F454233

General Info

Members Datasets Scaffolds Average Seq Length
492 221 968 265

Family's Representative Sequence

Representative Sequence 3300005545|Ga0070695_100167952|Ga0070695_1001679522
Length 312
Sequence VTSKGAKFITYKLDESALTNLPLEADRNSPLNASIVLHEVVYDLHMWRPLGSARWMRFALMSAAAQDFRILTNGRNLQIPINHGLPDKPFGFTFCRLRYQNIRRARKSGWGDDYPQADYNFMVRLNELTKTPISRWNDGYPGFANVTAMDPDLFHCPYLRMQNAANYDFTTDETARLHDYLLKGGFLWIDDNWDPDFEYIRPNLTRILPGARIVDLPLEHPMFSVLYHVNPLPQIPALNSWLRNGQNSEIGPSTVHFYGVFDDHDRLVVLVSMNSDISDSWEREGDNHEYFETYSWQGYALGVNVAVWVMAH

Samples

Sample ID Description Type Environment
1 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
89 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
90 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
152 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
153 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
154 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
155 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
156 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
157 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
158 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
161 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
162 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
163 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
164 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
165 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
166 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
167 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
168 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
169 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
170 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
171 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
172 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
173 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
175 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
176 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
177 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
178 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
179 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
180 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
181 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
182 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
183 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
184 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
185 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
186 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
187 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
188 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
189 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
190 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
191 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
192 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
193 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
194 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
195 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
196 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
197 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
198 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
199 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
200 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
201 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
202 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
203 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
204 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
205 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
206 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
207 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
208 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
209 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
210 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
211 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
212 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
213 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
214 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
215 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
216 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
217 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
218 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
219 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
220 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
221 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.64
Rhizosphere 97.36
Stem 0
Stem Tuber 0
Unclassified 27.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070695_100167952 3300005545 Unclassified 1546
2 JGI25406J46586_10000319 3300003203 Bacteria 21692
3 Ga0065714_10093586 3300005288 Bacteria 1842
4 Ga0065704_10079999 3300005289 Bacteria 4032
5 Ga0065712_10000031 3300005290 Bacteria 1899
6 Ga0065712_10004266 3300005290 Unclassified 3602
7 Ga0065712_10077925 3300005290 Bacteria 3423
8 Ga0065712_10179633 3300005290 Unclassified 1199
9 Ga0065715_10124485 3300005293 Bacteria 2147
10 Ga0065715_10126918 3300005293 Unclassified 2098
11 Ga0065715_10217688 3300005293 Unclassified 1286
12 Ga0065707_10031925 3300005295 Unclassified 1430
13 Ga0070658_10282924 3300005327 Bacteria 1412
14 Ga0070683_100087660 3300005329 Bacteria 2920
15 Ga0070690_100005145 3300005330 Bacteria 7325
16 Ga0070690_100009537 3300005330 Bacteria 5626
17 Ga0070690_100108850 3300005330 Bacteria 1846
18 Ga0070670_100163197 3300005331 Bacteria 1931
19 Ga0070677_10016441 3300005333 Bacteria 2634
20 Ga0068869_100023888 3300005334 Bacteria 4230
21 Ga0068869_100127105 3300005334 Unclassified 1956
22 Ga0070666_10025066 3300005335 Unclassified 3887
23 Ga0070666_10037726 3300005335 Bacteria 3214
24 Ga0070666_10168571 3300005335 Bacteria 1533
25 Ga0070666_10179744 3300005335 Bacteria 1483
26 Ga0070682_100190427 3300005337 Bacteria 1440
27 Ga0068868_100229928 3300005338 Bacteria 1555
28 Ga0070660_100214247 3300005339 Unclassified 1564
29 Ga0070689_100013520 3300005340 Bacteria 5910
30 Ga0070689_100253935 3300005340 Unclassified 1451
31 Ga0070689_100462055 3300005340 Bacteria 1082
32 Ga0070687_100009840 3300005343 Bacteria 4106
33 Ga0070687_100105227 3300005343 Unclassified 1587
34 Ga0070687_100240830 3300005343 Bacteria 1118
35 Ga0070661_100464926 3300005344 Unclassified 1008
36 Ga0070668_100027297 3300005347 Bacteria 4334
37 Ga0070668_100033118 3300005347 Bacteria 3933
38 Ga0070669_100000337 3300005353 Bacteria 36590
39 Ga0070669_100019847 3300005353 Bacteria 4802
40 Ga0070669_100020622 3300005353 Bacteria 4707
41 Ga0070669_100066688 3300005353 Unclassified 2653
42 Ga0070669_100167048 3300005353 Bacteria 1713
43 Ga0070669_100378816 3300005353 Unclassified 1154
44 Ga0070675_100000533 3300005354 Bacteria 26031
45 Ga0070675_100008903 3300005354 Bacteria 7801
46 Ga0070675_100022228 3300005354 Bacteria 5066
47 Ga0070675_100079913 3300005354 Unclassified 2725
48 Ga0070671_100095750 3300005355 Bacteria 2488
49 Ga0070671_100121633 3300005355 Bacteria 2197
50 Ga0070671_100158971 3300005355 Unclassified 1910
51 Ga0070671_100172063 3300005355 Unclassified 1832
52 Ga0070671_100272815 3300005355 Unclassified 1438
53 Ga0070673_100008841 3300005364 Bacteria 6726
54 Ga0070673_100012067 3300005364 Bacteria 5919
55 Ga0070673_100036688 3300005364 Bacteria 3729
56 Ga0070673_100037416 3300005364 Unclassified 3697
57 Ga0070673_100112774 3300005364 Bacteria 2257
58 Ga0070673_100235802 3300005364 Bacteria 1589
59 Ga0070673_100263069 3300005364 Unclassified 1507
60 Ga0070673_100532307 3300005364 Bacteria 1066
61 Ga0070673_100647885 3300005364 Bacteria 967
62 Ga0070688_100027239 3300005365 Bacteria 3403
63 Ga0070688_100045290 3300005365 Bacteria 2717
64 Ga0070667_100022138 3300005367 Bacteria 5272
65 Ga0070667_100273267 3300005367 Bacteria 1516
66 Ga0070667_100339683 3300005367 Unclassified 1358
67 Ga0070667_100524967 3300005367 Bacteria 1087
68 Ga0070703_10087780 3300005406 Unclassified 1072
69 Ga0070701_10137489 3300005438 Bacteria 1394
70 Ga0070711_100177054 3300005439 Unclassified 1630
71 Ga0070705_100004885 3300005440 Bacteria 6528
72 Ga0070700_100016084 3300005441 Bacteria 4255
73 Ga0070663_100008330 3300005455 Bacteria 6372
74 Ga0070678_100167406 3300005456 Bacteria 1786
75 Ga0070678_100388839 3300005456 Unclassified 1209
76 Ga0070678_100524319 3300005456 Bacteria 1049
77 Ga0070678_100555170 3300005456 Unclassified 1020
78 Ga0070681_10017103 3300005458 Bacteria 7249
79 Ga0070681_10051047 3300005458 Unclassified 4126
80 Ga0068867_100198335 3300005459 Bacteria 1605
81 Ga0070685_10007417 3300005466 Bacteria 5612
82 Ga0070685_10028437 3300005466 Bacteria 3097
83 Ga0070706_100281780 3300005467 Bacteria 1551
84 Ga0070707_100090258 3300005468 Bacteria 2966
85 Ga0070707_100257143 3300005468 Bacteria 1699
86 Ga0070698_100126141 3300005471 Bacteria 2516
87 Ga0070698_100206056 3300005471 Bacteria 1902
88 Ga0070698_100207241 3300005471 Bacteria 1896
89 Ga0070698_100262464 3300005471 Bacteria 1659
90 Ga0070699_100252266 3300005518 Unclassified 1576
91 Ga0070684_100055070 3300005535 Bacteria 3466
92 Ga0070697_100210680 3300005536 Bacteria 1654
93 Ga0070672_100079522 3300005543 Bacteria 2625
94 Ga0070672_100112347 3300005543 Bacteria 2222
95 Ga0070672_100466717 3300005543 Bacteria 1089
96 Ga0070672_100493480 3300005543 Unclassified 1058
97 Ga0070686_100004238 3300005544 Bacteria 7897
98 Ga0070686_100004558 3300005544 Bacteria 7644
99 Ga0070686_100137757 3300005544 Unclassified 1695
100 Ga0070686_100348602 3300005544 Unclassified 1112
101 Ga0070695_100000224 3300005545 Bacteria 27792
102 Ga0070696_100007428 3300005546 Bacteria 7328
103 Ga0070665_100031990 3300005548 Bacteria 5295
104 Ga0070665_100095755 3300005548 Bacteria 2974
105 Ga0070665_100120847 3300005548 Bacteria 2621
106 Ga0070665_100228317 3300005548 Bacteria 1861
107 Ga0070665_100325708 3300005548 Bacteria 1540
108 Ga0070704_100004661 3300005549 Bacteria 7932
109 Ga0070704_100022075 3300005549 Bacteria 4137
110 Ga0070664_100021448 3300005564 Bacteria 5323
111 Ga0070664_100067765 3300005564 Bacteria 3050
112 Ga0070664_100149565 3300005564 Bacteria 2061
113 Ga0070664_100207413 3300005564 Bacteria 1750
114 Ga0068857_100394774 3300005577 Unclassified 1286
115 Ga0068854_100005207 3300005578 Bacteria 8203
116 Ga0068856_100016586 3300005614 Bacteria 7130
117 Ga0070702_100119209 3300005615 Bacteria 1649
118 Ga0068859_100006597 3300005617 Bacteria 11780
119 Ga0068859_100016206 3300005617 Bacteria 7486
120 Ga0068859_100022433 3300005617 Bacteria 6329
121 Ga0068859_100057603 3300005617 Bacteria 3914
122 Ga0068859_100069355 3300005617 Unclassified 3560
123 Ga0068859_100190216 3300005617 Unclassified 2137
124 Ga0068859_100282853 3300005617 Bacteria 1751
125 Ga0068864_100078320 3300005618 Bacteria 2893
126 Ga0068861_100004570 3300005719 Bacteria 9291
127 Ga0068861_100301137 3300005719 Bacteria 1389
128 Ga0068870_10000089 3300005840 Bacteria 29678
129 Ga0068870_10088384 3300005840 Bacteria 1727
130 Ga0068870_10113195 3300005840 Unclassified 1552
131 Ga0068863_100002963 3300005841 Bacteria 16784
132 Ga0068863_100003116 3300005841 Bacteria 16367
133 Ga0068858_100006945 3300005842 Bacteria 11002
134 Ga0068858_100015144 3300005842 Bacteria 7253
135 Ga0068858_100048953 3300005842 Bacteria 3915
136 Ga0068858_100118898 3300005842 Bacteria 2470
137 Ga0068858_100466653 3300005842 Unclassified 1217
138 Ga0068860_100043176 3300005843 Bacteria 4302
139 Ga0068860_100259775 3300005843 Bacteria 1692
140 Ga0068862_100004769 3300005844 Bacteria 11413
141 Ga0068862_100021276 3300005844 Bacteria 5420
142 Ga0068862_100101360 3300005844 Unclassified 2519
143 Ga0068862_100128263 3300005844 Unclassified 2241
144 Ga0068862_100194097 3300005844 Bacteria 1828
145 Ga0081539_10000228 3300005985 Bacteria 131823
146 Ga0075432_10033220 3300006058 Bacteria 1789
147 Ga0097621_100051421 3300006237 Bacteria 3354
148 Ga0097621_100073058 3300006237 Bacteria 2838
149 Ga0097621_100080977 3300006237 Bacteria 2702
150 Ga0097621_100084413 3300006237 Bacteria 2647
151 Ga0097621_100151391 3300006237 Bacteria 1990
152 Ga0097621_100434289 3300006237 Unclassified 1180
153 Ga0097621_100468860 3300006237 Bacteria 1137
154 Ga0068871_100030023 3300006358 Bacteria 4276
155 Ga0068871_100064556 3300006358 Bacteria 2998
156 Ga0068871_100150822 3300006358 Bacteria 1982
157 Ga0068871_100295398 3300006358 Unclassified 1421
158 Ga0075428_100002526 3300006844 Bacteria 19894
159 Ga0075428_100047543 3300006844 Unclassified 4712
160 Ga0075428_100049098 3300006844 Bacteria 4630
161 Ga0075428_100235099 3300006844 Bacteria 1977
162 Ga0075428_100446936 3300006844 Bacteria 1385
163 Ga0075428_100456398 3300006844 Unclassified 1369
164 Ga0075430_100001882 3300006846 Bacteria 17187
165 Ga0075430_100023022 3300006846 Bacteria 5299
166 Ga0075430_100139310 3300006846 Bacteria 2020
167 Ga0075430_100230542 3300006846 Unclassified 1536
168 Ga0075431_100003406 3300006847 Bacteria 15421
169 Ga0075431_100005585 3300006847 Bacteria 12415
170 Ga0075433_10061727 3300006852 Unclassified 3283
171 Ga0075433_10116049 3300006852 Unclassified 2375
172 Ga0075433_10305122 3300006852 Unclassified 1409
173 Ga0075434_100001189 3300006871 Bacteria 21589
174 Ga0075434_100001828 3300006871 Bacteria 18371
175 Ga0075434_100036331 3300006871 Unclassified 4874
176 Ga0075434_100068532 3300006871 Bacteria 3534
177 Ga0075434_100152682 3300006871 Viruses 2329
178 Ga0075434_100205533 3300006871 Bacteria 1989
179 Ga0075429_100080414 3300006880 Bacteria 2841
180 Ga0075429_100081634 3300006880 Unclassified 2819
181 Ga0068865_100002762 3300006881 Bacteria 10437
182 Ga0068865_100005794 3300006881 Bacteria 7510
183 Ga0068865_100196479 3300006881 Unclassified 1563
184 Ga0097620_100006597 3300006931 Bacteria 11780
185 Ga0097620_100016206 3300006931 Bacteria 7486
186 Ga0097620_100022434 3300006931 Bacteria 6329
187 Ga0097620_100057604 3300006931 Bacteria 3914
188 Ga0097620_100069356 3300006931 Unclassified 3560
189 Ga0097620_100190218 3300006931 Unclassified 2137
190 Ga0097620_100282854 3300006931 Bacteria 1751
191 Ga0075435_100000054 3300007076 Bacteria 58537
192 Ga0075435_100008011 3300007076 Bacteria 7561
193 Ga0075435_100011939 3300007076 Bacteria 6416
194 Ga0075435_100046676 3300007076 Bacteria 3476
195 Ga0099794_10109784 3300007265 Bacteria 1381
196 Ga0099794_10147681 3300007265 Bacteria 1193
197 Ga0105240_10024914 3300009093 Bacteria 7875
198 Ga0105240_10284982 3300009093 Unclassified 1896
199 Ga0111539_10003017 3300009094 Bacteria 22310
200 Ga0111539_10005433 3300009094 Bacteria 16485
201 Ga0111539_10019031 3300009094 Bacteria 8487
202 Ga0111539_10019272 3300009094 Bacteria 8426
203 Ga0111539_10082875 3300009094 Bacteria 3772
204 Ga0111539_10085933 3300009094 Bacteria 3697
205 Ga0111539_10094896 3300009094 Bacteria 3505
206 Ga0111539_10140917 3300009094 Unclassified 2822
207 Ga0111539_10248255 3300009094 Bacteria 2072
208 Ga0111539_10477233 3300009094 Unclassified 1452
209 Ga0105245_10017059 3300009098 Bacteria 6339
210 Ga0105245_10167606 3300009098 Bacteria 2089
211 Ga0105245_10505841 3300009098 Bacteria 1225
212 Ga0105247_10001662 3300009101 Bacteria 15702
213 Ga0105247_10048872 3300009101 Unclassified 2599
214 Ga0114129_10063678 3300009147 Bacteria 5148
215 Ga0114129_10126464 3300009147 Unclassified 3514
216 Ga0114129_10549946 3300009147 Bacteria 1501
217 Ga0105243_10047969 3300009148 Bacteria 3365
218 Ga0105243_10577359 3300009148 Unclassified 1079
219 Ga0105241_10219563 3300009174 Bacteria 1597
220 Ga0105241_10331268 3300009174 Bacteria 1316
221 Ga0105242_10002670 3300009176 Bacteria 13984
222 Ga0105242_10049594 3300009176 Bacteria 3417
223 Ga0105242_10067909 3300009176 Bacteria 2948
224 Ga0105242_10085856 3300009176 Unclassified 2640
225 Ga0105242_10086485 3300009176 Bacteria 2631
226 Ga0105242_10352937 3300009176 Unclassified 1359
227 Ga0105248_10002868 3300009177 Bacteria 19138
228 Ga0105248_10082086 3300009177 Unclassified 3624
229 Ga0105248_10250787 3300009177 Bacteria 1992
230 Ga0105248_10301465 3300009177 Viruses 1804
231 Ga0105248_10350054 3300009177 Bacteria 1663
232 Ga0105248_10384716 3300009177 Archaea 1580
233 Ga0105237_10165319 3300009545 Bacteria 2211
234 Ga0105238_10021435 3300009551 Bacteria 6581
235 Ga0105246_10409307 3300011119 Unclassified 1128
236 Ga0157346_1003378 3300012480 Unclassified 888
237 Ga0157325_1002378 3300012485 Bacteria 955
238 Ga0157329_1002266 3300012491 Bacteria 1078
239 Ga0157371_10144866 3300013102 Archaea 1692
240 Ga0157374_10084912 3300013296 Unclassified 3010
241 Ga0157374_10345280 3300013296 Unclassified 1478
242 Ga0163162_10081168 3300013306 Unclassified 3313
243 Ga0163162_10138087 3300013306 Bacteria 2549
244 Ga0157372_10697559 3300013307 Bacteria 1181
245 Ga0157375_10213512 3300013308 Bacteria 2087
246 Ga0157375_10706586 3300013308 Unclassified 1161
247 Ga0163163_10004094 3300014325 Bacteria 12440
248 Ga0163163_10020823 3300014325 Bacteria 6182
249 Ga0163163_10163918 3300014325 Unclassified 2269
250 Ga0163163_10226193 3300014325 Bacteria 1920
251 Ga0163163_10723868 3300014325 Bacteria 1058
252 Ga0157380_10014767 3300014326 Bacteria 5719
253 Ga0157380_10048532 3300014326 Bacteria 3344
254 Ga0157380_10252713 3300014326 Bacteria 1596
255 Ga0157377_10017491 3300014745 Bacteria 3707
256 Ga0157377_10463016 3300014745 Bacteria 878
257 Ga0157379_10016827 3300014968 Bacteria 6436
258 Ga0157376_10094902 3300014969 Bacteria 2593
259 Ga0157376_10193344 3300014969 Unclassified 1867
260 Ga0157376_10371548 3300014969 Bacteria 1375
261 Ga0207697_10005736 3300025315 Bacteria 5722
262 Ga0207656_10005176 3300025321 Bacteria 4587
263 Ga0207682_10025235 3300025893 Bacteria 2357
264 Ga0207682_10114652 3300025893 Bacteria 1189
265 Ga0207642_10065936 3300025899 Bacteria 1703
266 Ga0207642_10118935 3300025899 Unclassified 1359
267 Ga0207710_10016739 3300025900 Bacteria 3104
268 Ga0207710_10051204 3300025900 Unclassified 1854
269 Ga0207688_10005997 3300025901 Bacteria 6613
270 Ga0207680_10172548 3300025903 Bacteria 1457
271 Ga0207680_10193204 3300025903 Bacteria 1383
272 Ga0207645_10007159 3300025907 Bacteria 7911
273 Ga0207645_10029657 3300025907 Bacteria 3526
274 Ga0207643_10003614 3300025908 Bacteria 8336
275 Ga0207643_10015883 3300025908 Bacteria 4101
276 Ga0207684_10167648 3300025910 Bacteria 1893
277 Ga0207695_10035928 3300025913 Bacteria 5363
278 Ga0207662_10063393 3300025918 Unclassified 2223
279 Ga0207662_10137070 3300025918 Unclassified 1547
280 Ga0207657_10106957 3300025919 Bacteria 2314
281 Ga0207649_10036560 3300025920 Bacteria 2959
282 Ga0207681_10000687 3300025923 Bacteria 22247
283 Ga0207681_10101732 3300025923 Bacteria 2073
284 Ga0207694_10003473 3300025924 Bacteria 12527
285 Ga0207659_10000515 3300025926 Bacteria 23227
286 Ga0207659_10002027 3300025926 Bacteria 12010
287 Ga0207659_10010773 3300025926 Bacteria 5753
288 Ga0207659_10015720 3300025926 Bacteria 4913
289 Ga0207659_10037929 3300025926 Bacteria 3349
290 Ga0207659_10094762 3300025926 Unclassified 2237
291 Ga0207659_10215416 3300025926 Bacteria 1541
292 Ga0207644_10078372 3300025931 Bacteria 2435
293 Ga0207644_10144715 3300025931 Bacteria 1834
294 Ga0207644_10338070 3300025931 Viruses 1220
295 Ga0207690_10200546 3300025932 Bacteria 1515
296 Ga0207706_10033430 3300025933 Bacteria 4578
297 Ga0207706_10137334 3300025933 Bacteria 2151
298 Ga0207686_10043693 3300025934 Bacteria 2747
299 Ga0207686_10058310 3300025934 Unclassified 2434
300 Ga0207686_10250197 3300025934 Bacteria 1294
301 Ga0207709_10248550 3300025935 Bacteria 1298
302 Ga0207670_10003571 3300025936 Bacteria 8259
303 Ga0207670_10082577 3300025936 Unclassified 2252
304 Ga0207670_10290245 3300025936 Unclassified 1278
305 Ga0207669_10192298 3300025937 Bacteria 1473
306 Ga0207704_10016376 3300025938 Bacteria 3808
307 Ga0207704_10116613 3300025938 Bacteria 1817
308 Ga0207691_10033311 3300025940 Bacteria 4797
309 Ga0207691_10151033 3300025940 Bacteria 2042
310 Ga0207691_10457814 3300025940 Bacteria 1085
311 Ga0207711_10049884 3300025941 Bacteria 3583
312 Ga0207711_10076642 3300025941 Bacteria 2912
313 Ga0207711_10138128 3300025941 Bacteria 2191
314 Ga0207711_10357368 3300025941 Bacteria 1353
315 Ga0207689_10000821 3300025942 Bacteria 29911
316 Ga0207689_10020493 3300025942 Bacteria 5563
317 Ga0207689_10109489 3300025942 Archaea 2270
318 Ga0207661_10539610 3300025944 Bacteria 1068
319 Ga0207679_10036930 3300025945 Bacteria 3469
320 Ga0207679_10195508 3300025945 Bacteria 1685
321 Ga0207679_10293028 3300025945 Bacteria 1399
322 Ga0207651_10002343 3300025960 Bacteria 9034
323 Ga0207651_10035482 3300025960 Bacteria 3243
324 Ga0207651_10064619 3300025960 Unclassified 2562
325 Ga0207651_10117116 3300025960 Bacteria 2012
326 Ga0207651_10134088 3300025960 Bacteria 1901
327 Ga0207651_10176587 3300025960 Bacteria 1690
328 Ga0207668_10009682 3300025972 Bacteria 5787
329 Ga0207668_10061360 3300025972 Bacteria 2644
330 Ga0207640_10018092 3300025981 Bacteria 4134
331 Ga0207658_10283010 3300025986 Unclassified 1422
332 Ga0207658_10318770 3300025986 Bacteria 1345
333 Ga0207677_10187839 3300026023 Unclassified 1632
334 Ga0207703_10007997 3300026035 Bacteria 8356
335 Ga0207703_10142108 3300026035 Bacteria 2084
336 Ga0207703_10241670 3300026035 Bacteria 1623
337 Ga0207703_10484476 3300026035 Bacteria 1159
338 Ga0207678_10013365 3300026067 Bacteria 7205
339 Ga0207708_10093374 3300026075 Bacteria 2322
340 Ga0207641_10003710 3300026088 Bacteria 13451
341 Ga0207641_10023096 3300026088 Bacteria 5124
342 Ga0207648_10000884 3300026089 Bacteria 33769
343 Ga0207648_10003699 3300026089 Bacteria 16015
344 Ga0207676_10006254 3300026095 Bacteria 8405
345 Ga0207676_10028949 3300026095 Bacteria 4143
346 Ga0207676_10035045 3300026095 Bacteria 3805
347 Ga0207676_10061202 3300026095 Bacteria 2980
348 Ga0207675_100049149 3300026118 Bacteria 3937
349 Ga0207675_100348091 3300026118 Bacteria 1452
350 Ga0207683_10414311 3300026121 Bacteria 1240
351 Ga0207683_10574815 3300026121 Unclassified 1042
352 Ga0209969_1022391 3300027360 Unclassified 945
353 Ga0209999_1012049 3300027543 Bacteria 1565
354 Ga0209966_1006221 3300027695 Bacteria 2069
355 Ga0207428_10000089 3300027907 Bacteria 127333
356 Ga0207428_10001244 3300027907 Bacteria 27303
357 Ga0207428_10003967 3300027907 Bacteria 14197
358 Ga0207428_10037747 3300027907 Unclassified 3929
359 Ga0207428_10215772 3300027907 Unclassified 1440
360 Ga0207428_10364879 3300027907 Bacteria 1061
361 Ga0268266_10169388 3300028379 Bacteria 1981
362 Ga0268266_10170620 3300028379 Bacteria 1974
363 Ga0268265_10000504 3300028380 Bacteria 40349
364 Ga0268265_10038515 3300028380 Bacteria 3517
365 Ga0268265_10189625 3300028380 Bacteria 1774
366 Ga0268264_10100939 3300028381 Bacteria 2507
367 Ga0268264_10134565 3300028381 Unclassified 2196
368 Ga0268264_10306359 3300028381 Bacteria 1497
369 Ga0268264_10391877 3300028381 Unclassified 1333
370 Ga0307408_100141266 3300031548 Unclassified 1890
371 Ga0307405_10029207 3300031731 Bacteria 3221
372 Ga0307405_10078364 3300031731 Unclassified 2150
373 Ga0307413_10046654 3300031824 Unclassified 2578
374 Ga0307410_10005329 3300031852 Bacteria 6793
375 Ga0307406_10070115 3300031901 Unclassified 2294
376 Ga0307407_10026665 3300031903 Unclassified 3063
377 Ga0307412_10135602 3300031911 Unclassified 1795
378 Ga0307409_100107041 3300031995 Unclassified 2335
379 Ga0307416_100043130 3300032002 Unclassified 3529
380 Ga0307416_100246332 3300032002 Unclassified 1736
381 Ga0307414_10129039 3300032004 Unclassified 1959
382 Ga0307415_100052616 3300032126 Unclassified 2770
383 Ga0373930_0002448 3300034816 Unclassified 2871
384 Ga0373951_0000532 3300035091 Bacteria 10739
385 Ga0373932_0002362 3300035112 Bacteria 4791
386 Ga0373939_0018044 3300035114 Bacteria 1883
387 Ga0373941_0001358 3300035115 Bacteria 5154
388 Ga0373957_0057140 3300035120 Bacteria 1504
389 Ga0373960_0012717 3300035121 Bacteria 2096
390 Ga0373942_0003956 3300035207 Unclassified 3458
391 Ga0373961_0023455 3300035241 Bacteria 1660
392 Ga0373962_0017529 3300035242 Unclassified 1856
393 Ga0373931_0029884 3300035691 Unclassified 2801
394 Ga0373937_0102595 3300036401 Bacteria 2656
395 Ga0373937_0273780 3300036401 Unclassified 1594
396 Ga0395898_0683333 3300037466 Unclassified 969
397 Ga0439435_0036874 3300042436 Bacteria 1353
398 Ga0439440_0006613 3300042993 Bacteria 2339
399 Ga0453684_0357183 3300044712 Bacteria 1646
400 Ga0451576_0084410 3300045051 Bacteria 3303
401 Ga0451576_0157614 3300045051 Bacteria 2368
402 Ga0495603_0134793 3300046455 Unclassified 1437
403 Ga0495664_0172098 3300046477 Bacteria 1313
404 Ga0495584_0062398 3300046491 Bacteria 1873
405 Ga0495585_0112282 3300046492 Unclassified 1448
406 Ga0495618_0164557 3300046514 Unclassified 1413
407 Ga0495630_0189826 3300046517 Unclassified 1568
408 Ga0495631_0174743 3300046518 Bacteria 921
409 Ga0495644_0080040 3300046523 Unclassified 1231
410 Ga0495642_0033468 3300046528 Unclassified 2066
411 Ga0495586_0176857 3300046535 Bacteria 1207
412 Ga0495598_0029706 3300046537 Bacteria 1526
413 Ga0495645_0142889 3300046543 Bacteria 1668
414 Ga0495634_0339298 3300046642 Bacteria 902
415 Ga0495635_0078630 3300046663 Bacteria 2258
416 Ga0495659_0013532 3300046664 Bacteria 2658
417 Ga0495659_0017227 3300046664 Unclassified 2391
418 Ga0495669_0043228 3300046684 Unclassified 2005
419 Ga0495669_0046558 3300046684 Unclassified 1936
420 Ga0495624_0158794 3300046690 Unclassified 1382
421 Ga0495674_0520194 3300047319 Unclassified 950
422 Ga0495683_0170804 3300047323 Bacteria 1000
423 Ga0495677_0053823 3300047445 Unclassified 1484
424 Ga0496101_0140272 3300048904 Bacteria 1842
425 Ga0496101_0382681 3300048904 Unclassified 1107
426 Ga0496104_0068542 3300048907 Bacteria 3371
427 Ga0496106_0325087 3300048909 Bacteria 1235
428 Ga0496108_0012552 3300048911 Bacteria 6901
429 Ga0496109_0122626 3300048912 Bacteria 2421
430 Ga0496112_0060688 3300048915 Unclassified 3727
431 Ga0496112_0135205 3300048915 Bacteria 2436
432 Ga0496112_0316791 3300048915 Unclassified 1504
433 Ga0496113_0090718 3300048916 Bacteria 2354
434 Ga0496114_0148914 3300048917 Unclassified 2030
435 Ga0496114_0249992 3300048917 Bacteria 1560
436 Ga0496115_0188479 3300048918 Bacteria 1704
437 Ga0501071_0489701 3300049587 Bacteria 943
438 nmdc:mga05p37_242035_c1 3300050507 Unclassified 2169
439 nmdc:mga05p37_372765_c1 3300050507 Bacteria 1348
440 nmdc:mga05p37_472757_c1 3300050507 Bacteria 1446
441 nmdc:mga05p37_485036_c1 3300050507 Bacteria 1423
442 nmdc:mga05p37_7702_c1 3300050507 Bacteria 12708
443 nmdc:mga09592_135197_c1 3300050508 Unclassified 2123
444 nmdc:mga09592_149018_c1 3300050508 Unclassified 2018
445 nmdc:mga09592_369983_c1 3300050508 Bacteria 1240
446 nmdc:mga09592_5330_c1 3300050508 Bacteria 10455
447 nmdc:mga09592_71775_c1 3300050508 Unclassified 2939
448 nmdc:mga0qj67_191120_c1 3300050509 Unclassified 1664
449 nmdc:mga0qj67_27933_c1 3300050509 Bacteria 4376
450 nmdc:mga06r32_37478_c1 3300050510 Bacteria 4586
451 nmdc:mga06r32_5763_c1 3300050510 Bacteria 11162
452 nmdc:mga08y16_132322_c1 3300050511 Bacteria 2593
453 nmdc:mga08y16_231913_c1 3300050511 Bacteria 1909
454 nmdc:mga08y16_24484_c1 3300050511 Bacteria 6371
455 nmdc:mga08y16_309899_c1 3300050511 Unclassified 1626
456 nmdc:mga08y16_406500_c1 3300050511 Unclassified 1393
457 nmdc:mga08y16_44894_c1 3300050511 Unclassified 4631
458 nmdc:mga08y16_61571_c1 3300050511 Bacteria 3919
459 nmdc:mga08y16_69554_c1 3300050511 Bacteria 3670
460 nmdc:mga0n895_136036_c1 3300050512 Bacteria 2484
461 nmdc:mga0n895_16299_c1 3300050512 Bacteria 6815
462 nmdc:mga0n895_172334_c1 3300050512 Unclassified 2196
463 nmdc:mga0n895_35696_c1 3300050512 Bacteria 4795
464 nmdc:mga0n895_39934_c1 3300050512 Unclassified 4557
465 nmdc:mga0n895_421994_c1 3300050512 Bacteria 1348
466 nmdc:mga0n895_461_c1 3300050512 Bacteria 27200
467 nmdc:mga0n895_89565_c1 3300050512 Unclassified 3078
468 nmdc:mga0rr50_169119_c1 3300050513 Unclassified 1780
469 nmdc:mga0rr50_259_c1 3300050513 Bacteria 28683
470 nmdc:mga0rr50_537629_c1 3300050513 Bacteria 995
471 nmdc:mga0rr50_53937_c1 3300050513 Bacteria 2993
472 nmdc:mga0rr50_5_c1 3300050513 Bacteria 327169
473 nmdc:mga08x19_552_c1 3300050514 Bacteria 24509
474 nmdc:mga0a205_107533_c1 3300050515 Unclassified 2688
475 nmdc:mga0a205_109367_c1 3300050515 Bacteria 2662
476 nmdc:mga0a205_14136_c1 3300050515 Bacteria 7449
477 nmdc:mga0a205_37788_c1 3300050515 Bacteria 4643
478 nmdc:mga0a205_4644_c1 3300050515 Bacteria 8383
479 nmdc:mga0a205_9353_c1 3300050515 Bacteria 8955
480 Ga0495601_0080578 3300053077 Bacteria 2089
481 Ga0495655_0092689 3300053083 Unclassified 883
482 Ga0495595_0147441 3300053084 Unclassified 1157
483 Ga0495619_0053356 3300053085 Bacteria 2674
484 Ga0495619_0288767 3300053085 Unclassified 1136
485 Ga0070695_100167952
486 JGI25406J46586_10000319
487 Ga0065714_10093586
488 Ga0065704_10079999
489 Ga0065712_10000031
490 Ga0065712_10004266
491 Ga0065712_10077925
492 Ga0065712_10179633
493 Ga0065715_10124485
494 Ga0065715_10126918
495 Ga0065715_10217688
496 Ga0065707_10031925
497 Ga0070658_10282924
498 Ga0070683_100087660
499 Ga0070690_100005145
500 Ga0070690_100009537
501 Ga0070690_100108850
502 Ga0070670_100163197
503 Ga0070677_10016441
504 Ga0068869_100023888
505 Ga0068869_100127105
506 Ga0070666_10025066
507 Ga0070666_10037726
508 Ga0070666_10168571
509 Ga0070666_10179744
510 Ga0070682_100190427
511 Ga0068868_100229928
512 Ga0070660_100214247
513 Ga0070689_100013520
514 Ga0070689_100253935
515 Ga0070689_100462055
516 Ga0070687_100009840
517 Ga0070687_100105227
518 Ga0070687_100240830
519 Ga0070661_100464926
520 Ga0070668_100027297
521 Ga0070668_100033118
522 Ga0070669_100000337
523 Ga0070669_100019847
524 Ga0070669_100020622
525 Ga0070669_100066688
526 Ga0070669_100167048
527 Ga0070669_100378816
528 Ga0070675_100000533
529 Ga0070675_100008903
530 Ga0070675_100022228
531 Ga0070675_100079913
532 Ga0070671_100095750
533 Ga0070671_100121633
534 Ga0070671_100158971
535 Ga0070671_100172063
536 Ga0070671_100272815
537 Ga0070673_100008841
538 Ga0070673_100012067
539 Ga0070673_100036688
540 Ga0070673_100037416
541 Ga0070673_100112774
542 Ga0070673_100235802
543 Ga0070673_100263069
544 Ga0070673_100532307
545 Ga0070673_100647885
546 Ga0070688_100027239
547 Ga0070688_100045290
548 Ga0070667_100022138
549 Ga0070667_100273267
550 Ga0070667_100339683
551 Ga0070667_100524967
552 Ga0070703_10087780
553 Ga0070701_10137489
554 Ga0070711_100177054
555 Ga0070705_100004885
556 Ga0070700_100016084
557 Ga0070663_100008330
558 Ga0070678_100167406
559 Ga0070678_100388839
560 Ga0070678_100524319
561 Ga0070678_100555170
562 Ga0070681_10017103
563 Ga0070681_10051047
564 Ga0068867_100198335
565 Ga0070685_10007417
566 Ga0070685_10028437
567 Ga0070706_100281780
568 Ga0070707_100090258
569 Ga0070707_100257143
570 Ga0070698_100126141
571 Ga0070698_100206056
572 Ga0070698_100207241
573 Ga0070698_100262464
574 Ga0070699_100252266
575 Ga0070684_100055070
576 Ga0070697_100210680
577 Ga0070672_100079522
578 Ga0070672_100112347
579 Ga0070672_100466717
580 Ga0070672_100493480
581 Ga0070686_100004238
582 Ga0070686_100004558
583 Ga0070686_100137757
584 Ga0070686_100348602
585 Ga0070695_100000224
586 Ga0070696_100007428
587 Ga0070665_100031990
588 Ga0070665_100095755
589 Ga0070665_100120847
590 Ga0070665_100228317
591 Ga0070665_100325708
592 Ga0070704_100004661
593 Ga0070704_100022075
594 Ga0070664_100021448
595 Ga0070664_100067765
596 Ga0070664_100149565
597 Ga0070664_100207413
598 Ga0068857_100394774
599 Ga0068854_100005207
600 Ga0068856_100016586
601 Ga0070702_100119209
602 Ga0068859_100006597
603 Ga0068859_100016206
604 Ga0068859_100022433
605 Ga0068859_100057603
606 Ga0068859_100069355
607 Ga0068859_100190216
608 Ga0068859_100282853
609 Ga0068864_100078320
610 Ga0068861_100004570
611 Ga0068861_100301137
612 Ga0068870_10000089
613 Ga0068870_10088384
614 Ga0068870_10113195
615 Ga0068863_100002963
616 Ga0068863_100003116
617 Ga0068858_100006945
618 Ga0068858_100015144
619 Ga0068858_100048953
620 Ga0068858_100118898
621 Ga0068858_100466653
622 Ga0068860_100043176
623 Ga0068860_100259775
624 Ga0068862_100004769
625 Ga0068862_100021276
626 Ga0068862_100101360
627 Ga0068862_100128263
628 Ga0068862_100194097
629 Ga0081539_10000228
630 Ga0075432_10033220
631 Ga0097621_100051421
632 Ga0097621_100073058
633 Ga0097621_100080977
634 Ga0097621_100084413
635 Ga0097621_100151391
636 Ga0097621_100434289
637 Ga0097621_100468860
638 Ga0068871_100030023
639 Ga0068871_100064556
640 Ga0068871_100150822
641 Ga0068871_100295398
642 Ga0075428_100002526
643 Ga0075428_100047543
644 Ga0075428_100049098
645 Ga0075428_100235099
646 Ga0075428_100446936
647 Ga0075428_100456398
648 Ga0075430_100001882
649 Ga0075430_100023022
650 Ga0075430_100139310
651 Ga0075430_100230542
652 Ga0075431_100003406
653 Ga0075431_100005585
654 Ga0075433_10061727
655 Ga0075433_10116049
656 Ga0075433_10305122
657 Ga0075434_100001189
658 Ga0075434_100001828
659 Ga0075434_100036331
660 Ga0075434_100068532
661 Ga0075434_100152682
662 Ga0075434_100205533
663 Ga0075429_100080414
664 Ga0075429_100081634
665 Ga0068865_100002762
666 Ga0068865_100005794
667 Ga0068865_100196479
668 Ga0097620_100006597
669 Ga0097620_100016206
670 Ga0097620_100022434
671 Ga0097620_100057604
672 Ga0097620_100069356
673 Ga0097620_100190218
674 Ga0097620_100282854
675 Ga0075435_100000054
676 Ga0075435_100008011
677 Ga0075435_100011939
678 Ga0075435_100046676
679 Ga0099794_10109784
680 Ga0099794_10147681
681 Ga0105240_10024914
682 Ga0105240_10284982
683 Ga0111539_10003017
684 Ga0111539_10005433
685 Ga0111539_10019031
686 Ga0111539_10019272
687 Ga0111539_10082875
688 Ga0111539_10085933
689 Ga0111539_10094896
690 Ga0111539_10140917
691 Ga0111539_10248255
692 Ga0111539_10477233
693 Ga0105245_10017059
694 Ga0105245_10167606
695 Ga0105245_10505841
696 Ga0105247_10001662
697 Ga0105247_10048872
698 Ga0114129_10063678
699 Ga0114129_10126464
700 Ga0114129_10549946
701 Ga0105243_10047969
702 Ga0105243_10577359
703 Ga0105241_10219563
704 Ga0105241_10331268
705 Ga0105242_10002670
706 Ga0105242_10049594
707 Ga0105242_10067909
708 Ga0105242_10085856
709 Ga0105242_10086485
710 Ga0105242_10352937
711 Ga0105248_10002868
712 Ga0105248_10082086
713 Ga0105248_10250787
714 Ga0105248_10301465
715 Ga0105248_10350054
716 Ga0105248_10384716
717 Ga0105237_10165319
718 Ga0105238_10021435
719 Ga0105246_10409307
720 Ga0157346_1003378
721 Ga0157325_1002378
722 Ga0157329_1002266
723 Ga0157371_10144866
724 Ga0157374_10084912
725 Ga0157374_10345280
726 Ga0163162_10081168
727 Ga0163162_10138087
728 Ga0157372_10697559
729 Ga0157375_10213512
730 Ga0157375_10706586
731 Ga0163163_10004094
732 Ga0163163_10020823
733 Ga0163163_10163918
734 Ga0163163_10226193
735 Ga0163163_10723868
736 Ga0157380_10014767
737 Ga0157380_10048532
738 Ga0157380_10252713
739 Ga0157377_10017491
740 Ga0157377_10463016
741 Ga0157379_10016827
742 Ga0157376_10094902
743 Ga0157376_10193344
744 Ga0157376_10371548
745 Ga0207697_10005736
746 Ga0207656_10005176
747 Ga0207682_10025235
748 Ga0207682_10114652
749 Ga0207642_10065936
750 Ga0207642_10118935
751 Ga0207710_10016739
752 Ga0207710_10051204
753 Ga0207688_10005997
754 Ga0207680_10172548
755 Ga0207680_10193204
756 Ga0207645_10007159
757 Ga0207645_10029657
758 Ga0207643_10003614
759 Ga0207643_10015883
760 Ga0207684_10167648
761 Ga0207695_10035928
762 Ga0207662_10063393
763 Ga0207662_10137070
764 Ga0207657_10106957
765 Ga0207649_10036560
766 Ga0207681_10000687
767 Ga0207681_10101732
768 Ga0207694_10003473
769 Ga0207659_10000515
770 Ga0207659_10002027
771 Ga0207659_10010773
772 Ga0207659_10015720
773 Ga0207659_10037929
774 Ga0207659_10094762
775 Ga0207659_10215416
776 Ga0207644_10078372
777 Ga0207644_10144715
778 Ga0207644_10338070
779 Ga0207690_10200546
780 Ga0207706_10033430
781 Ga0207706_10137334
782 Ga0207686_10043693
783 Ga0207686_10058310
784 Ga0207686_10250197
785 Ga0207709_10248550
786 Ga0207670_10003571
787 Ga0207670_10082577
788 Ga0207670_10290245
789 Ga0207669_10192298
790 Ga0207704_10016376
791 Ga0207704_10116613
792 Ga0207691_10033311
793 Ga0207691_10151033
794 Ga0207691_10457814
795 Ga0207711_10049884
796 Ga0207711_10076642
797 Ga0207711_10138128
798 Ga0207711_10357368
799 Ga0207689_10000821
800 Ga0207689_10020493
801 Ga0207689_10109489
802 Ga0207661_10539610
803 Ga0207679_10036930
804 Ga0207679_10195508
805 Ga0207679_10293028
806 Ga0207651_10002343
807 Ga0207651_10035482
808 Ga0207651_10064619
809 Ga0207651_10117116
810 Ga0207651_10134088
811 Ga0207651_10176587
812 Ga0207668_10009682
813 Ga0207668_10061360
814 Ga0207640_10018092
815 Ga0207658_10283010
816 Ga0207658_10318770
817 Ga0207677_10187839
818 Ga0207703_10007997
819 Ga0207703_10142108
820 Ga0207703_10241670
821 Ga0207703_10484476
822 Ga0207678_10013365
823 Ga0207708_10093374
824 Ga0207641_10003710
825 Ga0207641_10023096
826 Ga0207648_10000884
827 Ga0207648_10003699
828 Ga0207676_10006254
829 Ga0207676_10028949
830 Ga0207676_10035045
831 Ga0207676_10061202
832 Ga0207675_100049149
833 Ga0207675_100348091
834 Ga0207683_10414311
835 Ga0207683_10574815
836 Ga0209969_1022391
837 Ga0209999_1012049
838 Ga0209966_1006221
839 Ga0207428_10000089
840 Ga0207428_10001244
841 Ga0207428_10003967
842 Ga0207428_10037747
843 Ga0207428_10215772
844 Ga0207428_10364879
845 Ga0268266_10169388
846 Ga0268266_10170620
847 Ga0268265_10000504
848 Ga0268265_10038515
849 Ga0268265_10189625
850 Ga0268264_10100939
851 Ga0268264_10134565
852 Ga0268264_10306359
853 Ga0268264_10391877
854 Ga0307408_100141266
855 Ga0307405_10029207
856 Ga0307405_10078364
857 Ga0307413_10046654
858 Ga0307410_10005329
859 Ga0307406_10070115
860 Ga0307407_10026665
861 Ga0307412_10135602
862 Ga0307409_100107041
863 Ga0307416_100043130
864 Ga0307416_100246332
865 Ga0307414_10129039
866 Ga0307415_100052616
867 Ga0373930_0002448
868 Ga0373951_0000532
869 Ga0373932_0002362
870 Ga0373939_0018044
871 Ga0373941_0001358
872 Ga0373957_0057140
873 Ga0373960_0012717
874 Ga0373942_0003956
875 Ga0373961_0023455
876 Ga0373962_0017529
877 Ga0373931_0029884
878 Ga0373937_0102595
879 Ga0373937_0273780
880 Ga0395898_0683333
881 Ga0439435_0036874
882 Ga0439440_0006613
883 Ga0453684_0357183
884 Ga0451576_0084410
885 Ga0451576_0157614
886 Ga0495603_0134793
887 Ga0495664_0172098
888 Ga0495584_0062398
889 Ga0495585_0112282
890 Ga0495618_0164557
891 Ga0495630_0189826
892 Ga0495631_0174743
893 Ga0495644_0080040
894 Ga0495642_0033468
895 Ga0495586_0176857
896 Ga0495598_0029706
897 Ga0495645_0142889
898 Ga0495634_0339298
899 Ga0495635_0078630
900 Ga0495659_0013532
901 Ga0495659_0017227
902 Ga0495669_0043228
903 Ga0495669_0046558
904 Ga0495624_0158794
905 Ga0495674_0520194
906 Ga0495683_0170804
907 Ga0495677_0053823
908 Ga0496101_0140272
909 Ga0496101_0382681
910 Ga0496104_0068542
911 Ga0496106_0325087
912 Ga0496108_0012552
913 Ga0496109_0122626
914 Ga0496112_0060688
915 Ga0496112_0135205
916 Ga0496112_0316791
917 Ga0496113_0090718
918 Ga0496114_0148914
919 Ga0496114_0249992
920 Ga0496115_0188479
921 Ga0501071_0489701
922 nmdc:mga05p37_242035_c1
923 nmdc:mga05p37_372765_c1
924 nmdc:mga05p37_472757_c1
925 nmdc:mga05p37_485036_c1
926 nmdc:mga05p37_7702_c1
927 nmdc:mga09592_135197_c1
928 nmdc:mga09592_149018_c1
929 nmdc:mga09592_369983_c1
930 nmdc:mga09592_5330_c1
931 nmdc:mga09592_71775_c1
932 nmdc:mga0qj67_191120_c1
933 nmdc:mga0qj67_27933_c1
934 nmdc:mga06r32_37478_c1
935 nmdc:mga06r32_5763_c1
936 nmdc:mga08y16_132322_c1
937 nmdc:mga08y16_231913_c1
938 nmdc:mga08y16_24484_c1
939 nmdc:mga08y16_309899_c1
940 nmdc:mga08y16_406500_c1
941 nmdc:mga08y16_44894_c1
942 nmdc:mga08y16_61571_c1
943 nmdc:mga08y16_69554_c1
944 nmdc:mga0n895_136036_c1
945 nmdc:mga0n895_16299_c1
946 nmdc:mga0n895_172334_c1
947 nmdc:mga0n895_35696_c1
948 nmdc:mga0n895_39934_c1
949 nmdc:mga0n895_421994_c1
950 nmdc:mga0n895_461_c1
951 nmdc:mga0n895_89565_c1
952 nmdc:mga0rr50_169119_c1
953 nmdc:mga0rr50_259_c1
954 nmdc:mga0rr50_537629_c1
955 nmdc:mga0rr50_53937_c1
956 nmdc:mga0rr50_5_c1
957 nmdc:mga08x19_552_c1
958 nmdc:mga0a205_107533_c1
959 nmdc:mga0a205_109367_c1
960 nmdc:mga0a205_14136_c1
961 nmdc:mga0a205_37788_c1
962 nmdc:mga0a205_4644_c1
963 nmdc:mga0a205_9353_c1
964 Ga0495601_0080578
965 Ga0495655_0092689
966 Ga0495595_0147441
967 Ga0495619_0053356
968 Ga0495619_0288767

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13709

DUF4159

Domain of unknown function (DUF4159)

93

310

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3nuv-assembly1.cif.gz_A crystal structure of ketosteroid isomerase d38nd99n from pseudomonas testosteroni (tksi) with 4-androstene-3,17-dione bound 0.768 195 213
3m8c-assembly1.cif.gz_A crystal structure of ketosteroid isomerase d99n from pseudomonas testosteroni (tksi) with equilenin bound 0.7643 195 213
8cho-assembly1.cif.gz_A-2 crystal structure of delta5-3-ketosteroid isomerase from pseudomonas testosteroni 0.7621 195 213
3unl-assembly2.cif.gz_D crystal structure of ketosteroid isomerase f54g from pseudomonas testosteroni 0.7578 195 213
3mki-assembly2.cif.gz_C crystal structure of ketosteroid isomerase d38ed99n from pseudomonas testosteroni (tksi) 0.7489 195 213
ID Description Score Start End Superfamily
af_Q6TMK2_24_122_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8077 195 213 3.10.450.50
af_A0A2R8RL16_66_203_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7884 195 213 2.60.40.10
4rzmB02 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7562 195 213 3.10.450.50
af_Q4CTR6_67_183_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7417 191 213 3.10.450.50
af_Q2R940_342_494_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7307 195 213 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A7Z9TBB1-F1-model_v4 DUF4159 domain-containing protein 0.8389 89 252
AF-A0A2V8BE56-F1-model_v4 Transmembrane prediction 0.8373 109 252
AF-A0A2V6PC23-F1-model_v4 DUF4159 domain-containing protein 0.8194 101 252
AF-A0A2V8EP25-F1-model_v4 DUF4159 domain-containing protein 0.8096 114 252
AF-A0A554JJS8-F1-model_v4 DUF4159 domain-containing protein 0.8088 93 252

Map