050514 | Bacteria | 1719 |
| 470 | nmdc:mga08x19_230_c1 | 3300050514 | Bacteria | 42633 |
| 471 | nmdc:mga08x19_407531_c1 | 3300050514 | Bacteria | 954 |
| 472 | nmdc:mga08x19_41654_c1 | 3300050514 | Bacteria | 2925 |
| 473 | nmdc:mga08x19_6107_c1 | 3300050514 | Bacteria | 7122 |
| 474 | nmdc:mga0a205_312029_c1 | 3300050515 | Bacteria | 1445 |
| 475 | nmdc:mga0a205_422249_c1 | 3300050515 | Bacteria | 1195 |
| 476 | nmdc:mga0a205_441956_c1 | 3300050515 | Bacteria | 1161 |
| 477 | nmdc:mga0a205_547354_c1 | 3300050515 | Bacteria | 1013 |
| 478 | nmdc:mga0a205_761_c1 | 3300050515 | Bacteria | 26018 |
| 479 | Ga0500646_0180938 | 3300053090 | Bacteria | 714 |
| 480 | Ga0500650_0000050 | 3300053098 | Bacteria | 39314 |
| 481 | Ga0500616_0218147 | 3300053153 | Bacteria | 834 |
| 482 | Ga0530510_0119701 | 3300061734 | Bacteria | 1932 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2739367663 | 2739648180 | 216 |
| 2 | 3300028786 | Ga0307517_10012397 | Ga0307517_100123979 | 218 |
| 3 | 3300005290 | Ga0065712_10003711 | Ga0065712_100037114 | 220 |
| 4 | 3300005329 | Ga0070683_100001129 | Ga0070683_1000011294 | 220 |
| 5 | 3300005331 | Ga0070670_100176157 | Ga0070670_1001761573 | 220 |
| 6 | 3300005335 | Ga0070666_10082537 | Ga0070666_100825373 | 220 |
| 7 | 3300005344 | Ga0070661_100058001 | Ga0070661_1000580013 | 220 |
| 8 | 3300005535 | Ga0070684_100000586 | Ga0070684_10000058613 | 220 |
| 9 | 3300005543 | Ga0070672_100844654 | Ga0070672_1008446541 | 220 |
| 10 | 3300013308 | Ga0157375_10109162 | Ga0157375_101091626 | 220 |
| 11 | 3300014325 | Ga0163163_10929338 | Ga0163163_109293381 | 220 |
| 12 | 3300025315 | Ga0207697_10019981 | Ga0207697_100199813 | 220 |
| 13 | 3300025903 | Ga0207680_10151917 | Ga0207680_101519171 | 220 |
| 14 | 3300025920 | Ga0207649_10030489 | Ga0207649_100304892 | 220 |
| 15 | 3300025925 | Ga0207650_10109608 | Ga0207650_101096082 | 220 |
| 16 | 3300025926 | Ga0207659_10163787 | Ga0207659_101637872 | 220 |
| 17 | 3300025940 | Ga0207691_10732981 | Ga0207691_107329811 | 220 |
| 18 | 3300025941 | Ga0207711_10037902 | Ga0207711_100379023 | 220 |
| 19 | 3300025944 | Ga0207661_10026955 | Ga0207661_100269553 | 220 |
| 20 | 3300026095 | Ga0207676_10169240 | Ga0207676_101692401 | 220 |
| 21 | 3300032126 | Ga0307415_100636746 | Ga0307415_1006367461 | 220 |
| 22 | 3300005471 | Ga0070698_100239614 | Ga0070698_1002396142 | 221 |
| 23 | 3300041997 | Ga0439431_0020719 | Ga0439431_0020719_139_828 | 221 |
| 24 | 3300042435 | Ga0439434_0045787 | Ga0439434_0045787_324_1013 | 221 |
| 25 | 3300045051 | Ga0451576_0070276 | Ga0451576_0070276_863_1552 | 221 |
| 26 | 3300014969 | Ga0157376_10095942 | Ga0157376_100959422 | 222 |
| 27 | 3300031911 | Ga0307412_10015038 | Ga0307412_100150385 | 222 |
| 28 | 3300037068 | Ga0373925_0150188 | Ga0373925_0150188_505_1203 | 222 |
| 29 | 3300006871 | Ga0075434_101199427 | Ga0075434_1011994271 | 223 |
| 30 | 3300006844 | Ga0075428_101296353 | Ga0075428_1012963531 | 224 |
| 31 | 3300005330 | Ga0070690_100323279 | Ga0070690_1003232792 | 225 |
| 32 | 3300005335 | Ga0070666_10266729 | Ga0070666_102667291 | 225 |
| 33 | 3300005338 | Ga0068868_100457399 | Ga0068868_1004573991 | 225 |
| 34 | 3300005543 | Ga0070672_100040467 | Ga0070672_1000404674 | 225 |
| 35 | 3300005549 | Ga0070704_100033593 | Ga0070704_1000335934 | 225 |
| 36 | 3300005617 | Ga0068859_100051609 | Ga0068859_1000516094 | 225 |
| 37 | 3300005617 | Ga0068859_100559669 | Ga0068859_1005596692 | 225 |
| 38 | 3300005841 | Ga0068863_100023252 | Ga0068863_1000232526 | 225 |
| 39 | 3300005842 | Ga0068858_100254314 | Ga0068858_1002543142 | 225 |
| 40 | 3300005844 | Ga0068862_100012433 | Ga0068862_1000124337 | 225 |
| 41 | 3300005844 | Ga0068862_100279847 | Ga0068862_1002798471 | 225 |
| 42 | 3300006042 | Ga0075368_10143571 | Ga0075368_101435712 | 225 |
| 43 | 3300006195 | Ga0075366_10004695 | Ga0075366_100046951 | 225 |
| 44 | 3300006844 | Ga0075428_100001713 | Ga0075428_1000017138 | 225 |
| 45 | 3300006846 | Ga0075430_100011218 | Ga0075430_1000112186 | 225 |
| 46 | 3300006847 | Ga0075431_100082874 | Ga0075431_1000828742 | 225 |
| 47 | 3300006847 | Ga0075431_100635610 | Ga0075431_1006356102 | 225 |
| 48 | 3300006852 | Ga0075433_10000648 | Ga0075433_1000064825 | 225 |
| 49 | 3300006852 | Ga0075433_10082214 | Ga0075433_100822142 | 225 |
| 50 | 3300006871 | Ga0075434_100000721 | Ga0075434_10000072116 | 225 |
| 51 | 3300006871 | Ga0075434_100011731 | Ga0075434_1000117314 | 225 |
| 52 | 3300006871 | Ga0075434_100012138 | Ga0075434_1000121385 | 225 |
| 53 | 3300006871 | Ga0075434_100651275 | Ga0075434_1006512752 | 225 |
| 54 | 3300006871 | Ga0075434_100719944 | Ga0075434_1007199442 | 225 |
| 55 | 3300006880 | Ga0075429_100016987 | Ga0075429_1000169874 | 225 |
| 56 | 3300006914 | Ga0075436_100001714 | Ga0075436_1000017143 | 225 |
| 57 | 3300006914 | Ga0075436_100026167 | Ga0075436_1000261672 | 225 |
| 58 | 3300006914 | Ga0075436_100063724 | Ga0075436_1000637243 | 225 |
| 59 | 3300006914 | Ga0075436_100413984 | Ga0075436_1004139842 | 225 |
| 60 | 3300006914 | Ga0075436_100439376 | Ga0075436_1004393762 | 225 |
| 61 | 3300006931 | Ga0097620_100051609 | Ga0097620_1000516092 | 225 |
| 62 | 3300006931 | Ga0097620_100559697 | Ga0097620_1005596971 | 225 |
| 63 | 3300007076 | Ga0075435_100000194 | Ga0075435_10000019417 | 225 |
| 64 | 3300007076 | Ga0075435_100014302 | Ga0075435_1000143023 | 225 |
| 65 | 3300007076 | Ga0075435_100034736 | Ga0075435_1000347364 | 225 |
| 66 | 3300007076 | Ga0075435_100066269 | Ga0075435_1000662693 | 225 |
| 67 | 3300007076 | Ga0075435_100075373 | Ga0075435_1000753733 | 225 |
| 68 | 3300007076 | Ga0075435_100350812 | Ga0075435_1003508122 | 225 |
| 69 | 3300007265 | Ga0099794_10157334 | Ga0099794_101573341 | 225 |
| 70 | 3300009094 | Ga0111539_10003496 | Ga0111539_100034969 | 225 |
| 71 | 3300009094 | Ga0111539_10058660 | Ga0111539_100586603 | 225 |
| 72 | 3300009147 | Ga0114129_10001894 | Ga0114129_100018949 | 225 |
| 73 | 3300009147 | Ga0114129_10008232 | Ga0114129_100082323 | 225 |
| 74 | 3300009147 | Ga0114129_10040050 | Ga0114129_100400502 | 225 |
| 75 | 3300009147 | Ga0114129_10049705 | Ga0114129_100497053 | 225 |
| 76 | 3300009147 | Ga0114129_10107750 | Ga0114129_101077503 | 225 |
| 77 | 3300009147 | Ga0114129_10181533 | Ga0114129_101815332 | 225 |
| 78 | 3300009147 | Ga0114129_10846638 | Ga0114129_108466382 | 225 |
| 79 | 3300009177 | Ga0105248_10037353 | Ga0105248_100373532 | 225 |
| 80 | 3300013308 | Ga0157375_10682420 | Ga0157375_106824201 | 225 |
| 81 | 3300014326 | Ga0157380_10697394 | Ga0157380_106973942 | 225 |
| 82 | 3300025903 | Ga0207680_10004399 | Ga0207680_100043997 | 225 |
| 83 | 3300025934 | Ga0207686_10281396 | Ga0207686_102813962 | 225 |
| 84 | 3300025936 | Ga0207670_10193456 | Ga0207670_101934562 | 225 |
| 85 | 3300025938 | Ga0207704_10350641 | Ga0207704_103506412 | 225 |
| 86 | 3300025940 | Ga0207691_10016063 | Ga0207691_100160637 | 225 |
| 87 | 3300025941 | Ga0207711_10033593 | Ga0207711_100335934 | 225 |
| 88 | 3300026023 | Ga0207677_10220837 | Ga0207677_102208372 | 225 |
| 89 | 3300026035 | Ga0207703_10014415 | Ga0207703_100144154 | 225 |
| 90 | 3300026075 | Ga0207708_10350043 | Ga0207708_103500432 | 225 |
| 91 | 3300026088 | Ga0207641_10000787 | Ga0207641_1000078728 | 225 |
| 92 | 3300026089 | Ga0207648_10348737 | Ga0207648_103487372 | 225 |
| 93 | 3300026118 | Ga0207675_100467597 | Ga0207675_1004675972 | 225 |
| 94 | 3300027866 | Ga0209813_10091501 | Ga0209813_100915012 | 225 |
| 95 | 3300027907 | Ga0207428_10000569 | Ga0207428_1000056933 | 225 |
| 96 | 3300027907 | Ga0207428_10027496 | Ga0207428_100274965 | 225 |
| 97 | 3300028380 | Ga0268265_10015651 | Ga0268265_100156514 | 225 |
| 98 | 3300031548 | Ga0307408_100007671 | Ga0307408_1000076715 | 225 |
| 99 | 3300031548 | Ga0307408_100393543 | Ga0307408_1003935432 | 225 |
| 100 | 3300031911 | Ga0307412_10017018 | Ga0307412_100170183 | 225 |
| 101 | 3300035115 | Ga0373941_0083762 | Ga0373941_0083762_240_977 | 225 |
| 102 | 3300042001 | Ga0439441_037187 | Ga0439441_037187_37_714 | 225 |
| 103 | 3300042439 | Ga0439464_0003148 | Ga0439464_0003148_1341_2018 | 225 |
| 104 | 3300042876 | Ga0451577_0366440 | Ga0451577_0366440_157_834 | 225 |
| 105 | 3300044712 | Ga0453684_0016890 | Ga0453684_0016890_8502_9179 | 225 |
| 106 | 3300044712 | Ga0453684_0386456 | Ga0453684_0386456_585_1262 | 225 |
| 107 | 3300046684 | Ga0495669_0302826 | Ga0495669_0302826_11_748 | 225 |
| 108 | 3300048909 | Ga0496106_0393092 | Ga0496106_0393092_415_1101 | 225 |
| 109 | 3300048912 | Ga0496109_0225734 | Ga0496109_0225734_154_831 | 225 |
| 110 | 3300048913 | Ga0496110_0514795 | Ga0496110_0514795_81_818 | 225 |
| 111 | 3300048915 | Ga0496112_0398204 | Ga0496112_0398204_456_1136 | 225 |
| 112 | 3300050493 | nmdc:mga0k408_1542_c1 | nmdc:mga0k408_1542_c1_2565_3242 | 225 |
| 113 | 3300050495 | nmdc:mga04h51_85868_c1 | nmdc:mga04h51_85868_c1_277_954 | 225 |
| 114 | 3300050496 | nmdc:mga07m45_9623_c1 | nmdc:mga07m45_9623_c1_318_995 | 225 |
| 115 | 3300050507 | nmdc:mga05p37_291644_c1 | nmdc:mga05p37_291644_c1_14_691 | 225 |
| 116 | 3300050507 | nmdc:mga05p37_4241_c1 | nmdc:mga05p37_4241_c1_9024_9701 | 225 |
| 117 | 3300050507 | nmdc:mga05p37_49374_c1 | nmdc:mga05p37_49374_c1_1496_2173 | 225 |
| 118 | 3300050507 | nmdc:mga05p37_644758_c1 | nmdc:mga05p37_644758_c1_238_915 | 225 |
| 119 | 3300050507 | nmdc:mga05p37_74683_c1 | nmdc:mga05p37_74683_c1_276_953 | 225 |
| 120 | 3300050507 | nmdc:mga05p37_802289_c1 | nmdc:mga05p37_802289_c1_343_1020 | 225 |
| 121 | 3300050507 | nmdc:mga05p37_94195_c1 | nmdc:mga05p37_94195_c1_118_804 | 225 |
| 122 | 3300050508 | nmdc:mga09592_15773_c1 | nmdc:mga09592_15773_c1_3095_3772 | 225 |
| 123 | 3300050509 | nmdc:mga0qj67_5697_c1 | nmdc:mga0qj67_5697_c1_6878_7555 | 225 |
| 124 | 3300050510 | nmdc:mga06r32_58541_c1 | nmdc:mga06r32_58541_c1_1651_2328 | 225 |
| 125 | 3300050510 | nmdc:mga06r32_622476_c1 | nmdc:mga06r32_622476_c1_348_1025 | 225 |
| 126 | 3300050511 | nmdc:mga08y16_12595_c1 | nmdc:mga08y16_12595_c1_3570_4310 | 225 |
| 127 | 3300050511 | nmdc:mga08y16_15920_c1 | nmdc:mga08y16_15920_c1_4668_5345 | 225 |
| 128 | 3300050512 | nmdc:mga0n895_104230_c1 | nmdc:mga0n895_104230_c1_1282_1959 | 225 |
| 129 | 3300050512 | nmdc:mga0n895_25758_c1 | nmdc:mga0n895_25758_c1_2403_3080 | 225 |
| 130 | 3300050512 | nmdc:mga0n895_30_c1 | nmdc:mga0n895_30_c1_75874_76551 | 225 |
| 131 | 3300050512 | nmdc:mga0n895_366494_c1 | nmdc:mga0n895_366494_c1_24_701 | 225 |
| 132 | 3300050512 | nmdc:mga0n895_45771_c1 | nmdc:mga0n895_45771_c1_3430_4107 | 225 |
| 133 | 3300050512 | nmdc:mga0n895_798130_c1 | nmdc:mga0n895_798130_c1_47_724 | 225 |
| 134 | 3300050512 | nmdc:mga0n895_83666_c1 | nmdc:mga0n895_83666_c1_1914_2645 | 225 |
| 135 | 3300050513 | nmdc:mga0rr50_2_c1 | nmdc:mga0rr50_2_c1_236627_237304 | 225 |
| 136 | 3300050513 | nmdc:mga0rr50_42901_c1 | nmdc:mga0rr50_42901_c1_267_944 | 225 |
| 137 | 3300050514 | nmdc:mga08x19_126191_c1 | nmdc:mga08x19_126191_c1_34_711 | 225 |
| 138 | 3300050514 | nmdc:mga08x19_230_c1 | nmdc:mga08x19_230_c1_15850_16527 | 225 |
| 139 | 3300050514 | nmdc:mga08x19_41654_c1 | nmdc:mga08x19_41654_c1_1768_2445 | 225 |
| 140 | 3300050514 | nmdc:mga08x19_6107_c1 | nmdc:mga08x19_6107_c1_1967_2644 | 225 |
| 141 | 3300050515 | nmdc:mga0a205_312029_c1 | nmdc:mga0a205_312029_c1_14_691 | 225 |
| 142 | 3300050515 | nmdc:mga0a205_547354_c1 | nmdc:mga0a205_547354_c1_125_802 | 225 |
| 143 | 3300050515 | nmdc:mga0a205_761_c1 | nmdc:mga0a205_761_c1_18020_18697 | 225 |
| 144 | 3300005293 | Ga0065715_10099610 | Ga0065715_100996103 | 226 |
| 145 | 3300005293 | Ga0065715_10249122 | Ga0065715_102491221 | 226 |
| 146 | 3300005293 | Ga0065715_10361679 | Ga0065715_103616792 | 226 |
| 147 | 3300005295 | Ga0065707_10026392 | Ga0065707_100263922 | 226 |
| 148 | 3300005295 | Ga0065707_10458283 | Ga0065707_104582831 | 226 |
| 149 | 3300005328 | Ga0070676_10007110 | Ga0070676_100071106 | 226 |
| 150 | 3300005328 | Ga0070676_10046925 | Ga0070676_100469253 | 226 |
| 151 | 3300005331 | Ga0070670_100153540 | Ga0070670_1001535402 | 226 |
| 152 | 3300005333 | Ga0070677_10039894 | Ga0070677_100398942 | 226 |
| 153 | 3300005336 | Ga0070680_100151638 | Ga0070680_1001516382 | 226 |
| 154 | 3300005347 | Ga0070668_100037437 | Ga0070668_1000374372 | 226 |
| 155 | 3300005347 | Ga0070668_100364701 | Ga0070668_1003647011 | 226 |
| 156 | 3300005353 | Ga0070669_100067057 | Ga0070669_1000670573 | 226 |
| 157 | 3300005353 | Ga0070669_100068483 | Ga0070669_1000684832 | 226 |
| 158 | 3300005353 | Ga0070669_100158391 | Ga0070669_1001583912 | 226 |
| 159 | 3300005354 | Ga0070675_100089304 | Ga0070675_1000893042 | 226 |
| 160 | 3300005355 | Ga0070671_100084277 | Ga0070671_1000842773 | 226 |
| 161 | 3300005356 | Ga0070674_100125138 | Ga0070674_1001251382 | 226 |
| 162 | 3300005356 | Ga0070674_100395974 | Ga0070674_1003959742 | 226 |
| 163 | 3300005364 | Ga0070673_100062947 | Ga0070673_1000629473 | 226 |
| 164 | 3300005367 | Ga0070667_100282718 | Ga0070667_1002827182 | 226 |
| 165 | 3300005438 | Ga0070701_10018259 | Ga0070701_100182593 | 226 |
| 166 | 3300005440 | Ga0070705_100070876 | Ga0070705_1000708762 | 226 |
| 167 | 3300005441 | Ga0070700_100012124 | Ga0070700_1000121242 | 226 |
| 168 | 3300005444 | Ga0070694_100034137 | Ga0070694_1000341373 | 226 |
| 169 | 3300005444 | Ga0070694_100246540 | Ga0070694_1002465401 | 226 |
| 170 | 3300005445 | Ga0070708_100320923 | Ga0070708_1003209232 | 226 |
| 171 | 3300005456 | Ga0070678_100151471 | Ga0070678_1001514713 | 226 |
| 172 | 3300005457 | Ga0070662_100090479 | Ga0070662_1000904792 | 226 |
| 173 | 3300005457 | Ga0070662_100305748 | Ga0070662_1003057482 | 226 |
| 174 | 3300005459 | Ga0068867_100005156 | Ga0068867_10000515611 | 226 |
| 175 | 3300005467 | Ga0070706_100288006 | Ga0070706_1002880062 | 226 |
| 176 | 3300005471 | Ga0070698_100062615 | Ga0070698_1000626152 | 226 |
| 177 | 3300005518 | Ga0070699_100133970 | Ga0070699_1001339702 | 226 |
| 178 | 3300005543 | Ga0070672_100310073 | Ga0070672_1003100732 | 226 |
| 179 | 3300005543 | Ga0070672_100426975 | Ga0070672_1004269751 | 226 |
| 180 | 3300005544 | Ga0070686_100136802 | Ga0070686_1001368022 | 226 |
| 181 | 3300005545 | Ga0070695_100010483 | Ga0070695_1000104838 | 226 |
| 182 | 3300005546 | Ga0070696_100002548 | Ga0070696_1000025488 | 226 |
| 183 | 3300005546 | Ga0070696_100026147 | Ga0070696_1000261472 | 226 |
| 184 | 3300005549 | Ga0070704_100089053 | Ga0070704_1000890532 | 226 |
| 185 | 3300005563 | Ga0068855_100127244 | Ga0068855_1001272442 | 226 |
| 186 | 3300005564 | Ga0070664_100003464 | Ga0070664_1000034643 | 226 |
| 187 | 3300005564 | Ga0070664_100715341 | Ga0070664_1007153411 | 226 |
| 188 | 3300005577 | Ga0068857_100816824 | Ga0068857_1008168241 | 226 |
| 189 | 3300005615 | Ga0070702_100046258 | Ga0070702_1000462582 | 226 |
| 190 | 3300005617 | Ga0068859_100522101 | Ga0068859_1005221012 | 226 |
| 191 | 3300005618 | Ga0068864_100186587 | Ga0068864_1001865872 | 226 |
| 192 | 3300005618 | Ga0068864_100257551 | Ga0068864_1002575511 | 226 |
| 193 | 3300005719 | Ga0068861_100006307 | Ga0068861_10000630710 | 226 |
| 194 | 3300005719 | Ga0068861_100167192 | Ga0068861_1001671923 | 226 |
| 195 | 3300005841 | Ga0068863_100912499 | Ga0068863_1009124991 | 226 |
| 196 | 3300005844 | Ga0068862_100019281 | Ga0068862_1000192811 | 226 |
| 197 | 3300005844 | Ga0068862_100086535 | Ga0068862_1000865352 | 226 |
| 198 | 3300005844 | Ga0068862_100136640 | Ga0068862_1001366403 | 226 |
| 199 | 3300005844 | Ga0068862_101080438 | Ga0068862_1010804381 | 226 |
| 200 | 3300005981 | Ga0081538_10052923 | Ga0081538_100529232 | 226 |
| 201 | 3300006042 | Ga0075368_10006466 | Ga0075368_100064666 | 226 |
| 202 | 3300006042 | Ga0075368_10014451 | Ga0075368_100144512 | 226 |
| 203 | 3300006051 | Ga0075364_10067628 | Ga0075364_100676283 | 226 |
| 204 | 3300006051 | Ga0075364_10070184 | Ga0075364_100701843 | 226 |
| 205 | 3300006058 | Ga0075432_10089504 | Ga0075432_100895042 | 226 |
| 206 | 3300006178 | Ga0075367_10040707 | Ga0075367_100407073 | 226 |
| 207 | 3300006178 | Ga0075367_10107125 | Ga0075367_101071252 | 226 |
| 208 | 3300006178 | Ga0075367_10352523 | Ga0075367_103525231 | 226 |
| 209 | 3300006195 | Ga0075366_10011572 | Ga0075366_100115723 | 226 |
| 210 | 3300006195 | Ga0075366_10219054 | Ga0075366_102190542 | 226 |
| 211 | 3300006353 | Ga0075370_10076538 | Ga0075370_100765382 | 226 |
| 212 | 3300006844 | Ga0075428_100007896 | Ga0075428_1000078962 | 226 |
| 213 | 3300006844 | Ga0075428_100035133 | Ga0075428_1000351336 | 226 |
| 214 | 3300006844 | Ga0075428_100056674 | Ga0075428_1000566744 | 226 |
| 215 | 3300006844 | Ga0075428_100082739 | Ga0075428_1000827392 | 226 |
| 216 | 3300006844 | Ga0075428_100204613 | Ga0075428_1002046133 | 226 |
| 217 | 3300006844 | Ga0075428_100659236 | Ga0075428_1006592362 | 226 |
| 218 | 3300006846 | Ga0075430_100042982 | Ga0075430_1000429823 | 226 |
| 219 | 3300006846 | Ga0075430_100044807 | Ga0075430_1000448072 | 226 |
| 220 | 3300006847 | Ga0075431_100006444 | Ga0075431_1000064446 | 226 |
| 221 | 3300006847 | Ga0075431_100060816 | Ga0075431_1000608165 | 226 |
| 222 | 3300006847 | Ga0075431_100097351 | Ga0075431_1000973512 | 226 |
| 223 | 3300006847 | Ga0075431_100415420 | Ga0075431_1004154202 | 226 |
| 224 | 3300006880 | Ga0075429_100057027 | Ga0075429_1000570273 | 226 |
| 225 | 3300006880 | Ga0075429_100057634 | Ga0075429_1000576342 | 226 |
| 226 | 3300006880 | Ga0075429_100789704 | Ga0075429_1007897041 | 226 |
| 227 | 3300006881 | Ga0068865_100186987 | Ga0068865_1001869872 | 226 |
| 228 | 3300006881 | Ga0068865_100347971 | Ga0068865_1003479712 | 226 |
| 229 | 3300006931 | Ga0097620_100522101 | Ga0097620_1005221012 | 226 |
| 230 | 3300007076 | Ga0075435_100075874 | Ga0075435_1000758742 | 226 |
| 231 | 3300007076 | Ga0075435_100123746 | Ga0075435_1001237462 | 226 |
| 232 | 3300009094 | Ga0111539_10012297 | Ga0111539_100122973 | 226 |
| 233 | 3300009094 | Ga0111539_10015082 | Ga0111539_100150829 | 226 |
| 234 | 3300009094 | Ga0111539_10028441 | Ga0111539_100284415 | 226 |
| 235 | 3300009094 | Ga0111539_10081307 | Ga0111539_100813074 | 226 |
| 236 | 3300009094 | Ga0111539_10106882 | Ga0111539_101068823 | 226 |
| 237 | 3300009094 | Ga0111539_10120490 | Ga0111539_101204902 | 226 |
| 238 | 3300009094 | Ga0111539_10141696 | Ga0111539_101416962 | 226 |
| 239 | 3300009094 | Ga0111539_10244636 | Ga0111539_102446362 | 226 |
| 240 | 3300009094 | Ga0111539_10299996 | Ga0111539_102999962 | 226 |
| 241 | 3300009098 | Ga0105245_10252552 | Ga0105245_102525522 | 226 |
| 242 | 3300009147 | Ga0114129_10011164 | Ga0114129_1001116412 | 226 |
| 243 | 3300009147 | Ga0114129_10017826 | Ga0114129_100178265 | 226 |
| 244 | 3300009147 | Ga0114129_10019384 | Ga0114129_100193845 | 226 |
| 245 | 3300009147 | Ga0114129_10027741 | Ga0114129_100277413 | 226 |
| 246 | 3300009147 | Ga0114129_10079577 | Ga0114129_100795776 | 226 |
| 247 | 3300009147 | Ga0114129_10109253 | Ga0114129_101092533 | 226 |
| 248 | 3300009147 | Ga0114129_10419546 | Ga0114129_104195462 | 226 |
| 249 | 3300009147 | Ga0114129_10604545 | Ga0114129_106045452 | 226 |
| 250 | 3300009148 | Ga0105243_10007218 | Ga0105243_100072182 | 226 |
| 251 | 3300009177 | Ga0105248_10075879 | Ga0105248_100758793 | 226 |
| 252 | 3300009551 | Ga0105238_10834720 | Ga0105238_108347201 | 226 |
| 253 | 3300009553 | Ga0105249_10014767 | Ga0105249_100147675 | 226 |
| 254 | 3300009553 | Ga0105249_10076416 | Ga0105249_100764163 | 226 |
| 255 | 3300009553 | Ga0105249_10181220 | Ga0105249_101812203 | 226 |
| 256 | 3300009553 | Ga0105249_10403160 | Ga0105249_104031602 | 226 |
| 257 | 3300009553 | Ga0105249_10818639 | Ga0105249_108186392 | 226 |
| 258 | 3300010375 | Ga0105239_10397736 | Ga0105239_103977362 | 226 |
| 259 | 3300011119 | Ga0105246_10016936 | Ga0105246_100169363 | 226 |
| 260 | 3300011119 | Ga0105246_10141803 | Ga0105246_101418033 | 226 |
| 261 | 3300013297 | Ga0157378_10004825 | Ga0157378_100048258 | 226 |
| 262 | 3300013308 | Ga0157375_10043926 | Ga0157375_100439264 | 226 |
| 263 | 3300014325 | Ga0163163_10430384 | Ga0163163_104303841 | 226 |
| 264 | 3300014326 | Ga0157380_10006984 | Ga0157380_1000698410 | 226 |
| 265 | 3300014326 | Ga0157380_10142197 | Ga0157380_101421973 | 226 |
| 266 | 3300014326 | Ga0157380_10346367 | Ga0157380_103463671 | 226 |
| 267 | 3300014326 | Ga0157380_10969838 | Ga0157380_109698381 | 226 |
| 268 | 3300014745 | Ga0157377_10204608 | Ga0157377_102046082 | 226 |
| 269 | 3300017792 | Ga0163161_10479118 | Ga0163161_104791182 | 226 |
| 270 | 3300025315 | Ga0207697_10254654 | Ga0207697_102546541 | 226 |
| 271 | 3300025893 | Ga0207682_10043316 | Ga0207682_100433161 | 226 |
| 272 | 3300025907 | Ga0207645_10006786 | Ga0207645_100067867 | 226 |
| 273 | 3300025908 | Ga0207643_10062750 | Ga0207643_100627502 | 226 |
| 274 | 3300025910 | Ga0207684_10287940 | Ga0207684_102879402 | 226 |
| 275 | 3300025912 | Ga0207707_10402752 | Ga0207707_104027522 | 226 |
| 276 | 3300025917 | Ga0207660_10114007 | Ga0207660_101140072 | 226 |
| 277 | 3300025922 | Ga0207646_10383444 | Ga0207646_103834442 | 226 |
| 278 | 3300025923 | Ga0207681_10071697 | Ga0207681_100716972 | 226 |
| 279 | 3300025923 | Ga0207681_10656661 | Ga0207681_106566612 | 226 |
| 280 | 3300025924 | Ga0207694_10453436 | Ga0207694_104534361 | 226 |
| 281 | 3300025925 | Ga0207650_10030255 | Ga0207650_100302552 | 226 |
| 282 | 3300025926 | Ga0207659_10015920 | Ga0207659_100159202 | 226 |
| 283 | 3300025926 | Ga0207659_10182193 | Ga0207659_101821933 | 226 |
| 284 | 3300025932 | Ga0207690_10041392 | Ga0207690_100413922 | 226 |
| 285 | 3300025933 | Ga0207706_10066478 | Ga0207706_100664783 | 226 |
| 286 | 3300025933 | Ga0207706_10181050 | Ga0207706_101810502 | 226 |
| 287 | 3300025933 | Ga0207706_10317062 | Ga0207706_103170622 | 226 |
| 288 | 3300025935 | Ga0207709_10055938 | Ga0207709_100559382 | 226 |
| 289 | 3300025937 | Ga0207669_10089292 | Ga0207669_100892923 | 226 |
| 290 | 3300025940 | Ga0207691_10072118 | Ga0207691_100721184 | 226 |
| 291 | 3300025941 | Ga0207711_10052838 | Ga0207711_100528383 | 226 |
| 292 | 3300025945 | Ga0207679_10303525 | Ga0207679_103035252 | 226 |
| 293 | 3300025960 | Ga0207651_10126500 | Ga0207651_101265003 | 226 |
| 294 | 3300025960 | Ga0207651_10144918 | Ga0207651_101449181 | 226 |
| 295 | 3300025960 | Ga0207651_10553202 | Ga0207651_105532021 | 226 |
| 296 | 3300025961 | Ga0207712_10027589 | Ga0207712_100275892 | 226 |
| 297 | 3300025961 | Ga0207712_10371749 | Ga0207712_103717492 | 226 |
| 298 | 3300025961 | Ga0207712_10596139 | Ga0207712_105961392 | 226 |
| 299 | 3300025972 | Ga0207668_10068322 | Ga0207668_100683223 | 226 |
| 300 | 3300025986 | Ga0207658_10239660 | Ga0207658_102396602 | 226 |
| 301 | 3300026023 | Ga0207677_10144493 | Ga0207677_101444932 | 226 |
| 302 | 3300026023 | Ga0207677_10281175 | Ga0207677_102811752 | 226 |
| 303 | 3300026067 | Ga0207678_10044661 | Ga0207678_100446612 | 226 |
| 304 | 3300026075 | Ga0207708_10133683 | Ga0207708_101336832 | 226 |
| 305 | 3300026088 | Ga0207641_10538138 | Ga0207641_105381382 | 226 |
| 306 | 3300026088 | Ga0207641_10832257 | Ga0207641_108322571 | 226 |
| 307 | 3300026089 | Ga0207648_10006036 | Ga0207648_100060366 | 226 |
| 308 | 3300026095 | Ga0207676_10061980 | Ga0207676_100619803 | 226 |
| 309 | 3300026095 | Ga0207676_10203977 | Ga0207676_102039772 | 226 |
| 310 | 3300026116 | Ga0207674_10408761 | Ga0207674_104087612 | 226 |
| 311 | 3300026118 | Ga0207675_100031461 | Ga0207675_1000314616 | 226 |
| 312 | 3300026118 | Ga0207675_100072492 | Ga0207675_1000724925 | 226 |
| 313 | 3300026118 | Ga0207675_100191832 | Ga0207675_1001918323 | 226 |
| 314 | 3300026118 | Ga0207675_100293359 | Ga0207675_1002933592 | 226 |
| 315 | 3300026118 | Ga0207675_100426721 | Ga0207675_1004267212 | 226 |
| 316 | 3300026121 | Ga0207683_10294516 | Ga0207683_102945162 | 226 |
| 317 | 3300027907 | Ga0207428_10008813 | Ga0207428_100088136 | 226 |
| 318 | 3300027907 | Ga0207428_10010324 | Ga0207428_100103243 | 226 |
| 319 | 3300027907 | Ga0207428_10016271 | Ga0207428_100162715 | 226 |
| 320 | 3300027907 | Ga0207428_10484143 | Ga0207428_104841432 | 226 |
| 321 | 3300028380 | Ga0268265_10068627 | Ga0268265_100686272 | 226 |
| 322 | 3300028380 | Ga0268265_10474492 | Ga0268265_104744922 | 226 |
| 323 | 3300028381 | Ga0268264_10754949 | Ga0268264_107549492 | 226 |
| 324 | 3300031901 | Ga0307406_10022262 | Ga0307406_100222624 | 226 |
| 325 | 3300031995 | Ga0307409_100884860 | Ga0307409_1008848602 | 226 |
| 326 | 3300032002 | Ga0307416_100724123 | Ga0307416_1007241232 | 226 |
| 327 | 3300032005 | Ga0307411_10077291 | Ga0307411_100772913 | 226 |
| 328 | 3300032126 | Ga0307415_100553953 | Ga0307415_1005539532 | 226 |
| 329 | 3300035725 | Ga0373947_0167359 | Ga0373947_0167359_668_1348 | 226 |
| 330 | 3300037068 | Ga0373925_0214522 | Ga0373925_0214522_741_1421 | 226 |
| 331 | 3300044712 | Ga0453684_0000640 | Ga0453684_0000640_85149_85835 | 226 |
| 332 | 3300045051 | Ga0451576_0207118 | Ga0451576_0207118_1277_1966 | 226 |
| 333 | 3300046455 | Ga0495603_0042804 | Ga0495603_0042804_1694_2374 | 226 |
| 334 | 3300046683 | Ga0495658_0104503 | Ga0495658_0104503_779_1459 | 226 |
| 335 | 3300048903 | Ga0496100_0052021 | Ga0496100_0052021_56_736 | 226 |
| 336 | 3300048904 | Ga0496101_0027364 | Ga0496101_0027364_941_1621 | 226 |
| 337 | 3300048907 | Ga0496104_0033099 | Ga0496104_0033099_1877_2557 | 226 |
| 338 | 3300048908 | Ga0496105_0027302 | Ga0496105_0027302_2690_3370 | 226 |
| 339 | 3300048909 | Ga0496106_0044866 | Ga0496106_0044866_369_1049 | 226 |
| 340 | 3300048910 | Ga0496107_0111757 | Ga0496107_0111757_1298_1978 | 226 |
| 341 | 3300048911 | Ga0496108_0000512 | Ga0496108_0000512_8867_9547 | 226 |
| 342 | 3300048912 | Ga0496109_0068453 | Ga0496109_0068453_1039_1719 | 226 |
| 343 | 3300048913 | Ga0496110_0021439 | Ga0496110_0021439_1598_2278 | 226 |
| 344 | 3300048914 | Ga0496111_0055113 | Ga0496111_0055113_1596_2276 | 226 |
| 345 | 3300048915 | Ga0496112_0003921 | Ga0496112_0003921_502_1182 | 226 |
| 346 | 3300048916 | Ga0496113_0144851 | Ga0496113_0144851_521_1201 | 226 |
| 347 | 3300048917 | Ga0496114_0127233 | Ga0496114_0127233_919_1599 | 226 |
| 348 | 3300048918 | Ga0496115_0526855 | Ga0496115_0526855_37_717 | 226 |
| 349 | 3300049584 | Ga0501068_0041640 | Ga0501068_0041640_176_856 | 226 |
| 350 | 3300050491 | nmdc:mga00v17_302925_c1 | nmdc:mga00v17_302925_c1_223_903 | 226 |
| 351 | 3300050493 | nmdc:mga0k408_9782_c1 | nmdc:mga0k408_9782_c1_3042_3722 | 226 |
| 352 | 3300050494 | nmdc:mga06z11_10606_c1 | nmdc:mga06z11_10606_c1_3047_3727 | 226 |
| 353 | 3300050495 | nmdc:mga04h51_13456_c1 | nmdc:mga04h51_13456_c1_551_1234 | 226 |
| 354 | 3300050496 | nmdc:mga07m45_18659_c1 | nmdc:mga07m45_18659_c1_399_1079 | 226 |
| 355 | 3300050507 | nmdc:mga05p37_13913_c1 | nmdc:mga05p37_13913_c1_1001_1681 | 226 |
| 356 | 3300050507 | nmdc:mga05p37_20502_c2 | nmdc:mga05p37_20502_c2_4158_4838 | 226 |
| 357 | 3300050507 | nmdc:mga05p37_81042_c1 | nmdc:mga05p37_81042_c1_836_1603 | 226 |
| 358 | 3300050508 | nmdc:mga09592_143381_c1 | nmdc:mga09592_143381_c1_651_1331 | 226 |
| 359 | 3300050508 | nmdc:mga09592_20053_c1 | nmdc:mga09592_20053_c1_1011_1691 | 226 |
| 360 | 3300050508 | nmdc:mga09592_26467_c1 | nmdc:mga09592_26467_c1_1567_2247 | 226 |
| 361 | 3300050509 | nmdc:mga0qj67_48815_c1 | nmdc:mga0qj67_48815_c1_1484_2164 | 226 |
| 362 | 3300050510 | nmdc:mga06r32_127057_c1 | nmdc:mga06r32_127057_c1_248_928 | 226 |
| 363 | 3300050510 | nmdc:mga06r32_236644_c1 | nmdc:mga06r32_236644_c1_459_1139 | 226 |
| 364 | 3300050510 | nmdc:mga06r32_25516_c1 | nmdc:mga06r32_25516_c1_3181_3861 | 226 |
| 365 | 3300050510 | nmdc:mga06r32_4645_c1 | nmdc:mga06r32_4645_c1_6913_7593 | 226 |
| 366 | 3300050510 | nmdc:mga06r32_53285_c1 | nmdc:mga06r32_53285_c1_2485_3165 | 226 |
| 367 | 3300050511 | nmdc:mga08y16_15145_c1 | nmdc:mga08y16_15145_c1_5456_6136 | 226 |
| 368 | 3300050511 | nmdc:mga08y16_46327_c1 | nmdc:mga08y16_46327_c1_616_1296 | 226 |
| 369 | 3300050511 | nmdc:mga08y16_69609_c1 | nmdc:mga08y16_69609_c1_1804_2484 | 226 |
| 370 | 3300050511 | nmdc:mga08y16_697596_c1 | nmdc:mga08y16_697596_c1_45_725 | 226 |
| 371 | 3300050511 | nmdc:mga08y16_79616_c1 | nmdc:mga08y16_79616_c1_1331_2011 | 226 |
| 372 | 3300050512 | nmdc:mga0n895_707129_c1 | nmdc:mga0n895_707129_c1_211_891 | 226 |
| 373 | 3300050513 | nmdc:mga0rr50_103976_c1 | nmdc:mga0rr50_103976_c1_1005_1694 | 226 |
| 374 | 3300050513 | nmdc:mga0rr50_867708_c1 | nmdc:mga0rr50_867708_c1_22_702 | 226 |
| 375 | 3300050515 | nmdc:mga0a205_422249_c1 | nmdc:mga0a205_422249_c1_131_811 | 226 |
| 376 | 3300050515 | nmdc:mga0a205_441956_c1 | nmdc:mga0a205_441956_c1_120_848 | 226 |
| 377 | 3300053090 | Ga0500646_0180938 | Ga0500646_0180938_13_693 | 226 |
| 378 | 3300005330 | Ga0070690_100056763 | Ga0070690_1000567631 | 227 |
| 379 | 3300005335 | Ga0070666_10093575 | Ga0070666_100935751 | 227 |
| 380 | 3300005337 | Ga0070682_100009570 | Ga0070682_1000095703 | 227 |
| 381 | 3300005337 | Ga0070682_100013077 | Ga0070682_1000130775 | 227 |
| 382 | 3300005355 | Ga0070671_100048786 | Ga0070671_1000487862 | 227 |
| 383 | 3300005536 | Ga0070697_100160116 | Ga0070697_1001601162 | 227 |
| 384 | 3300005544 | Ga0070686_100000831 | Ga0070686_1000008319 | 227 |
| 385 | 3300005545 | Ga0070695_100111143 | Ga0070695_1001111432 | 227 |
| 386 | 3300005549 | Ga0070704_100094666 | Ga0070704_1000946663 | 227 |
| 387 | 3300005563 | Ga0068855_100498210 | Ga0068855_1004982102 | 227 |
| 388 | 3300005578 | Ga0068854_100067466 | Ga0068854_1000674661 | 227 |
| 389 | 3300005616 | Ga0068852_101028385 | Ga0068852_1010283851 | 227 |
| 390 | 3300005843 | Ga0068860_101102976 | Ga0068860_1011029762 | 227 |
| 391 | 3300006195 | Ga0075366_10016080 | Ga0075366_100160802 | 227 |
| 392 | 3300006844 | Ga0075428_100430165 | Ga0075428_1004301652 | 227 |
| 393 | 3300006871 | Ga0075434_100087137 | Ga0075434_1000871373 | 227 |
| 394 | 3300007076 | Ga0075435_100048938 | Ga0075435_1000489383 | 227 |
| 395 | 3300009093 | Ga0105240_10143538 | Ga0105240_101435382 | 227 |
| 396 | 3300009174 | Ga0105241_10665990 | Ga0105241_106659901 | 227 |
| 397 | 3300014969 | Ga0157376_10330210 | Ga0157376_103302102 | 227 |
| 398 | 3300025913 | Ga0207695_10375767 | Ga0207695_103757672 | 227 |
| 399 | 3300025931 | Ga0207644_10167889 | Ga0207644_101678892 | 227 |
| 400 | 3300025949 | Ga0207667_10424804 | Ga0207667_104248042 | 227 |
| 401 | 3300025981 | Ga0207640_10038589 | Ga0207640_100385892 | 227 |
| 402 | 3300025981 | Ga0207640_10046360 | Ga0207640_100463602 | 227 |
| 403 | 3300031238 | Ga0265332_10075004 | Ga0265332_100750041 | 227 |
| 404 | 3300031249 | Ga0265339_10000105 | Ga0265339_1000010546 | 227 |
| 405 | 3300031344 | Ga0265316_10001844 | Ga0265316_100018443 | 227 |
| 406 | 3300031711 | Ga0265314_10000002 | Ga0265314_10000002735 | 227 |
| 407 | 3300034816 | Ga0373930_0022427 | Ga0373930_0022427_549_1232 | 227 |
| 408 | 3300034818 | Ga0373950_0001574 | Ga0373950_0001574_217_957 | 227 |
| 409 | 3300034957 | Ga0373938_0001334 | Ga0373938_0001334_578_1318 | 227 |
| 410 | 3300035084 | Ga0373928_0000747 | Ga0373928_0000747_158_898 | 227 |
| 411 | 3300035085 | Ga0373929_0002475 | Ga0373929_0002475_609_1349 | 227 |
| 412 | 3300035088 | Ga0373940_0031184 | Ga0373940_0031184_154_894 | 227 |
| 413 | 3300035090 | Ga0373949_0002243 | Ga0373949_0002243_265_948 | 227 |
| 414 | 3300035092 | Ga0373952_0001940 | Ga0373952_0001940_521_1204 | 227 |
| 415 | 3300035114 | Ga0373939_0001590 | Ga0373939_0001590_2219_2959 | 227 |
| 416 | 3300035115 | Ga0373941_0001410 | Ga0373941_0001410_660_1343 | 227 |
| 417 | 3300035121 | Ga0373960_0000217 | Ga0373960_0000217_5604_6344 | 227 |
| 418 | 3300035207 | Ga0373942_0001105 | Ga0373942_0001105_4302_5042 | 227 |
| 419 | 3300035241 | Ga0373961_0068218 | Ga0373961_0068218_341_1081 | 227 |
| 420 | 3300036647 | Ga0316582_0343150 | Ga0316582_0343150_151_906 | 227 |
| 421 | 3300045051 | Ga0451576_0035389 | Ga0451576_0035389_1934_2617 | 227 |
| 422 | 3300048905 | Ga0496102_0629768 | Ga0496102_0629768_216_899 | 227 |
| 423 | 3300048909 | Ga0496106_0516665 | Ga0496106_0516665_139_822 | 227 |
| 424 | 3300049592 | Ga0501076_0379613 | Ga0501076_0379613_213_902 | 227 |
| 425 | 3300050508 | nmdc:mga09592_199963_c1 | nmdc:mga09592_199963_c1_642_1409 | 227 |
| 426 | 3300050511 | nmdc:mga08y16_637952_c1 | nmdc:mga08y16_637952_c1_118_828 | 227 |
| 427 | 3300050512 | nmdc:mga0n895_1127571_c1 | nmdc:mga0n895_1127571_c1_63_749 | 227 |
| 428 | 3300050512 | nmdc:mga0n895_88098_c1 | nmdc:mga0n895_88098_c1_1465_2148 | 227 |
| 429 | 3300050513 | nmdc:mga0rr50_35288_c1 | nmdc:mga0rr50_35288_c1_2403_3086 | 227 |
| 430 | 3300050513 | nmdc:mga0rr50_555960_c1 | nmdc:mga0rr50_555960_c1_215_961 | 227 |
| 431 | 3300061734 | Ga0530510_0119701 | Ga0530510_0119701_1161_1844 | 227 |
| 432 | iso_pu_bacteria | 2971410472 | 2971417591 | 227 |
| 433 | 3300005337 | Ga0070682_100027740 | Ga0070682_1000277403 | 228 |
| 434 | 3300005366 | Ga0070659_100186866 | Ga0070659_1001868662 | 228 |
| 435 | 3300005547 | Ga0070693_100005083 | Ga0070693_1000050834 | 228 |
| 436 | 3300005549 | Ga0070704_100129364 | Ga0070704_1001293641 | 228 |
| 437 | 3300006844 | Ga0075428_100041905 | Ga0075428_1000419053 | 228 |
| 438 | 3300006846 | Ga0075430_100102363 | Ga0075430_1001023632 | 228 |
| 439 | 3300006871 | Ga0075434_100354855 | Ga0075434_1003548552 | 228 |
| 440 | 3300036647 | Ga0316582_0204448 | Ga0316582_0204448_401_1087 | 228 |
| 441 | 3300048905 | Ga0496102_0219323 | Ga0496102_0219323_401_1087 | 228 |
| 442 | 3300048924 | Ga0496121_0152485 | Ga0496121_0152485_628_1383 | 228 |
| 443 | 3300050509 | nmdc:mga0qj67_56449_c1 | nmdc:mga0qj67_56449_c1_1171_1863 | 228 |
| 444 | 3300050514 | nmdc:mga08x19_407531_c1 | nmdc:mga08x19_407531_c1_80_766 | 228 |
| 445 | 3300005444 | Ga0070694_100002461 | Ga0070694_10000246110 | 229 |
| 446 | 3300005535 | Ga0070684_100014631 | Ga0070684_1000146312 | 229 |
| 447 | 3300005546 | Ga0070696_100189753 | Ga0070696_1001897532 | 229 |
| 448 | 3300009147 | Ga0114129_10002646 | Ga0114129_1000264620 | 229 |
| 449 | 3300009147 | Ga0114129_10337183 | Ga0114129_103371832 | 229 |
| 450 | 3300050507 | nmdc:mga05p37_250897_c1 | nmdc:mga05p37_250897_c1_352_1041 | 229 |
| 451 | 3300050507 | nmdc:mga05p37_6919_c1 | nmdc:mga05p37_6919_c1_187_918 | 229 |
| 452 | 3300014968 | Ga0157379_10228800 | Ga0157379_102288002 | 230 |
| 453 | 3300026023 | Ga0207677_10368607 | Ga0207677_103686072 | 230 |
| 454 | 3300036647 | Ga0316582_0057966 | Ga0316582_0057966_16_738 | 230 |
| 455 | 3300049775 | Ga0501279_014934 | Ga0501279_014934_111_923 | 230 |
| 456 | 3300053153 | Ga0500616_0218147 | Ga0500616_0218147_88_810 | 230 |
| 457 | 3300003841 | Ga0055541_1000921 | Ga0055541_10009216 | 231 |
| 458 | 3300025225 | Ga0209566_100300 | Ga0209566_10030034 | 231 |
| 459 | 3300048919 | Ga0496116_0138005 | Ga0496116_0138005_584_1339 | 231 |
| 460 | iso_pu_bacteria | 2857453340 | 2857459432 | 231 |
| 461 | iso_pu_bacteria | 8056533031 | 8056536312 | 231 |
| 462 | iso_pu_bacteria | 2600255256 | 2601532467 | 232 |
| 463 | iso_pu_bacteria | 2600255257 | 2601537837 | 232 |
| 464 | iso_pu_bacteria | 2600255310 | 2601756507 | 232 |
| 465 | iso_pu_bacteria | 2600255311 | 2601763012 | 232 |
| 466 | iso_pu_bacteria | 2602042046 | 2603638085 | 232 |
| 467 | iso_pu_bacteria | 2814123068 | 2814696633 | 232 |
| 468 | 3300003856 | Ga0058692_1000128 | Ga0058692_100012820 | 234 |
| 469 | 3300027312 | Ga0209371_1000002 | Ga0209371_1000002273 | 234 |
| 470 | 3300027312 | Ga0209371_1000109 | Ga0209371_100010955 | 234 |
| 471 | 3300030500 | Ga0268256_1000002 | Ga0268256_10000021191 | 234 |
| 472 | 3300031727 | Ga0316576_10016511 | Ga0316576_100165112 | 235 |
| 473 | 3300031733 | Ga0316577_10007339 | Ga0316577_100073395 | 235 |
| 474 | 3300031733 | Ga0316577_10076038 | Ga0316577_100760382 | 235 |
| 475 | 3300038726 | Ga0400490_37142 | Ga0400490_37142_540_1253 | 235 |
| 476 | 3300038735 | Ga0400485_11367 | Ga0400485_11367_17797_18510 | 235 |
| 477 | 3300038742 | Ga0400486_17557 | Ga0400486_17557_111_824 | 235 |
| 478 | 3300038742 | Ga0400486_19491 | Ga0400486_19491_6700_7413 | 235 |
| 479 | 3300039062 | Ga0400483_183368 | Ga0400483_183368_1218_1931 | 235 |
| 480 | 3300039093 | Ga0400489_48110 | Ga0400489_48110_3172_3885 | 235 |
| 481 | 3300039110 | Ga0400487_07019 | Ga0400487_07019_3243_3956 | 235 |
| 482 | 3300046459 | Ga0495629_0036298 | Ga0495629_0036298_752_1555 | 236 |
| 483 | 3300046526 | Ga0495666_0000647 | Ga0495666_0000647_7816_8619 | 236 |
| 484 | 3300046531 | Ga0495665_0000343 | Ga0495665_0000343_16100_16903 | 236 |
| 485 | 3300046674 | Ga0495588_0090142 | Ga0495588_0090142_448_1251 | 236 |
| 486 | 3300047315 | Ga0495581_0064431 | Ga0495581_0064431_843_1646 | 236 |
| 487 | 3300047319 | Ga0495674_0012568 | Ga0495674_0012568_6824_7627 | 236 |
| 488 | 3300047321 | Ga0495676_0013598 | Ga0495676_0013598_1928_2731 | 236 |
| 489 | 3300002459 | JGI24751J29686_10016562 | JGI24751J29686_100165623 | 237 |
| 490 | 3300031665 | Ga0316575_10126225 | Ga0316575_101262252 | 237 |
| 491 | 3300035398 | Ga0316574_0014975 | Ga0316574_0014975_573_1310 | 237 |
| 492 | 3300053098 | Ga0500650_0000050 | Ga0500650_0000050_6659_7372 | 237 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8fk2-assembly1.cif.gz_B | the n-terminal vicr from streptococcus mutans | 0.9769 | 4 | 123 |
| 1nxt-assembly1.cif.gz_A-2 | micarec ph 4.0 | 0.9699 | 4 | 121 |
| 2a9r-assembly1.cif.gz_A-2 | rr02-rec phosphate in the active site | 0.9689 | 4 | 121 |
| 3nnn-assembly1.cif.gz_B | bef3 activated drrd receiver domain | 0.9683 | 3 | 120 |
| 6is2-assembly1.cif.gz_A | crystal structure of staphylococcus aureus response regulator arlr receiver domain in complex with mg | 0.9674 | 2 | 121 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9KJN4_1_80_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.991 | 4 | 82 | 3.40.50.2300 |
| af_P76340_1_79_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9757 | 5 | 82 | 3.40.50.2300 |
| af_Q2FY79_1_81_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9734 | 3 | 82 | 3.40.50.2300 |
| af_P69228_9_89_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9697 | 2 | 82 | 3.40.50.2300 |
| 5hm6B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9653 | 3 | 120 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0D8SQB7-F1-model_v4 | deleted | 0.9813 | 1 | 131 |
|
| AF-A0A1H1MHS3-F1-model_v4 | Response regulator receiver domain-containing protein | 0.9751 | 3 | 119 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A2V8RBR2-F1-model_v4 | DNA-binding response regulator | 0.9708 | 1 | 124 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A7X6ZL16-F1-model_v4 | Response regulator | 0.9692 | 3 | 120 |
GO:0000160
|
| AF-A0A353VD63-F1-model_v4 | Sigma-54-dependent Fis family transcriptional regulator | 0.9692 | 3 | 128 |
GO:0000160
GO:0005524 GO:0006355 GO:0016887 GO:0043565 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar