F454211

General Info

Members Datasets Scaffolds Average Seq Length
492 336 247 811

Family's Representative Sequence

Representative Sequence 3300003790|Ga0055528_1010450|Ga0055528_10104503
Length 918
Sequence MVALXAFRITXPSFADLVPYAGLVDNGVLLLKDGSLMAGWYFAGPDSXSATDLERNELSRXINAVLSRLGSGWMIQVEAIRVPTVDYPCEDRCHFPDAVTRAIDAERRAHFVREQGHFESKHAVILTHRPLEAKKSALSRYIYSDEESRKRSYADTVLAIFKNAVREVEQYLANTLSIRRMETRETSDRGGTTVARYDELLQFIRFCITGDXYPVRLPDVPMYLDWLVTAQLEHGLTPKVENRFLGVVAIDGLPAESWPGILNSLDLMPLTYRWSSRFIVLDAEEARQKLERTRKKWQQKVRPFFDQLFQTQSRSIDQDAMAMVAETEDAIAQASSRLVAYGYYTPVVILFDGNSEALQEKAEAIRRLVQAEGFGARIETLNATDAYLGSLPGNWYCNIREPLINTSNLADLIPLNSVWSGNPTAPCPFYAQNSPPLMQVASGSTPFRLNLHVDDVGHTLIFGPTGSGKSTLLALIAAQFRRYEGAQVFAFDKGRSLLPLTLACGGDHYEIGDSEMQKPALAFCPLSDLGTNGDRAWAIEWVEMLVALQGVTVTPDLRNAISRQIGLMATAPGRSLSDFVSGVQVREIKDALHPYTVDGPMGQLLDAEEDGLAIGGFQCFEIEPLMNRGERNLVPVLSYLFRRIEKCLDGSPSLILLDEAWLMLGHPVFRDKIREWLKVLRKANCAVVLATQSISDAERSGIIDVLKESCPTKICLPNGAAREPGTREFYERIGFNERQIEIVASAIPKREYYVAXPEGRRLFDMSLGPVALSFVGVSGKEDLKRIRXLKSNHGEDWPVRWLESRGVHDAASLFNIAXEAXRTXRLHAHLGFGRNRFCRFGHWRGYRMDTARQQRPAXRSSEKLGPSGRQSTEADQPVGRANSKXTEYLXEHAAKHRXASXSHLGAGGRRPQPAPRHR

Samples

Sample ID Description Type Environment
1 2509276019 Ensifer aridi TW10 Isolate Nodule
2 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
3 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
4 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
5 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
6 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
7 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
8 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
9 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
10 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
11 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
12 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
13 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
14 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
15 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
16 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
17 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
18 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
19 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
20 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
21 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
22 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
23 2516143018 Ensifer sp. BR816 Isolate Nodule
24 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
25 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
26 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
27 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
28 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
29 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
30 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
31 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
32 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
33 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
34 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
35 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
36 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
37 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
38 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
39 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
40 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
41 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
42 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
43 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
44 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
45 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
46 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
47 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
48 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
49 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
50 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
51 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
52 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
53 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
54 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
55 2643221557 Ensifer sp. Root558 Isolate Unclassified
56 2643221558 Rhizobium sp. Root149 Isolate Unclassified
57 2643221568 Rhizobium sp. Root564 Isolate Unclassified
58 2643221582 Rhizobium sp. Root651 Isolate Unclassified
59 2643221599 Rhizobium sp. Root708 Isolate Unclassified
60 2643221610 Ensifer sp. Root74 Isolate Unclassified
61 2643221626 Ensifer sp. Root31 Isolate Unclassified
62 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
63 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
64 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
65 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
66 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
67 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
68 2643221668 Ensifer sp. Root423 Isolate Unclassified
69 2643221675 Ensifer sp. Root1298 Isolate Unclassified
70 2643221680 Ensifer sp. Root1312 Isolate Unclassified
71 2643221718 Rhizobium sp. Root268 Isolate Unclassified
72 2643221719 Rhizobium sp. Root274 Isolate Unclassified
73 2643221726 Ensifer sp. Root954 Isolate Unclassified
74 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
75 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
76 2738541293 Rhizobium sp. GV031 Isolate Unclassified
77 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
78 2738543024 Aminobacter sp. AP02 Isolate Unclassified
79 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
80 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
81 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
82 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
83 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
84 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
85 2791355256 Rhizobium sp. M10 Isolate Nodule
86 2791355263 Rhizobium chutanense C5 Isolate Nodule
87 2791355266 Rhizobium sp. L43 Isolate Nodule
88 2791355267 Rhizobium sp. L18 Isolate Nodule
89 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
90 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
91 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
92 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
93 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
94 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
95 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
96 2802429633 Rhizobium anhuiense J3 Isolate Nodule
97 2802429634 Rhizobium anhuiense S10 Isolate Nodule
98 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
99 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
100 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
101 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
102 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
103 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
104 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
105 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
106 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
107 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
108 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
109 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
110 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
111 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
112 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
113 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
114 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
115 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
116 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
117 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
118 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
119 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
120 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
121 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
122 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
123 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
124 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
125 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
126 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
127 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
128 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
129 2844163670 Ensifer sp. 1H6 Isolate Unclassified
130 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
131 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
132 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
133 2854911287 Brucella lupini LUP21 Isolate Unclassified
134 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
135 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
136 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
137 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
138 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
139 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
140 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
141 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
142 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
143 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
144 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
145 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
146 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
147 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
148 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
149 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
150 2936381700 Rhizobium chutanense C16 Isolate Unclassified
151 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
152 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
153 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
154 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
155 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
156 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
157 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
158 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
159 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
160 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
161 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
162 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
163 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
164 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
165 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
166 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
167 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
168 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
169 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
170 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
171 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
172 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
173 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
174 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
175 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
176 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
177 2996887358 Rhizobium sp. R711 Isolate Nodule
178 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
179 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
180 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
181 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
182 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
183 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
184 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
185 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
186 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
187 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
188 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
189 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
190 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
191 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
192 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
193 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
194 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
195 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
196 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
197 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
198 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
199 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
200 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
201 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
202 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
203 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
204 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
205 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
206 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
207 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
208 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
209 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
210 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
211 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
212 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
213 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
214 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
215 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
216 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
217 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
218 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
219 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
220 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
221 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
222 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
223 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
224 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
225 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
226 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
227 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
228 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
229 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
230 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
231 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
232 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
234 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
235 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
236 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
237 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
238 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
239 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
240 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
241 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
242 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
243 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
244 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
245 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
246 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
247 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
248 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
249 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
250 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
251 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
252 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
253 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
254 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
255 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
256 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
257 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
258 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
259 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
260 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
261 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
262 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
263 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
264 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
265 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
266 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
267 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
268 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
269 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
270 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
271 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
272 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
273 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
274 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
275 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
276 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
277 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
278 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
279 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
280 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
281 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
282 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
283 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
284 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
285 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
286 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
287 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
288 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
289 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
296 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
297 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
298 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
299 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
300 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
301 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
302 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
303 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
304 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
305 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
306 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
307 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
308 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
309 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
310 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
311 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
312 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
313 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
314 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
315 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
316 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
317 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
318 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
319 8005321885 Rhizobium sp. R72 Isolate Nodule
320 8005395548 Rhizobium sp. R339 Isolate Nodule
321 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
322 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
323 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
324 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
325 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
326 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
327 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
328 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
329 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
330 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
331 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
332 8018176218 Rhizobium sp. N122 Isolate Nodule
333 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
334 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
335 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
336 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 50.51
Metatranscriptomes 0
Isolates 49.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 23.78
Nodule 35.37
Rhizoplane 1.02
Rhizosphere 17.89
Stem 0
Stem Tuber 0
Unclassified 21.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1000766 3300002739 Bacteria 6150
2 JGI25152J39213_1000088 3300002773 Bacteria 64052
3 JGI25152J39213_1001183 3300002773 Bacteria 12050
4 JGI25150J39212_1000058 3300002774 Bacteria 66130
5 JGI25159J45721_1000109 3300002987 Bacteria 38930
6 JGI25159J45721_1001093 3300002987 Bacteria 11574
7 JGI25151J46595_10000241 3300003187 Bacteria 64064
8 JGI25165J46597_1000238 3300003214 Bacteria 75282
9 JGI25165J46597_1000950 3300003214 Bacteria 19828
10 JGI25165J46597_1001882 3300003214 Bacteria 8560
11 JGI25153J46596_10003224 3300003215 Bacteria 9170
12 rootH1_10002814 3300003316 Bacteria 40375
13 rootH1_10002814 3300003323 Bacteria 12796
14 rootH2_10029723 3300003320 Bacteria 13503
15 rootL2_10010387 3300003322 Bacteria 55016
16 rootH1_10025473 3300003323 Bacteria 4607
17 JGI25160J50197_1000103 3300003354 Bacteria 80968
18 JGI25160J50197_1001519 3300003354 Bacteria 11509
19 JGI25160J50197_1003054 3300003354 Bacteria 7633
20 JGI25160J50197_1003468 3300003354 Bacteria 7052
21 JGI25161J50226_1000090 3300003374 Bacteria 73647
22 JGI25161J50226_1000106 3300003374 Bacteria 65625
23 Ga0055526_1000340 3300003771 Bacteria 38210
24 Ga0055526_1001750 3300003771 Bacteria 15071
25 Ga0055526_1005680 3300003771 Bacteria 7081
26 Ga0055524_1000407 3300003775 Bacteria 36421
27 Ga0055524_1002811 3300003775 Bacteria 8740
28 Ga0055524_1003922 3300003775 Bacteria 7048
29 Ga0055524_1014124 3300003775 Bacteria 2976
30 Ga0055528_1000039 3300003790 Bacteria 112899
31 Ga0055528_1003238 3300003790 Bacteria 8305
32 Ga0055528_1010450 3300003790 Bacteria 3772
33 Ga0055540_1000094 3300003792 Bacteria 97733
34 Ga0055540_1000113 3300003792 Bacteria 86603
35 Ga0055540_1000381 3300003792 Bacteria 37015
36 Ga0055540_1000794 3300003792 Bacteria 21378
37 Ga0055531_10000389 3300003794 Bacteria 42420
38 Ga0055531_10001307 3300003794 Bacteria 18774
39 Ga0055531_10014697 3300003794 Bacteria 3507
40 Ga0055531_10016453 3300003794 Bacteria 3189
41 Ga0058692_1000019 3300003856 Bacteria 255580
42 Ga0058692_1000083 3300003856 Bacteria 66222
43 Ga0055543_1000087 3300004625 Bacteria 81157
44 Ga0055543_1000169 3300004625 Bacteria 54844
45 Ga0065165_1000900 3300005262 Bacteria 38368
46 Ga0065165_1001497 3300005262 Bacteria 24706
47 Ga0065165_1004719 3300005262 Bacteria 8183
48 Ga0065165_1011007 3300005262 Bacteria 3833
49 Ga0065165_1011694 3300005262 Bacteria 3630
50 Ga0065165_1015933 3300005262 Bacteria 2841
51 Ga0068856_100039957 3300005614 Bacteria 4607
52 Ga0075363_100000498 3300006048 Bacteria 12499
53 Ga0075364_10003243 3300006051 Bacteria 9214
54 Ga0075367_10006329 3300006178 Bacteria 5971
55 Ga0075367_10015065 3300006178 Bacteria 4193
56 Ga0099826_10000032 3300006948 Bacteria 122288
57 Ga0099826_10032287 3300006948 Bacteria 3776
58 Ga0105248_10045733 3300009177 Bacteria 4907
59 Ga0123341_1018325 3300009765 Bacteria 6079
60 Ga0123342_1007895 3300009766 Bacteria 13782
61 Ga0123342_1008640 3300009766 Bacteria 12672
62 Ga0123342_1015871 3300009766 Bacteria 6710
63 Ga0105239_10000065 3300010375 Bacteria 151224
64 Ga0214544_1000097 3300021320 Bacteria 116548
65 Ga0214544_1000584 3300021320 Bacteria 68638
66 Ga0214544_1015545 3300021320 Bacteria 7875
67 Ga0214542_1000418 3300021321 Bacteria 75807
68 Ga0214542_1017888 3300021321 Bacteria 6219
69 Ga0214543_1003317 3300021327 Bacteria 31302
70 Ga0228710_1011825 3300022740 Bacteria 11087
71 Ga0209436_100001 3300025208 Bacteria 304543
72 Ga0209437_100250 3300025233 Bacteria 85166
73 Ga0209437_100614 3300025233 Bacteria 21837
74 Ga0207425_1000083 3300025245 Bacteria 96984
75 Ga0209677_100703 3300025253 Bacteria 17075
76 Ga0209677_101341 3300025253 Bacteria 10816
77 Ga0209129_1000098 3300025258 Bacteria 163406
78 Ga0209129_1000719 3300025258 Bacteria 21372
79 Ga0209129_1000821 3300025258 Bacteria 19527
80 Ga0209233_1000238 3300025261 Bacteria 92087
81 Ga0209233_1000562 3300025261 Bacteria 19864
82 Ga0209233_1000661 3300025261 Bacteria 16624
83 Ga0209673_1000126 3300025273 Bacteria 167949
84 Ga0209673_1000161 3300025273 Bacteria 142073
85 Ga0209673_1000845 3300025273 Bacteria 39932
86 Ga0209673_1001573 3300025273 Bacteria 20332
87 Ga0209673_1003461 3300025273 Bacteria 9290
88 Ga0209130_1000049 3300025284 Bacteria 226841
89 Ga0209130_1000098 3300025284 Bacteria 142506
90 Ga0209130_1006584 3300025284 Bacteria 3748
91 Ga0209676_1002796 3300025292 Bacteria 11569
92 Ga0209676_1003351 3300025292 Bacteria 9985
93 Ga0209025_1000142 3300025294 Bacteria 183903
94 Ga0209025_1001930 3300025294 Bacteria 24020
95 Ga0209564_1000354 3300025295 Bacteria 85718
96 Ga0209564_1000368 3300025295 Bacteria 83910
97 Ga0209564_1001053 3300025295 Bacteria 33613
98 Ga0209564_1009671 3300025295 Bacteria 4552
99 Ga0209564_1011104 3300025295 Bacteria 4070
100 Ga0209758_1000300 3300025297 Bacteria 97000
101 Ga0209758_1001917 3300025297 Bacteria 22638
102 Ga0209758_1003216 3300025297 Bacteria 15213
103 Ga0209758_1008866 3300025297 Bacteria 6394
104 Ga0209050_1003671 3300025298 Bacteria 11078
105 Ga0209256_1000228 3300025299 Bacteria 102990
106 Ga0209256_1000999 3300025299 Bacteria 33608
107 Ga0209256_1002109 3300025299 Bacteria 17299
108 Ga0209256_1010554 3300025299 Bacteria 3845
109 Ga0207426_1000043 3300025302 Bacteria 432827
110 Ga0207426_1000069 3300025302 Bacteria 334513
111 Ga0207426_1000283 3300025302 Bacteria 103487
112 Ga0207426_1001108 3300025302 Bacteria 24750
113 Ga0207426_1002581 3300025302 Bacteria 11267
114 Ga0209051_1000032 3300025303 Bacteria 383445
115 Ga0209051_1000132 3300025303 Bacteria 139145
116 Ga0209051_1000287 3300025303 Bacteria 80935
117 Ga0209051_1000895 3300025303 Bacteria 29801
118 Ga0209257_1000209 3300025304 Bacteria 141383
119 Ga0209257_1001865 3300025304 Bacteria 22867
120 Ga0209257_1002393 3300025304 Bacteria 18775
121 Ga0209281_1000348 3300027111 Bacteria 76877
122 Ga0209371_1000107 3300027312 Bacteria 141889
123 Ga0209371_1000251 3300027312 Bacteria 66325
124 Ga0209282_1000070 3300027666 Bacteria 85274
125 Ga0209282_1003138 3300027666 Bacteria 9759
126 Ga0268256_1000093 3300030500 Bacteria 141889
127 Ga0307513_10075160 3300031456 Bacteria 3510
128 Ga0307405_10001720 3300031731 Bacteria 9340
129 Ga0307406_10020348 3300031901 Bacteria 3907
130 Ga0315914_1000082 3300031967 Bacteria 78317
131 Ga0307510_10004792 3300033180 Bacteria 16009
132 Ga0315913_1000028 3300033430 Bacteria 78319
133 Ga0315915_1000004 3300033464 Bacteria 403083
134 Ga0373927_0001245 3300035695 Bacteria 19322
135 Ga0373925_0000579 3300037068 Bacteria 35494
136 Ga0395898_0000840 3300037466 Bacteria 50812
137 Ga0395905_0004538 3300037471 Bacteria 14378
138 Ga0395901_0000132 3300038443 Bacteria 96418
139 Ga0439436_0005973 3300041404 Bacteria 3734
140 Ga0439465_0000118 3300041413 Bacteria 18781
141 Ga0451833_0152513 3300041491 Bacteria 14791
142 Ga0451833_0858088 3300041491 Bacteria 7564
143 Ga0451835_0471770 3300041492 Bacteria 8979
144 Ga0451835_1242391 3300041492 Bacteria 4960
145 Ga0451839_0352628 3300041496 Bacteria 15201
146 Ga0451839_0363184 3300041496 Bacteria 11590
147 Ga0451839_0711942 3300041496 Bacteria 2997
148 Ga0451841_0555957 3300041498 Bacteria 30671
149 Ga0451845_0193549 3300041501 Bacteria 3271
150 Ga0451845_0361663 3300041501 Bacteria 8485
151 Ga0451847_0206364 3300041503 Bacteria 12047
152 Ga0451849_0565515 3300041505 Bacteria 6553
153 Ga0451849_1476207 3300041505 Bacteria 4672
154 Ga0451851_0003572 3300041507 Bacteria 27523
155 Ga0451851_0193482 3300041507 Bacteria 26742
156 Ga0451843_1389179 3300041509 Bacteria 16178
157 Ga0451853_0193996 3300041512 Bacteria 20097
158 Ga0451853_1755455 3300041512 Bacteria 4076
159 Ga0495638_0000077 3300046460 Bacteria 158724
160 Ga0495638_0000181 3300046460 Bacteria 96473
161 Ga0495638_0007091 3300046460 Bacteria 8083
162 Ga0495585_0002471 3300046492 Bacteria 13197
163 Ga0495607_0004354 3300046501 Bacteria 10439
164 Ga0495607_0028661 3300046501 Bacteria 3433
165 Ga0495606_0000599 3300046507 Bacteria 57031
166 Ga0495610_0005827 3300046512 Bacteria 8658
167 Ga0495620_0000107 3300046515 Bacteria 66810
168 Ga0495620_0001213 3300046515 Bacteria 15761
169 Ga0495632_0000423 3300046519 Bacteria 40113
170 Ga0495632_0012865 3300046519 Bacteria 4801
171 Ga0495643_0003041 3300046522 Bacteria 12611
172 Ga0495654_0004327 3300046530 Bacteria 8462
173 Ga0495611_0000364 3300046648 Bacteria 29296
174 Ga0495625_0004571 3300046660 Bacteria 13017
175 Ga0495625_0012530 3300046660 Bacteria 6865
176 Ga0495613_0004078 3300046689 Bacteria 10920
177 Ga0495670_0000149 3300046691 Bacteria 30870
178 Ga0495687_000105 3300047443 Bacteria 128239
179 Ga0495681_0000657 3300047470 Bacteria 26280
180 Ga0495686_0000500 3300047472 Bacteria 57459
181 Ga0496104_0016015 3300048907 Bacteria 6807
182 Ga0496105_0000087 3300048908 Bacteria 65230
183 Ga0496116_0000601 3300048919 Bacteria 47643
184 Ga0496116_0001726 3300048919 Bacteria 23861
185 Ga0496116_0024132 3300048919 Bacteria 4506
186 Ga0496117_0002417 3300048920 Bacteria 23697
187 Ga0496118_0030791 3300048921 Bacteria 4466
188 Ga0496119_0000302 3300048922 Bacteria 68876
189 Ga0496119_0000569 3300048922 Bacteria 49819
190 Ga0496119_0001142 3300048922 Bacteria 33317
191 Ga0496119_0013427 3300048922 Bacteria 6526
192 Ga0496119_0014575 3300048922 Bacteria 6134
193 Ga0496120_0000410 3300048923 Bacteria 68982
194 Ga0496120_0003528 3300048923 Bacteria 14156
195 Ga0496120_0020913 3300048923 Bacteria 4146
196 Ga0496121_0000115 3300048924 Bacteria 178411
197 Ga0496121_0027857 3300048924 Bacteria 5277
198 Ga0496121_0028679 3300048924 Bacteria 5176
199 Ga0496122_0005173 3300048925 Bacteria 15693
200 Ga0496122_0010254 3300048925 Bacteria 9701
201 Ga0496122_0010619 3300048925 Bacteria 9458
202 Ga0496122_0011835 3300048925 Bacteria 8771
203 Ga0496123_0002390 3300048926 Bacteria 23485
204 Ga0496123_0012233 3300048926 Bacteria 7339
205 Ga0496124_0018666 3300048927 Bacteria 6487
206 Ga0496124_0020377 3300048927 Bacteria 6129
207 Ga0496125_0000182 3300048928 Bacteria 137747
208 Ga0496125_0002294 3300048928 Bacteria 25293
209 Ga0496125_0036410 3300048928 Bacteria 4298
210 Ga0496126_0000522 3300048929 Bacteria 74922
211 Ga0496126_0001273 3300048929 Bacteria 40531
212 Ga0495678_000295 3300049459 Bacteria 54788
213 Ga0501033_0000054 3300049570 Bacteria 108163
214 Ga0501033_0000630 3300049570 Bacteria 32555
215 Ga0501033_0002813 3300049570 Bacteria 14563
216 Ga0501034_0006431 3300049571 Bacteria 12649
217 Ga0501034_0054016 3300049571 Bacteria 4045
218 Ga0501034_0097425 3300049571 Bacteria 2937
219 Ga0501037_0047531 3300049573 Bacteria 3145
220 Ga0501038_0000594 3300049574 Bacteria 32069
221 Ga0501038_0006644 3300049574 Bacteria 10695
222 Ga0501043_0010704 3300049579 Bacteria 7186
223 Ga0501043_0065354 3300049579 Bacteria 2857
224 Ga0501035_0000231 3300049822 Bacteria 66354
225 Ga0501035_0000730 3300049822 Bacteria 35664
226 Ga0501035_0001626 3300049822 Bacteria 22754
227 Ga0501044_0001034 3300049823 Bacteria 33520
228 nmdc:mga00v17_85_c1 3300050491 Bacteria 57269
229 Ga0500578_0001231 3300053086 Bacteria 26849
230 Ga0500583_0001023 3300053092 Bacteria 7980
231 Ga0500555_002431 3300053103 Bacteria 5399
232 Ga0500608_000646 3300053122 Bacteria 12801
233 Ga0500618_000097 3300053125 Bacteria 71932
234 Ga0500618_000649 3300053125 Bacteria 20700
235 Ga0500564_001819 3300053138 Bacteria 7570
236 Ga0500573_0003603 3300053140 Bacteria 8036
237 Ga0500574_000032 3300053141 Bacteria 18144
238 Ga0500604_0000838 3300053151 Bacteria 8492
239 Ga0500604_0001186 3300053151 Bacteria 7251
240 Ga0500616_0000438 3300053153 Bacteria 55072
241 Ga0500622_0000278 3300053156 Bacteria 52272
242 Ga0500624_000353 3300053157 Bacteria 14950
243 Ga0500638_000138 3300053162 Bacteria 13919
244 Ga0500636_0000091 3300053177 Bacteria 45101
245 Ga0500636_0000096 3300053177 Bacteria 44837
246 Ga0500636_0000231 3300053177 Bacteria 30492
247 Ga0500611_002194 3300053727 Bacteria 2296

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053727 Ga0500611_002194 Ga0500611_002194_135_2267 694
2 3300048924 Ga0496121_0028679 Ga0496121_0028679_50_2284 727
3 3300049571 Ga0501034_0097425 Ga0501034_0097425_32_2263 727
4 3300041404 Ga0439436_0005973 Ga0439436_0005973_1467_3704 728
5 iso_pu_bacteria 2513237159 2514001282 754
6 iso_pu_bacteria 2915980308 2915986715 761
7 iso_pu_bacteria 2921250672 2921254080 761
8 3300009766 Ga0123342_1007895 Ga0123342_10078955 763
9 iso_pu_bacteria 2858800743 2858804487 765
10 3300049571 Ga0501034_0054016 Ga0501034_0054016_719_3055 766
11 3300046501 Ga0495607_0004354 Ga0495607_0004354_398_2854 767
12 3300041505 Ga0451849_1476207 Ga0451849_1476207_358_2826 768
13 3300053141 Ga0500574_000032 Ga0500574_000032_307_2760 769
14 3300053177 Ga0500636_0000091 Ga0500636_0000091_38870_41338 769
15 3300003214 JGI25165J46597_1000950 JGI25165J46597_100095017 770
16 3300005614 Ga0068856_100039957 Ga0068856_1000399574 770
17 3300025233 Ga0209437_100614 Ga0209437_10061412 770
18 3300025261 Ga0209233_1000562 Ga0209233_100056216 770
19 3300025253 Ga0209677_100703 Ga0209677_1007034 771
20 3300006948 Ga0099826_10000032 Ga0099826_1000003216 772
21 3300027666 Ga0209282_1003138 Ga0209282_10031385 772
22 3300053140 Ga0500573_0003603 Ga0500573_0003603_3059_5512 778
23 3300033180 Ga0307510_10004792 Ga0307510_100047927 784
24 3300046460 Ga0495638_0000181 Ga0495638_0000181_38745_41198 784
25 3300046515 Ga0495620_0000107 Ga0495620_0000107_41198_43651 784
26 3300046648 Ga0495611_0000364 Ga0495611_0000364_1821_4274 784
27 3300046689 Ga0495613_0004078 Ga0495613_0004078_6192_8645 784
28 3300046691 Ga0495670_0000149 Ga0495670_0000149_22548_25001 784
29 3300047443 Ga0495687_000105 Ga0495687_000105_84572_87025 784
30 3300047470 Ga0495681_0000657 Ga0495681_0000657_19215_21668 784
31 3300049459 Ga0495678_000295 Ga0495678_000295_17953_20406 784
32 3300053086 Ga0500578_0001231 Ga0500578_0001231_9589_12042 784
33 3300053092 Ga0500583_0001023 Ga0500583_0001023_4156_6609 784
34 3300053103 Ga0500555_002431 Ga0500555_002431_2050_4503 784
35 3300053122 Ga0500608_000646 Ga0500608_000646_6431_8884 784
36 3300053138 Ga0500564_001819 Ga0500564_001819_2235_4688 784
37 3300053162 Ga0500638_000138 Ga0500638_000138_4776_7229 784
38 3300053157 Ga0500624_000353 Ga0500624_000353_12445_14898 785
39 3300037471 Ga0395905_0004538 Ga0395905_0004538_2829_5285 786
40 iso_pu_bacteria 2802429633 2806048256 786
41 3300003214 JGI25165J46597_1001882 JGI25165J46597_10018826 792
42 3300025253 Ga0209677_101341 Ga0209677_1013416 792
43 3300025261 Ga0209233_1000661 Ga0209233_100066114 792
44 iso_pu_bacteria 2643221627 2644153795 792
45 iso_pu_bacteria 2919100787 2919108374 792
46 3300021320 Ga0214544_1015545 Ga0214544_10155454 793
47 3300025297 Ga0209758_1008866 Ga0209758_10088664 793
48 3300041491 Ga0451833_0858088 Ga0451833_0858088_5027_7474 793
49 3300041492 Ga0451835_1242391 Ga0451835_1242391_1260_3707 793
50 3300041496 Ga0451839_0352628 Ga0451839_0352628_673_3120 793
51 3300041501 Ga0451845_0361663 Ga0451845_0361663_3837_6284 793
52 3300041503 Ga0451847_0206364 Ga0451847_0206364_5105_7552 793
53 3300041507 Ga0451851_0003572 Ga0451851_0003572_9406_11853 793
54 3300047472 Ga0495686_0000500 Ga0495686_0000500_41196_43649 794
55 iso_pu_bacteria 2513237162 2514024728 794
56 iso_pu_bacteria 2515154116 2515661299 794
57 iso_pu_bacteria 2516653077 2517042911 794
58 iso_pu_bacteria 2517093000 2517099938 794
59 iso_pu_bacteria 2765235942 2766064447 794
60 iso_pu_bacteria 2791355267 2793370591 794
61 iso_pu_bacteria 8056375014 8056377375 794
62 3300046522 Ga0495643_0003041 Ga0495643_0003041_10011_12461 795
63 3300046660 Ga0495625_0004571 Ga0495625_0004571_559_3009 795
64 iso_pu_bacteria 2513237086 2513586403 795
65 iso_pu_bacteria 2513237103 2513714163 795
66 iso_pu_bacteria 2513237138 2513869315 795
67 iso_pu_bacteria 2513237159 2513998922 795
68 iso_pu_bacteria 2524023209 2524460892 795
69 iso_pu_bacteria 2551306087 2551699248 795
70 iso_pu_bacteria 2582581316 2585336482 795
71 iso_pu_bacteria 2599185236 2599723325 795
72 iso_pu_bacteria 2615840626 2616310041 795
73 iso_pu_bacteria 2643221599 2644008202 795
74 iso_pu_bacteria 2643221634 2644194983 795
75 iso_pu_bacteria 2643221643 2644238394 795
76 iso_pu_bacteria 2738541293 2738805199 795
77 iso_pu_bacteria 2738541293 2738805877 795
78 iso_pu_bacteria 2791355256 2793298072 795
79 iso_pu_bacteria 2818991461 2819688120 795
80 iso_pu_bacteria 2821123053 2821128898 795
81 iso_pu_bacteria 2841864319 2841870174 795
82 iso_pu_bacteria 2842521101 2842524147 795
83 iso_pu_bacteria 2857531043 2857537244 795
84 iso_pu_bacteria 2888378607 2888387959 795
85 iso_pu_bacteria 2916068649 2916072059 795
86 iso_pu_bacteria 2921289301 2921296163 795
87 iso_pu_bacteria 2924165586 2924171042 795
88 iso_pu_bacteria 2924221636 2924226705 795
89 iso_pu_bacteria 2957422303 2957429312 795
90 iso_pu_bacteria 2960645483 2960651023 795
91 iso_pu_bacteria 2967706974 2967713034 795
92 iso_pu_bacteria 2970136068 2970141386 795
93 iso_pu_bacteria 2996887358 2996889809 795
94 iso_pu_bacteria 3005409236 3005410233 795
95 iso_pu_bacteria 639633055 639651345 795
96 iso_pu_bacteria 8003992118 8003999214 795
97 iso_pu_bacteria 8005321885 8005324336 795
98 3300006048 Ga0075363_100000498 Ga0075363_10000049812 796
99 3300006178 Ga0075367_10015065 Ga0075367_100150652 796
100 3300021320 Ga0214544_1000097 Ga0214544_100009753 796
101 3300021321 Ga0214542_1000418 Ga0214542_100041864 796
102 3300021321 Ga0214542_1017888 Ga0214542_10178886 796
103 3300021327 Ga0214543_1003317 Ga0214543_100331711 796
104 3300046507 Ga0495606_0000599 Ga0495606_0000599_18911_21379 796
105 3300048922 Ga0496119_0000302 Ga0496119_0000302_19300_21738 796
106 3300048923 Ga0496120_0000410 Ga0496120_0000410_47139_49577 796
107 3300048928 Ga0496125_0036410 Ga0496125_0036410_694_3132 796
108 3300049570 Ga0501033_0000630 Ga0501033_0000630_23565_26000 796
109 3300049571 Ga0501034_0006431 Ga0501034_0006431_9899_12337 796
110 3300049573 Ga0501037_0047531 Ga0501037_0047531_395_2833 796
111 3300049574 Ga0501038_0000594 Ga0501038_0000594_29319_31757 796
112 3300049574 Ga0501038_0006644 Ga0501038_0006644_6625_9060 796
113 3300049579 Ga0501043_0010704 Ga0501043_0010704_1936_4374 796
114 3300049579 Ga0501043_0065354 Ga0501043_0065354_388_2823 796
115 3300049822 Ga0501035_0000730 Ga0501035_0000730_6641_9076 796
116 3300049823 Ga0501044_0001034 Ga0501044_0001034_6559_8994 796
117 3300053151 Ga0500604_0000838 Ga0500604_0000838_2906_5341 796
118 iso_pu_bacteria 2510917026 2511173544 796
119 iso_pu_bacteria 2511231027 2511388164 796
120 iso_pu_bacteria 2528768022 2528855945 796
121 iso_pu_bacteria 2582581306 2585268305 796
122 iso_pu_bacteria 2582581307 2585275732 796
123 iso_pu_bacteria 2582581308 2585281745 796
124 iso_pu_bacteria 2582581315 2585326979 796
125 iso_pu_bacteria 2582581316 2585334819 796
126 iso_pu_bacteria 2582581865 2585391202 796
127 iso_pu_bacteria 2585427527 2585534393 796
128 iso_pu_bacteria 2585427530 2585553937 796
129 iso_pu_bacteria 2585427530 2585555293 796
130 iso_pu_bacteria 2585427531 2585563679 796
131 iso_pu_bacteria 2585427608 2585897381 796
132 iso_pu_bacteria 2585427609 2585908928 796
133 iso_pu_bacteria 2585428125 2587984251 796
134 iso_pu_bacteria 2643221557 2643806756 796
135 iso_pu_bacteria 2643221610 2644066809 796
136 iso_pu_bacteria 2643221634 2644192467 796
137 iso_pu_bacteria 2643221668 2644381254 796
138 iso_pu_bacteria 2643221675 2644417755 796
139 iso_pu_bacteria 2643221680 2644451031 796
140 iso_pu_bacteria 2643221726 2644691750 796
141 iso_pu_bacteria 2821123053 2821129824 796
142 iso_pu_bacteria 2839993093 2839998457 796
143 iso_pu_bacteria 2842521101 2842526947 796
144 iso_pu_bacteria 2844163670 2844164518 796
145 iso_pu_bacteria 2854911287 2854911458 796
146 iso_pu_bacteria 2904699407 2904699710 796
147 iso_pu_bacteria 2922368715 2922378830 796
148 iso_pu_bacteria 2922425934 2922434796 796
149 iso_pu_bacteria 2928521798 2928525617 796
150 iso_pu_bacteria 2937843397 2937844038 796
151 iso_pu_bacteria 2954011201 2954012361 796
152 iso_pu_bacteria 8002285264 8002287560 796
153 iso_pu_bacteria 8006933436 8006943823 796
154 iso_pu_bacteria 8006973647 8006984288 796
155 iso_pu_bacteria 8018127388 8018134491 796
156 iso_pu_bacteria 8046767195 8046767825 796
157 3300003856 Ga0058692_1000019 Ga0058692_1000019100 797
158 3300003856 Ga0058692_1000019 Ga0058692_1000019237 797
159 3300027312 Ga0209371_1000107 Ga0209371_100010729 797
160 3300030500 Ga0268256_1000093 Ga0268256_100009329 797
161 3300049570 Ga0501033_0002813 Ga0501033_0002813_11945_14383 797
162 3300049822 Ga0501035_0000231 Ga0501035_0000231_22420_24858 797
163 iso_pu_bacteria 2509276019 2509378647 797
164 iso_pu_bacteria 2512047086 2512531269 797
165 iso_pu_bacteria 2512875026 2512975103 797
166 iso_pu_bacteria 2513237084 2513573047 797
167 iso_pu_bacteria 2513237085 2513580874 797
168 iso_pu_bacteria 2513237088 2513600617 797
169 iso_pu_bacteria 2513237089 2513605139 797
170 iso_pu_bacteria 2513237138 2513869943 797
171 iso_pu_bacteria 2513237140 2513881841 797
172 iso_pu_bacteria 2513237140 2513885918 797
173 iso_pu_bacteria 2513237144 2513914243 797
174 iso_pu_bacteria 2513237144 2513914275 797
175 iso_pu_bacteria 2513237146 2513930109 797
176 iso_pu_bacteria 2513237160 2514007830 797
177 iso_pu_bacteria 2515075009 2515109928 797
178 iso_pu_bacteria 2515154107 2515611281 797
179 iso_pu_bacteria 2515154107 2515611854 797
180 iso_pu_bacteria 2515154113 2515635676 797
181 iso_pu_bacteria 2516143018 2516210366 797
182 iso_pu_bacteria 2517487022 2517567747 797
183 iso_pu_bacteria 2524023207 2524451573 797
184 iso_pu_bacteria 2524023209 2524462821 797
185 iso_pu_bacteria 2524023209 2524462872 797
186 iso_pu_bacteria 2534681796 2535521025 797
187 iso_pu_bacteria 2558860100 2558864272 797
188 iso_pu_bacteria 2558860100 2558867017 797
189 iso_pu_bacteria 2558860100 2558867706 797
190 iso_pu_bacteria 2582581294 2585205205 797
191 iso_pu_bacteria 2582581304 2585258065 797
192 iso_pu_bacteria 2585427593 2585841009 797
193 iso_pu_bacteria 2585427594 2585846021 797
194 iso_pu_bacteria 2585427633 2585994094 797
195 iso_pu_bacteria 2599185170 2599413971 797
196 iso_pu_bacteria 2599185210 2599606328 797
197 iso_pu_bacteria 2615840626 2616311765 797
198 iso_pu_bacteria 2615840698 2616551459 797
199 iso_pu_bacteria 2643221558 2643810873 797
200 iso_pu_bacteria 2643221568 2643858399 797
201 iso_pu_bacteria 2643221582 2643918126 797
202 iso_pu_bacteria 2643221626 2644147391 797
203 iso_pu_bacteria 2643221636 2644200552 797
204 iso_pu_bacteria 2643221637 2644208163 797
205 iso_pu_bacteria 2643221653 2644300761 797
206 iso_pu_bacteria 2643221718 2644651921 797
207 iso_pu_bacteria 2643221719 2644658983 797
208 iso_pu_bacteria 2667528174 2671117166 797
209 iso_pu_bacteria 2724679232 2725949142 797
210 iso_pu_bacteria 2738541333 2739037590 797
211 iso_pu_bacteria 2738543024 2739306955 797
212 iso_pu_bacteria 2775507266 2778176769 797
213 iso_pu_bacteria 2775507266 2778179990 797
214 iso_pu_bacteria 2775507266 2778180296 797
215 iso_pu_bacteria 2791355091 2792623753 797
216 iso_pu_bacteria 2791355091 2792624679 797
217 iso_pu_bacteria 2791355092 2792630014 797
218 iso_pu_bacteria 2791355092 2792630799 797
219 iso_pu_bacteria 2791355094 2792641092 797
220 iso_pu_bacteria 2791355094 2792642042 797
221 iso_pu_bacteria 2791355253 2793283263 797
222 iso_pu_bacteria 2791355263 2793343377 797
223 iso_pu_bacteria 2791355263 2793343568 797
224 iso_pu_bacteria 2791355266 2793363139 797
225 iso_pu_bacteria 2791355266 2793363447 797
226 iso_pu_bacteria 2791355266 2793364262 797
227 iso_pu_bacteria 2802428858 2802721038 797
228 iso_pu_bacteria 2802428860 2802733592 797
229 iso_pu_bacteria 2802428861 2802736663 797
230 iso_pu_bacteria 2802428862 2802746731 797
231 iso_pu_bacteria 2802428863 2802749772 797
232 iso_pu_bacteria 2802429605 2805931153 797
233 iso_pu_bacteria 2802429606 2805936955 797
234 iso_pu_bacteria 2802429606 2805937707 797
235 iso_pu_bacteria 2802429634 2806055724 797
236 iso_pu_bacteria 2802429635 2806062561 797
237 iso_pu_bacteria 2802429636 2806070901 797
238 iso_pu_bacteria 2818991448 2819612130 797
239 iso_pu_bacteria 2838029111 2838033489 797
240 iso_pu_bacteria 2838029111 2838034521 797
241 iso_pu_bacteria 2838035591 2838042540 797
242 iso_pu_bacteria 2838074704 2838080830 797
243 iso_pu_bacteria 2838661181 2838668384 797
244 iso_pu_bacteria 2838686498 2838691059 797
245 iso_pu_bacteria 2841851746 2841856375 797
246 iso_pu_bacteria 2842077413 2842083226 797
247 iso_pu_bacteria 2842110456 2842117297 797
248 iso_pu_bacteria 2842198810 2842202711 797
249 iso_pu_bacteria 2842271015 2842275534 797
250 iso_pu_bacteria 2842285085 2842290220 797
251 iso_pu_bacteria 2842298080 2842302334 797
252 iso_pu_bacteria 2842298080 2842303815 797
253 iso_pu_bacteria 2842317721 2842324048 797
254 iso_pu_bacteria 2842357229 2842363294 797
255 iso_pu_bacteria 2842395702 2842402004 797
256 iso_pu_bacteria 2842402390 2842407954 797
257 iso_pu_bacteria 2842402390 2842408272 797
258 iso_pu_bacteria 2842409023 2842414541 797
259 iso_pu_bacteria 2842409023 2842414634 797
260 iso_pu_bacteria 2842415677 2842421023 797
261 iso_pu_bacteria 2842415677 2842421611 797
262 iso_pu_bacteria 2842475841 2842480240 797
263 iso_pu_bacteria 2842475841 2842481268 797
264 iso_pu_bacteria 2842482326 2842488244 797
265 iso_pu_bacteria 2842489311 2842494732 797
266 iso_pu_bacteria 2842502639 2842507652 797
267 iso_pu_bacteria 2842502639 2842508147 797
268 iso_pu_bacteria 2842509118 2842513972 797
269 iso_pu_bacteria 2842509118 2842514812 797
270 iso_pu_bacteria 2844454524 2844461924 797
271 iso_pu_bacteria 2844454524 2844462250 797
272 iso_pu_bacteria 2850079185 2850083352 797
273 iso_pu_bacteria 2852387548 2852392942 797
274 iso_pu_bacteria 2896384573 2896387904 797
275 iso_pu_bacteria 2913295892 2913298780 797
276 iso_pu_bacteria 2920760137 2920762319 797
277 iso_pu_bacteria 2933016740 2933023044 797
278 iso_pu_bacteria 2933586486 2933590021 797
279 iso_pu_bacteria 2936381700 2936386388 797
280 iso_pu_bacteria 2937029754 2937035491 797
281 iso_pu_bacteria 2937036028 2937039920 797
282 iso_pu_bacteria 2937078374 2937078944 797
283 iso_pu_bacteria 2937084907 2937087479 797
284 iso_pu_bacteria 2941499720 2941503549 797
285 iso_pu_bacteria 2957375807 2957376332 797
286 iso_pu_bacteria 2957437181 2957440505 797
287 iso_pu_bacteria 2958064165 2958068806 797
288 iso_pu_bacteria 2960591022 2960597372 797
289 iso_pu_bacteria 2960631154 2960636565 797
290 iso_pu_bacteria 2960680706 2960686076 797
291 iso_pu_bacteria 2960693952 2960695817 797
292 iso_pu_bacteria 2967686174 2967690985 797
293 iso_pu_bacteria 2967728569 2967733694 797
294 iso_pu_bacteria 2970026789 2970029036 797
295 iso_pu_bacteria 2970122695 2970125130 797
296 iso_pu_bacteria 2970143518 2970148075 797
297 iso_pu_bacteria 2977530762 2977533378 797
298 iso_pu_bacteria 2977544691 2977548865 797
299 iso_pu_bacteria 2989776772 2989780899 797
300 iso_pu_bacteria 2989776772 2989781195 797
301 iso_pu_bacteria 3005416602 3005418270 797
302 iso_pu_bacteria 8003570095 8003574979 797
303 iso_pu_bacteria 8003570095 8003575140 797
304 iso_pu_bacteria 8003999396 8004005293 797
305 iso_pu_bacteria 8005301065 8005301749 797
306 iso_pu_bacteria 8005314921 8005316040 797
307 iso_pu_bacteria 8005395548 8005402180 797
308 iso_pu_bacteria 8005460587 8005465962 797
309 iso_pu_bacteria 8005484373 8005488249 797
310 iso_pu_bacteria 8005542996 8005549965 797
311 iso_pu_bacteria 8005645114 8005648491 797
312 iso_pu_bacteria 8005682033 8005687157 797
313 iso_pu_bacteria 8005688590 8005693073 797
314 iso_pu_bacteria 8018150411 8018153808 797
315 iso_pu_bacteria 8018163183 8018169615 797
316 iso_pu_bacteria 8018176218 8018179068 797
317 iso_pu_bacteria 8046767195 8046770036 797
318 iso_pu_bacteria 8057575449 8057581438 797
319 iso_pu_bacteria 8057874678 8057880204 797
320 3300003214 JGI25165J46597_1000238 JGI25165J46597_100023858 798
321 3300003790 Ga0055528_1000039 Ga0055528_100003927 798
322 3300003792 Ga0055540_1000094 Ga0055540_1000094114 798
323 3300025233 Ga0209437_100250 Ga0209437_10025068 798
324 3300025261 Ga0209233_1000238 Ga0209233_100023868 798
325 3300025273 Ga0209673_1000161 Ga0209673_100016153 798
326 3300025298 Ga0209050_1003671 Ga0209050_10036717 798
327 3300025303 Ga0209051_1000032 Ga0209051_1000032240 798
328 3300041496 Ga0451839_0711942 Ga0451839_0711942_325_2772 798
329 3300041501 Ga0451845_0193549 Ga0451845_0193549_217_2664 798
330 3300046492 Ga0495585_0002471 Ga0495585_0002471_1149_3596 798
331 3300002773 JGI25152J39213_1000088 JGI25152J39213_100008850 799
332 3300002774 JGI25150J39212_1000058 JGI25150J39212_100005818 799
333 3300003187 JGI25151J46595_10000241 JGI25151J46595_1000024150 799
334 3300003215 JGI25153J46596_10003224 JGI25153J46596_100032248 799
335 3300003354 JGI25160J50197_1001519 JGI25160J50197_10015197 799
336 3300005262 Ga0065165_1011694 Ga0065165_10116943 799
337 3300005262 Ga0065165_1015933 Ga0065165_10159332 799
338 3300009765 Ga0123341_1018325 Ga0123341_10183254 799
339 3300009766 Ga0123342_1008640 Ga0123342_100864013 799
340 3300009766 Ga0123342_1015871 Ga0123342_10158714 799
341 3300025245 Ga0207425_1000083 Ga0207425_100008353 799
342 3300025258 Ga0209129_1000098 Ga0209129_1000098130 799
343 3300025273 Ga0209673_1000845 Ga0209673_100084516 799
344 3300025284 Ga0209130_1006584 Ga0209130_10065843 799
345 3300025294 Ga0209025_1000142 Ga0209025_1000142111 799
346 3300025295 Ga0209564_1009671 Ga0209564_10096714 799
347 3300025297 Ga0209758_1000300 Ga0209758_100030053 799
348 3300025297 Ga0209758_1003216 Ga0209758_10032168 799
349 3300025302 Ga0207426_1000283 Ga0207426_100028388 799
350 3300031901 Ga0307406_10020348 Ga0307406_100203484 799
351 3300037466 Ga0395898_0000840 Ga0395898_0000840_22486_24945 799
352 3300038443 Ga0395901_0000132 Ga0395901_0000132_78484_80943 799
353 3300041491 Ga0451833_0152513 Ga0451833_0152513_8017_10452 799
354 3300041492 Ga0451835_0471770 Ga0451835_0471770_5471_7906 799
355 3300041496 Ga0451839_0363184 Ga0451839_0363184_5917_8352 799
356 3300041498 Ga0451841_0555957 Ga0451841_0555957_20191_22626 799
357 3300041505 Ga0451849_0565515 Ga0451849_0565515_2245_4680 799
358 3300041507 Ga0451851_0193482 Ga0451851_0193482_23291_25726 799
359 3300041509 Ga0451843_1389179 Ga0451843_1389179_1977_4412 799
360 3300041512 Ga0451853_0193996 Ga0451853_0193996_7951_10386 799
361 3300046519 Ga0495632_0012865 Ga0495632_0012865_296_2731 799
362 3300048922 Ga0496119_0000569 Ga0496119_0000569_5377_7812 799
363 3300048924 Ga0496121_0027857 Ga0496121_0027857_1430_3865 799
364 3300053151 Ga0500604_0001186 Ga0500604_0001186_3798_6230 799
365 3300053177 Ga0500636_0000096 Ga0500636_0000096_18061_20496 799
366 3300002773 JGI25152J39213_1001183 JGI25152J39213_10011833 800
367 3300002987 JGI25159J45721_1000109 JGI25159J45721_100010919 800
368 3300003354 JGI25160J50197_1000103 JGI25160J50197_100010320 800
369 3300003374 JGI25161J50226_1000090 JGI25161J50226_100009018 800
370 3300003775 Ga0055524_1000407 Ga0055524_10004077 800
371 3300003775 Ga0055524_1003922 Ga0055524_10039223 800
372 3300003790 Ga0055528_1010450 Ga0055528_10104503 800
373 3300004625 Ga0055543_1000087 Ga0055543_100008762 800
374 3300005262 Ga0065165_1000900 Ga0065165_100090027 800
375 3300006051 Ga0075364_10003243 Ga0075364_100032433 800
376 3300009177 Ga0105248_10045733 Ga0105248_100457333 800
377 3300025258 Ga0209129_1000719 Ga0209129_100071914 800
378 3300025273 Ga0209673_1001573 Ga0209673_100157315 800
379 3300025284 Ga0209130_1000098 Ga0209130_100009819 800
380 3300025295 Ga0209564_1011104 Ga0209564_10111044 800
381 3300025299 Ga0209256_1000228 Ga0209256_100022854 800
382 3300025299 Ga0209256_1002109 Ga0209256_10021094 800
383 3300025302 Ga0207426_1000069 Ga0207426_1000069241 800
384 3300025302 Ga0207426_1002581 Ga0207426_10025819 800
385 3300031456 Ga0307513_10075160 Ga0307513_100751603 800
386 3300035695 Ga0373927_0001245 Ga0373927_0001245_7759_10212 800
387 3300037068 Ga0373925_0000579 Ga0373925_0000579_28607_31060 800
388 3300046501 Ga0495607_0028661 Ga0495607_0028661_537_2990 800
389 3300046530 Ga0495654_0004327 Ga0495654_0004327_2531_4984 800
390 3300046660 Ga0495625_0012530 Ga0495625_0012530_735_3188 800
391 3300048907 Ga0496104_0016015 Ga0496104_0016015_2028_4481 800
392 3300048908 Ga0496105_0000087 Ga0496105_0000087_58719_61172 800
393 3300048919 Ga0496116_0024132 Ga0496116_0024132_820_3279 800
394 3300048921 Ga0496118_0030791 Ga0496118_0030791_49_2508 800
395 3300048922 Ga0496119_0014575 Ga0496119_0014575_159_2612 800
396 3300048923 Ga0496120_0020913 Ga0496120_0020913_713_3166 800
397 3300048924 Ga0496121_0000115 Ga0496121_0000115_54035_56476 800
398 3300048925 Ga0496122_0005173 Ga0496122_0005173_11547_14000 800
399 3300048925 Ga0496122_0011835 Ga0496122_0011835_2519_4972 800
400 3300048927 Ga0496124_0018666 Ga0496124_0018666_2945_5398 800
401 3300048928 Ga0496125_0002294 Ga0496125_0002294_14117_16555 800
402 3300050491 nmdc:mga00v17_85_c1 nmdc:mga00v17_85_c1_15651_18092 800
403 3300053125 Ga0500618_000649 Ga0500618_000649_12235_14697 800
404 3300053156 Ga0500622_0000278 Ga0500622_0000278_17152_19581 800
405 iso_pu_bacteria 2919100787 2919107360 800
406 3300002739 JGI25158J39367_1000766 JGI25158J39367_10007665 801
407 3300002987 JGI25159J45721_1001093 JGI25159J45721_10010934 801
408 3300003316 rootH1_10002814 rootH1_1000281429 801
409 3300003320 rootH2_10029723 rootH2_100297238 801
410 3300003322 rootL2_10010387 rootL2_1001038740 801
411 3300003323 rootH1_10025473 rootH1_100254733 801
412 3300003354 JGI25160J50197_1003054 JGI25160J50197_10030544 801
413 3300003354 JGI25160J50197_1003468 JGI25160J50197_10034681 801
414 3300003374 JGI25161J50226_1000106 JGI25161J50226_100010643 801
415 3300003771 Ga0055526_1000340 Ga0055526_100034030 801
416 3300003771 Ga0055526_1001750 Ga0055526_100175013 801
417 3300003771 Ga0055526_1005680 Ga0055526_10056807 801
418 3300003775 Ga0055524_1002811 Ga0055524_10028116 801
419 3300003775 Ga0055524_1014124 Ga0055524_10141242 801
420 3300003790 Ga0055528_1003238 Ga0055528_10032385 801
421 3300003792 Ga0055540_1000113 Ga0055540_100011362 801
422 3300003792 Ga0055540_1000381 Ga0055540_100038124 801
423 3300003792 Ga0055540_1000794 Ga0055540_10007948 801
424 3300003794 Ga0055531_10000389 Ga0055531_1000038930 801
425 3300003794 Ga0055531_10001307 Ga0055531_100013072 801
426 3300003794 Ga0055531_10014697 Ga0055531_100146972 801
427 3300003794 Ga0055531_10016453 Ga0055531_100164532 801
428 3300003856 Ga0058692_1000083 Ga0058692_100008364 801
429 3300004625 Ga0055543_1000169 Ga0055543_100016930 801
430 3300005262 Ga0065165_1001497 Ga0065165_100149713 801
431 3300005262 Ga0065165_1004719 Ga0065165_10047194 801
432 3300005262 Ga0065165_1011007 Ga0065165_10110073 801
433 3300006178 Ga0075367_10006329 Ga0075367_100063292 801
434 3300006948 Ga0099826_10032287 Ga0099826_100322872 801
435 3300010375 Ga0105239_10000065 Ga0105239_1000006537 801
436 3300021320 Ga0214544_1000584 Ga0214544_100058412 801
437 3300022740 Ga0228710_1011825 Ga0228710_101182511 801
438 3300025208 Ga0209436_100001 Ga0209436_100001288 801
439 3300025258 Ga0209129_1000821 Ga0209129_10008217 801
440 3300025273 Ga0209673_1000126 Ga0209673_100012680 801
441 3300025273 Ga0209673_1003461 Ga0209673_10034618 801
442 3300025284 Ga0209130_1000049 Ga0209130_1000049177 801
443 3300025292 Ga0209676_1002796 Ga0209676_10027967 801
444 3300025292 Ga0209676_1003351 Ga0209676_10033514 801
445 3300025294 Ga0209025_1001930 Ga0209025_100193012 801
446 3300025295 Ga0209564_1000354 Ga0209564_100035440 801
447 3300025295 Ga0209564_1000368 Ga0209564_10003682 801
448 3300025295 Ga0209564_1001053 Ga0209564_100105326 801
449 3300025297 Ga0209758_1001917 Ga0209758_100191710 801
450 3300025299 Ga0209256_1000999 Ga0209256_100099911 801
451 3300025299 Ga0209256_1010554 Ga0209256_10105544 801
452 3300025302 Ga0207426_1000043 Ga0207426_100004341 801
453 3300025302 Ga0207426_1001108 Ga0207426_100110813 801
454 3300025303 Ga0209051_1000132 Ga0209051_100013228 801
455 3300025303 Ga0209051_1000287 Ga0209051_100028756 801
456 3300025303 Ga0209051_1000895 Ga0209051_100089516 801
457 3300025304 Ga0209257_1000209 Ga0209257_1000209111 801
458 3300025304 Ga0209257_1001865 Ga0209257_100186516 801
459 3300025304 Ga0209257_1002393 Ga0209257_100239320 801
460 3300027111 Ga0209281_1000348 Ga0209281_100034869 801
461 3300027312 Ga0209371_1000251 Ga0209371_100025116 801
462 3300027666 Ga0209282_1000070 Ga0209282_10000706 801
463 3300031731 Ga0307405_10001720 Ga0307405_100017206 801
464 3300031967 Ga0315914_1000082 Ga0315914_10000828 801
465 3300033430 Ga0315913_1000028 Ga0315913_10000288 801
466 3300033464 Ga0315915_1000004 Ga0315915_10000048 801
467 3300041413 Ga0439465_0000118 Ga0439465_0000118_7194_9626 801
468 3300041512 Ga0451853_1755455 Ga0451853_1755455_1597_4053 801
469 3300046460 Ga0495638_0000077 Ga0495638_0000077_99195_101654 801
470 3300046460 Ga0495638_0007091 Ga0495638_0007091_537_2996 801
471 3300046512 Ga0495610_0005827 Ga0495610_0005827_5874_8330 801
472 3300046515 Ga0495620_0001213 Ga0495620_0001213_3149_5599 801
473 3300046519 Ga0495632_0000423 Ga0495632_0000423_25112_27565 801
474 3300048919 Ga0496116_0000601 Ga0496116_0000601_7318_9774 801
475 3300048919 Ga0496116_0001726 Ga0496116_0001726_9725_12181 801
476 3300048920 Ga0496117_0002417 Ga0496117_0002417_9815_12271 801
477 3300048922 Ga0496119_0001142 Ga0496119_0001142_20295_22757 801
478 3300048922 Ga0496119_0013427 Ga0496119_0013427_1382_3850 801
479 3300048923 Ga0496120_0003528 Ga0496120_0003528_2743_5205 801
480 3300048925 Ga0496122_0010254 Ga0496122_0010254_5760_8216 801
481 3300048925 Ga0496122_0010619 Ga0496122_0010619_1214_3670 801
482 3300048926 Ga0496123_0002390 Ga0496123_0002390_8488_10944 801
483 3300048926 Ga0496123_0012233 Ga0496123_0012233_1390_3846 801
484 3300048927 Ga0496124_0020377 Ga0496124_0020377_3298_5754 801
485 3300048928 Ga0496125_0000182 Ga0496125_0000182_10792_13248 801
486 3300048929 Ga0496126_0000522 Ga0496126_0000522_7059_9521 801
487 3300048929 Ga0496126_0001273 Ga0496126_0001273_13627_16083 801
488 3300049570 Ga0501033_0000054 Ga0501033_0000054_74135_76591 801
489 3300049822 Ga0501035_0001626 Ga0501035_0001626_14681_17137 801
490 3300053125 Ga0500618_000097 Ga0500618_000097_29557_32022 801
491 3300053153 Ga0500616_0000438 Ga0500616_0000438_43811_46267 801
492 3300053177 Ga0500636_0000231 Ga0500636_0000231_15717_18185 801

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03135

CagE_TrbE_VirB

CagE, TrbE, VirB family, component of type IV transporter system

184

400

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4kfu-assembly2.cif.gz_B structure of the genome packaging ntpase b204 from sulfolobus turreted icosahedral virus 2 in complex with amppcp 0.7701 445 737
4ag5-assembly1.cif.gz_A structure of virb4 of thermoanaerobacter pseudethanolicus 0.746 448 737
4ag6-assembly1.cif.gz_A structure of virb4 of thermoanaerobacter pseudethanolicus 0.7355 448 737
4kfs-assembly1.cif.gz_A structure of the genome packaging ntpase b204 from sulfolobus turreted icosahedral virus 2 in complex with amp 0.7308 447 737
4kfu-assembly4.cif.gz_D structure of the genome packaging ntpase b204 from sulfolobus turreted icosahedral virus 2 in complex with amppcp 0.7278 447 737
ID Description Score Start End Superfamily
af_A0A1D6LJU6_526_656_3.30.70.270 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Reverse transcriptase/Diguanylate cyclase domain 0.8639 337 369 3.30.70.270
4kftA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7653 444 737 3.40.50.300
4ag6B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7271 448 737 3.40.50.300
af_O43933_580_729_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7202 625 683 3.40.50.300
4kftA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6879 444 737 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A531KBS0-F1-model_v4 deleted 0.952 441 703
AF-A0A560D4K9-F1-model_v4 Type IV secretion system protein VirB4 0.9514 466 680
AF-J1JEJ9-F1-model_v4 TraG P-loop domain-containing protein 0.9447 491 663
AF-A0A4V6QSG7-F1-model_v4 deleted 0.9339 538 736
AF-A0A531KBS0-F1-model_v4 deleted 0.9313 441 703

Feature Viewer

pLDDT pTM Quality
66.98 0.52 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map