F454207

General Info

Members Datasets Scaffolds Average Seq Length
492 301 984 152

Family's Representative Sequence

Representative Sequence 3300003322|rootL2_10011040|rootL2_100110402
Length 150
Sequence MSKRLDYAQIAPAGVKALGGVYGYVMQSDLSPVLVDLVYLRVSQINCAYCLDMHTRDLLKKGVKIEKLALVQAWREGGDLFDLRERAALAWAESVTLVAQTGVPDAAYEVVCAVFNERELVDLTIAISLMNTYNRMAISFRNTPQAVMET

Samples

Sample ID Description Type Environment
1 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
14 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
15 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
16 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
17 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
18 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
19 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
20 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
21 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
22 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
23 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
24 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
25 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
45 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
46 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
47 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
48 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
49 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
50 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
56 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
57 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
83 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
84 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
92 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
95 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
96 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
97 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
100 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
103 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
105 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
107 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
134 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
135 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
136 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
139 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
140 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
141 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
142 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
143 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
144 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
145 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
146 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
147 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
148 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
149 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
150 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
151 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
152 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
153 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
154 3300044671 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E Metagenome Unclassified
155 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
156 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
157 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
158 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
159 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
160 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
161 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
162 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
163 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
164 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
165 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
166 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
167 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
168 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
169 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
170 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
171 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
172 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
173 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
174 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
175 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
176 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
177 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
178 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
179 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
180 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
181 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
182 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
183 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
184 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
185 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
186 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
187 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
188 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
189 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
190 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
191 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
192 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
193 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
194 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
195 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
196 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
197 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
198 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
199 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
200 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
201 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
202 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
203 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
204 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
205 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
206 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
207 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
208 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
209 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
210 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
211 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
212 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
213 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
214 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
215 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
216 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
217 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
218 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
219 3300048986 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1E Metagenome Unclassified
220 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
223 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
224 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
225 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
226 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
227 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
228 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
229 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
230 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
231 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
232 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
233 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
234 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
235 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
236 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
237 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
238 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
239 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
240 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
241 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
242 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
243 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
244 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
245 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
246 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
247 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
248 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
249 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
250 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
251 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
252 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
253 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
254 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
255 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
256 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
257 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
258 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
259 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
260 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
261 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
262 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
263 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
264 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
265 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
266 2904456579 Variovorax sp. 2002 Isolate Unclassified
267 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
268 2904699407
269 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
270 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
271 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
272 2922368715
273 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
274 2928163908 Burkholderia sp. 567 Isolate Unclassified
275 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
276 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
277 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
278 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
279 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
280 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
281 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
282 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
283 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
284 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
285 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
286 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
287 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
288 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
289 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
290 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
291 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
292 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
293 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
294 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
295 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
296 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
297 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
298 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
299 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
300 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
301 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 88.98
Metatranscriptomes 0.2
Isolates 10.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.11
Nodule 6.3
Rhizoplane 6.71
Rhizosphere 54.67
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10011040 3300003322 Bacteria 5844
2 JGI24736J21556_1022104 3300001904 Bacteria 996
3 JGI24740J21852_10008702 3300001979 Bacteria 4030
4 JGI24739J22299_10008800 3300001989 Bacteria 3764
5 JGI24737J22298_10003287 3300001990 Bacteria 5728
6 JGI24735J21928_10000488 3300002067 Bacteria 14019
7 JGI24735J21928_10008468 3300002067 Bacteria 3323
8 JGI24735J21928_10088720 3300002067 Bacteria 886
9 JGI24738J21930_10094282 3300002075 Bacteria 635
10 JGI25156J39149_1001846 3300002705 Bacteria 8295
11 JGI25165J46597_1001452 3300003214 Bacteria 12481
12 JGI25153J46596_10008573 3300003215 Bacteria 4871
13 rootH2_10080586 3300003320 Bacteria 1853
14 JGI25160J50197_1000939 3300003354 Bacteria 15302
15 Ga0006562J51391_1024813 3300003578 Bacteria 7275
16 Ga0055533_1000094 3300003756 Bacteria 115741
17 Ga0055532_1000003 3300003758 Bacteria 494004
18 Ga0055525_1007388 3300003759 Bacteria 928
19 Ga0055527_1000006 3300003760 Bacteria 494004
20 Ga0055535_1000003 3300003761 Bacteria 494004
21 Ga0055542_1000007 3300003762 Bacteria 494004
22 Ga0055529_1000003 3300003763 Bacteria 494004
23 Ga0055526_1013980 3300003771 Bacteria 3344
24 Ga0055526_1052121 3300003771 Bacteria 925
25 Ga0055526_1071499 3300003771 Bacteria 702
26 Ga0055524_1006165 3300003775 Bacteria 5236
27 Ga0055540_1000585 3300003792 Bacteria 26563
28 Ga0055531_10000152 3300003794 Bacteria 80208
29 Ga0055531_10010581 3300003794 Bacteria 4563
30 Ga0065165_1001785 3300005262 Bacteria 21254
31 Ga0065165_1079731 3300005262 Bacteria 852
32 Ga0070658_10222265 3300005327 Bacteria 1597
33 Ga0070660_100000049 3300005339 Bacteria 69269
34 Ga0070660_100011415 3300005339 Bacteria 6309
35 Ga0070661_100122310 3300005344 Bacteria 1950
36 Ga0070668_100203087 3300005347 Bacteria 1628
37 Ga0070659_100000085 3300005366 Bacteria 70518
38 Ga0070667_100333030 3300005367 Bacteria 1372
39 Ga0070663_100110064 3300005455 Bacteria 2069
40 Ga0068867_100352704 3300005459 Bacteria 1228
41 Ga0070684_100596319 3300005535 Bacteria 1027
42 Ga0070672_100376205 3300005543 Bacteria 1214
43 Ga0068855_100002443 3300005563 Bacteria 22946
44 Ga0068855_100003969 3300005563 Bacteria 18068
45 Ga0068855_100026293 3300005563 Bacteria 6963
46 Ga0068855_100054635 3300005563 Bacteria 4693
47 Ga0070664_100047962 3300005564 Bacteria 3610
48 Ga0068857_100003481 3300005577 Bacteria 13143
49 Ga0068854_100000387 3300005578 Bacteria 27608
50 Ga0068854_100001064 3300005578 Bacteria 16495
51 Ga0068854_100265088 3300005578 Bacteria 1377
52 Ga0068854_100909112 3300005578 Bacteria 774
53 Ga0068856_100276689 3300005614 Bacteria 1695
54 Ga0068856_100299429 3300005614 Bacteria 1626
55 Ga0068852_100558119 3300005616 Bacteria 1146
56 Ga0068859_100223640 3300005617 Bacteria 1970
57 Ga0068859_101432584 3300005617 Bacteria 762
58 Ga0068858_100016666 3300005842 Bacteria 6900
59 Ga0068858_100085823 3300005842 Bacteria 2929
60 Ga0068858_100916047 3300005842 Bacteria 857
61 Ga0081540_1061194 3300005983 Bacteria 1796
62 Ga0075365_10031363 3300006038 Bacteria 3410
63 Ga0075365_10103314 3300006038 Bacteria 1953
64 Ga0075368_10047766 3300006042 Bacteria 1695
65 Ga0075368_10306725 3300006042 Bacteria 686
66 Ga0075363_100232963 3300006048 Bacteria 1058
67 Ga0075364_10438235 3300006051 Bacteria 892
68 Ga0075367_10015169 3300006178 Bacteria 4182
69 Ga0075369_10113458 3300006186 Bacteria 1222
70 Ga0075369_10164158 3300006186 Bacteria 1018
71 Ga0075366_10220777 3300006195 Bacteria 1155
72 Ga0075366_11076451 3300006195 Bacteria 502
73 Ga0075370_10050795 3300006353 Bacteria 2352
74 Ga0075370_10057315 3300006353 Bacteria 2214
75 Ga0075370_10499844 3300006353 Bacteria 734
76 Ga0075428_101031703 3300006844 Bacteria 870
77 Ga0097620_100223654 3300006931 Bacteria 1970
78 Ga0097620_101432775 3300006931 Bacteria 762
79 Ga0105251_10005911 3300009011 Bacteria 7911
80 Ga0105244_10209586 3300009036 Bacteria 917
81 Ga0105250_10088062 3300009092 Bacteria 1261
82 Ga0105240_10004138 3300009093 Bacteria 22226
83 Ga0105240_10011960 3300009093 Bacteria 12028
84 Ga0105240_10044486 3300009093 Bacteria 5641
85 Ga0105240_10192535 3300009093 Bacteria 2397
86 Ga0105240_10297901 3300009093 Bacteria 1846
87 Ga0111539_10930979 3300009094 Bacteria 1011
88 Ga0105245_10760714 3300009098 Bacteria 1005
89 Ga0105247_10047329 3300009101 Bacteria 2640
90 Ga0105243_10035648 3300009148 Bacteria 3858
91 Ga0105241_10170389 3300009174 Bacteria 1798
92 Ga0105241_10281636 3300009174 Bacteria 1420
93 Ga0105241_10637564 3300009174 Bacteria 966
94 Ga0105248_10003289 3300009177 Bacteria 17935
95 Ga0105237_10001725 3300009545 Bacteria 28243
96 Ga0105237_10005341 3300009545 Bacteria 14534
97 Ga0105237_10139720 3300009545 Bacteria 2416
98 Ga0105238_10150727 3300009551 Bacteria 2301
99 Ga0105238_10796072 3300009551 Bacteria 961
100 Ga0105249_10876237 3300009553 Bacteria 964
101 Ga0105239_10000892 3300010375 Bacteria 42342
102 Ga0105239_10324382 3300010375 Bacteria 1737
103 Ga0105239_10655088 3300010375 Bacteria 1199
104 Ga0105239_10766523 3300010375 Bacteria 1105
105 Ga0105246_10215031 3300011119 Bacteria 1503
106 Ga0157314_1000087 3300012500 Bacteria 9668
107 Ga0157373_10000726 3300013100 Bacteria 25755
108 Ga0157370_10009772 3300013104 Bacteria 10176
109 Ga0157370_10534346 3300013104 Bacteria 1075
110 Ga0157370_10612369 3300013104 Bacteria 997
111 Ga0157370_10995786 3300013104 Bacteria 759
112 Ga0157369_10024117 3300013105 Bacteria 6770
113 Ga0157369_10776474 3300013105 Bacteria 985
114 Ga0157374_10000050 3300013296 Bacteria 132127
115 Ga0157374_10580428 3300013296 Bacteria 1130
116 Ga0163162_10212272 3300013306 Bacteria 2066
117 Ga0157372_10007801 3300013307 Bacteria 11370
118 Ga0157372_10322975 3300013307 Bacteria 1797
119 Ga0163163_10073410 3300014325 Bacteria 3412
120 Ga0157380_11352094 3300014326 Bacteria 761
121 Ga0182008_10083098 3300014497 Bacteria 1577
122 Ga0182008_10519626 3300014497 Bacteria 657
123 Ga0157377_10845185 3300014745 Bacteria 679
124 Ga0157379_10788489 3300014968 Bacteria 896
125 Ga0182006_1021114 3300015261 Bacteria 2719
126 Ga0182006_1114238 3300015261 Bacteria 945
127 Ga0182006_1165793 3300015261 Bacteria 742
128 Ga0182006_1221833 3300015261 Bacteria 623
129 Ga0182007_10255229 3300015262 Bacteria 630
130 Ga0182005_1005237 3300015265 Bacteria 4069
131 Ga0163161_10000927 3300017792 Bacteria 22658
132 Ga0209566_104847 3300025225 Bacteria 1769
133 Ga0209674_100025 3300025226 Bacteria 515942
134 Ga0209672_100002 3300025228 Bacteria 1733325
135 Ga0209672_100104 3300025228 Bacteria 103234
136 Ga0209147_100003 3300025229 Bacteria 1733325
137 Ga0209563_100987 3300025230 Bacteria 8335
138 Ga0207427_100527 3300025231 Bacteria 19899
139 Ga0209258_100005 3300025242 Bacteria 1087938
140 Ga0209148_1000006 3300025254 Bacteria 1733325
141 Ga0209759_1000014 3300025256 Bacteria 396291
142 Ga0209759_1001879 3300025256 Bacteria 10415
143 Ga0209129_1007663 3300025258 Bacteria 3154
144 Ga0209233_1000018 3300025261 Bacteria 886857
145 Ga0209455_1000003 3300025272 Bacteria 1471893
146 Ga0209673_1022290 3300025273 Bacteria 2189
147 Ga0209673_1059231 3300025273 Bacteria 965
148 Ga0209130_1003933 3300025284 Bacteria 5949
149 Ga0209675_1020451 3300025291 Bacteria 1793
150 Ga0209676_1001918 3300025292 Bacteria 16835
151 Ga0209025_1020317 3300025294 Bacteria 3639
152 Ga0209025_1036536 3300025294 Bacteria 2198
153 Ga0209564_1002754 3300025295 Bacteria 13209
154 Ga0209564_1006901 3300025295 Bacteria 5979
155 Ga0209564_1013904 3300025295 Bacteria 3383
156 Ga0209758_1001258 3300025297 Bacteria 31388
157 Ga0209758_1001375 3300025297 Bacteria 29007
158 Ga0209758_1010715 3300025297 Bacteria 5440
159 Ga0209758_1012901 3300025297 Bacteria 4619
160 Ga0209758_1032098 3300025297 Bacteria 2139
161 Ga0209758_1033865 3300025297 Bacteria 2043
162 Ga0209256_1021470 3300025299 Bacteria 1980
163 Ga0207426_1000577 3300025302 Bacteria 49128
164 Ga0207426_1002334 3300025302 Bacteria 12396
165 Ga0207426_1005842 3300025302 Bacteria 5497
166 Ga0209051_1000059 3300025303 Bacteria 260307
167 Ga0209257_1000022 3300025304 Bacteria 765258
168 Ga0209257_1048101 3300025304 Bacteria 1222
169 Ga0209257_1124696 3300025304 Bacteria 598
170 Ga0207713_1137738 3300025735 Bacteria 800
171 Ga0207680_10456059 3300025903 Bacteria 908
172 Ga0207647_10000819 3300025904 Bacteria 24170
173 Ga0207647_10003908 3300025904 Bacteria 11130
174 Ga0207647_10106684 3300025904 Bacteria 1658
175 Ga0207647_10140744 3300025904 Bacteria 1414
176 Ga0207705_10021815 3300025909 Bacteria 4569
177 Ga0207654_10225259 3300025911 Bacteria 1246
178 Ga0207695_10000901 3300025913 Bacteria 53440
179 Ga0207695_10010746 3300025913 Bacteria 11170
180 Ga0207695_10069510 3300025913 Bacteria 3603
181 Ga0207695_10191663 3300025913 Bacteria 1962
182 Ga0207695_10274059 3300025913 Bacteria 1582
183 Ga0207671_10000011 3300025914 Bacteria 530349
184 Ga0207671_10020603 3300025914 Bacteria 5016
185 Ga0207671_10250025 3300025914 Bacteria 1394
186 Ga0207657_10000593 3300025919 Bacteria 38361
187 Ga0207657_10012713 3300025919 Bacteria 8292
188 Ga0207649_10806646 3300025920 Bacteria 733
189 Ga0207690_10000097 3300025932 Bacteria 71940
190 Ga0207709_10026557 3300025935 Bacteria 3327
191 Ga0207711_10020061 3300025941 Bacteria 5571
192 Ga0207667_10000249 3300025949 Bacteria 75885
193 Ga0207667_10000753 3300025949 Bacteria 42040
194 Ga0207667_10081548 3300025949 Bacteria 3351
195 Ga0207667_10110938 3300025949 Bacteria 2829
196 Ga0207667_10380499 3300025949 Bacteria 1438
197 Ga0207712_10580002 3300025961 Bacteria 968
198 Ga0207640_10000414 3300025981 Bacteria 26873
199 Ga0207640_10004511 3300025981 Bacteria 7555
200 Ga0207640_10456195 3300025981 Bacteria 1055
201 Ga0207658_10299090 3300025986 Bacteria 1386
202 Ga0207677_10866808 3300026023 Bacteria 812
203 Ga0207703_10012844 3300026035 Bacteria 6531
204 Ga0207703_10103286 3300026035 Bacteria 2419
205 Ga0207703_10841540 3300026035 Bacteria 877
206 Ga0207678_10002389 3300026067 Bacteria 17042
207 Ga0207678_10037743 3300026067 Bacteria 4201
208 Ga0207702_10138819 3300026078 Bacteria 2197
209 Ga0207702_10179488 3300026078 Bacteria 1949
210 Ga0207702_10188996 3300026078 Bacteria 1901
211 Ga0207648_10242267 3300026089 Bacteria 1606
212 Ga0207674_10002329 3300026116 Bacteria 24047
213 Ga0207674_10317313 3300026116 Bacteria 1508
214 Ga0207674_10488421 3300026116 Bacteria 1190
215 Ga0207683_10341219 3300026121 Bacteria 1374
216 Ga0207698_10056896 3300026142 Bacteria 3022
217 Ga0207698_10232956 3300026142 Bacteria 1673
218 Ga0207698_10524507 3300026142 Bacteria 1156
219 Ga0207698_10660958 3300026142 Bacteria 1036
220 Ga0209813_10168239 3300027866 Bacteria 795
221 Ga0307513_10119032 3300031456 Bacteria 2613
222 Ga0307408_100061612 3300031548 Bacteria 2739
223 Ga0307408_101131872 3300031548 Bacteria 727
224 Ga0307405_10466853 3300031731 Bacteria 1004
225 Ga0307416_100341614 3300032002 Bacteria 1510
226 Ga0307510_10153597 3300033180 Bacteria 1914
227 Ga0395899_0003001 3300037312 Bacteria 13486
228 Ga0395899_0059890 3300037312 Bacteria 2806
229 Ga0395899_0189553 3300037312 Bacteria 1439
230 Ga0395900_0045029 3300037418 Bacteria 4545
231 Ga0395900_0055075 3300037418 Bacteria 4094
232 Ga0395900_0096478 3300037418 Bacteria 3038
233 Ga0395900_0250044 3300037418 Bacteria 1774
234 Ga0395898_0000254 3300037466 Bacteria 131247
235 Ga0395898_0018936 3300037466 Bacteria 7014
236 Ga0395898_0020552 3300037466 Bacteria 6706
237 Ga0395898_0098290 3300037466 Bacteria 2810
238 Ga0395898_0107033 3300037466 Bacteria 2681
239 Ga0395898_0937651 3300037466 Bacteria 803
240 Ga0395898_1420171 3300037466 Bacteria 621
241 Ga0395905_0000043 3300037471 Bacteria 247469
242 Ga0395905_0000121 3300037471 Bacteria 130731
243 Ga0395905_0002866 3300037471 Bacteria 18828
244 Ga0395905_0018878 3300037471 Bacteria 6540
245 Ga0395905_0117080 3300037471 Bacteria 2504
246 Ga0395905_0133085 3300037471 Bacteria 2339
247 Ga0395905_1235491 3300037471 Bacteria 651
248 Ga0395901_0000009 3300038443 Bacteria 479396
249 Ga0395901_0001288 3300038443 Bacteria 26499
250 Ga0395901_0013930 3300038443 Bacteria 8183
251 Ga0395901_0150680 3300038443 Bacteria 2444
252 Ga0395901_0264502 3300038443 Bacteria 1789
253 Ga0395901_0515970 3300038443 Bacteria 1215
254 Ga0439436_0013874 3300041404 Bacteria 2435
255 Ga0439465_0034252 3300041413 Bacteria 1625
256 Ga0451802_0657324 3300041460 Bacteria 1086
257 Ga0439448_0000175 3300042005 Bacteria 12937
258 Ga0439449_0044461 3300042007 Bacteria 1647
259 Ga0439452_007012 3300042010 Bacteria 3480
260 Ga0439446_0017539 3300042156 Bacteria 2002
261 Ga0466969_0058244 3300044656 Bacteria 1881
262 Ga0466972_0012098 3300044658 Bacteria 4335
263 Ga0466972_0283254 3300044658 Bacteria 774
264 Ga0466972_0373108 3300044658 Bacteria 668
265 Ga0466981_0292268 3300044669 Bacteria 1028
266 Ga0466978_0057944 3300044671 Bacteria 2416
267 Ga0466982_0049260 3300044672 Bacteria 2573
268 Ga0466965_0099032 3300044683 Bacteria 1489
269 Ga0466966_0000143 3300044684 Bacteria 45651
270 Ga0466966_0009683 3300044684 Bacteria 6382
271 Ga0466961_0000370 3300044693 Bacteria 29075
272 Ga0466961_0002555 3300044693 Bacteria 11270
273 Ga0466961_0013660 3300044693 Bacteria 5203
274 Ga0466963_0010324 3300044694 Bacteria 5652
275 Ga0466963_0100915 3300044694 Bacteria 1975
276 Ga0466963_0204895 3300044694 Bacteria 1380
277 Ga0466964_0060483 3300044706 Bacteria 1575
278 Ga0466964_0727179 3300044706 Bacteria 555
279 Ga0466971_0011281 3300044719 Bacteria 3915
280 Ga0466971_0047771 3300044719 Bacteria 1924
281 Ga0466971_0073019 3300044719 Bacteria 1559
282 Ga0466968_0041065 3300044735 Bacteria 1952
283 Ga0466968_0699102 3300044735 Bacteria 517
284 Ga0466970_0003006 3300044765 Bacteria 8177
285 Ga0466970_0063911 3300044765 Bacteria 1973
286 Ga0466970_0083130 3300044765 Bacteria 1732
287 Ga0466970_0469623 3300044765 Bacteria 722
288 Ga0466957_0015976 3300044842 Bacteria 4386
289 Ga0466957_0033636 3300044842 Bacteria 3076
290 Ga0466957_0083613 3300044842 Bacteria 1992
291 Ga0466957_0117288 3300044842 Bacteria 1694
292 Ga0466960_0029957 3300044901 Bacteria 2501
293 Ga0466960_0071553 3300044901 Bacteria 1727
294 Ga0466959_0014115 3300045049 Bacteria 5796
295 Ga0466959_0041759 3300045049 Bacteria 3385
296 Ga0466958_0000374 3300045836 Bacteria 18172
297 Ga0466958_0007738 3300045836 Bacteria 5928
298 Ga0466958_0023350 3300045836 Bacteria 3630
299 Ga0466958_0106787 3300045836 Bacteria 1746
300 Ga0466958_0325974 3300045836 Bacteria 987
301 Ga0466958_0402402 3300045836 Bacteria 884
302 Ga0466967_0007347 3300045976 Bacteria 7935
303 Ga0495590_0019029 3300046457 Bacteria 2451
304 Ga0495580_0000995 3300046472 Bacteria 24907
305 Ga0495580_0610769 3300046472 Bacteria 720
306 Ga0495605_0080985 3300046474 Bacteria 1519
307 Ga0495584_0429552 3300046491 Bacteria 672
308 Ga0495606_0150881 3300046507 Bacteria 1364
309 Ga0495610_0298081 3300046512 Bacteria 622
310 Ga0495616_0208341 3300046513 Bacteria 856
311 Ga0495628_0683052 3300046516 Bacteria 726
312 Ga0495648_0091759 3300046524 Bacteria 1698
313 Ga0495654_0075964 3300046530 Bacteria 1584
314 Ga0495668_0091090 3300046616 Bacteria 1671
315 Ga0495625_0183373 3300046660 Bacteria 1390
316 Ga0495625_0289161 3300046660 Bacteria 1052
317 Ga0495625_0354752 3300046660 Bacteria 926
318 Ga0495661_0067087 3300046665 Bacteria 2109
319 Ga0495588_0055307 3300046674 Bacteria 2048
320 Ga0495646_0030566 3300046680 Bacteria 3363
321 Ga0495649_0047816 3300046694 Bacteria 2326
322 Ga0495660_0179028 3300046810 Bacteria 1027
323 Ga0495674_0035145 3300047319 Bacteria 4524
324 Ga0495680_0388737 3300047322 Bacteria 965
325 Ga0495687_002927 3300047443 Bacteria 12984
326 Ga0495687_003483 3300047443 Bacteria 11358
327 Ga0495687_149635 3300047443 Bacteria 800
328 Ga0495675_0441789 3300047444 Bacteria 753
329 Ga0495673_0045476 3300047469 Bacteria 1951
330 Ga0495686_0032571 3300047472 Bacteria 3373
331 Ga0495686_0070431 3300047472 Bacteria 2155
332 Ga0495602_0003875 3300048088 Bacteria 15570
333 Ga0495602_0611332 3300048088 Bacteria 748
334 Ga0496100_0034519 3300048903 Bacteria 3175
335 Ga0496100_0099847 3300048903 Bacteria 1998
336 Ga0496101_0026741 3300048904 Bacteria 4012
337 Ga0496101_0048226 3300048904 Bacteria 3060
338 Ga0496101_0145649 3300048904 Bacteria 1809
339 Ga0496102_0001560 3300048905 Bacteria 20225
340 Ga0496102_0100460 3300048905 Bacteria 2687
341 Ga0496103_0006627 3300048906 Bacteria 6909
342 Ga0496103_0210712 3300048906 Bacteria 1250
343 Ga0496104_0021477 3300048907 Bacteria 5926
344 Ga0496104_0085733 3300048907 Bacteria 3006
345 Ga0496104_0086734 3300048907 Bacteria 2988
346 Ga0496104_0208818 3300048907 Bacteria 1864
347 Ga0496105_0045689 3300048908 Bacteria 3614
348 Ga0496105_0355376 3300048908 Bacteria 1169
349 Ga0496105_0462602 3300048908 Bacteria 1000
350 Ga0496106_0062578 3300048909 Bacteria 2826
351 Ga0496106_0334558 3300048909 Bacteria 1216
352 Ga0496107_0033674 3300048910 Bacteria 3667
353 Ga0496107_0610044 3300048910 Bacteria 806
354 Ga0496108_0192467 3300048911 Bacteria 1768
355 Ga0496108_0607058 3300048911 Bacteria 953
356 Ga0496109_0044432 3300048912 Bacteria 4031
357 Ga0496110_0002240 3300048913 Bacteria 14461
358 Ga0496110_0862327 3300048913 Bacteria 811
359 Ga0496111_0239928 3300048914 Bacteria 1346
360 Ga0496112_0013175 3300048915 Bacteria 7630
361 Ga0496112_0042191 3300048915 Bacteria 4463
362 Ga0496113_0443020 3300048916 Bacteria 1043
363 Ga0496113_0548288 3300048916 Bacteria 927
364 Ga0496114_0207356 3300048917 Bacteria 1718
365 Ga0496115_0402720 3300048918 Bacteria 1110
366 Ga0496116_0017603 3300048919 Bacteria 5538
367 Ga0496116_0292194 3300048919 Bacteria 781
368 Ga0496117_0037909 3300048920 Bacteria 3584
369 Ga0496117_0086360 3300048920 Bacteria 2038
370 Ga0496117_0123995 3300048920 Bacteria 1581
371 Ga0496117_0460982 3300048920 Bacteria 626
372 Ga0496118_0013055 3300048921 Bacteria 7897
373 Ga0496118_0030237 3300048921 Bacteria 4524
374 Ga0496118_0087954 3300048921 Bacteria 2151
375 Ga0496118_0105539 3300048921 Bacteria 1888
376 Ga0496118_0171117 3300048921 Bacteria 1327
377 Ga0496118_0179468 3300048921 Bacteria 1281
378 Ga0496119_0032436 3300048922 Bacteria 3481
379 Ga0496119_0104812 3300048922 Bacteria 1581
380 Ga0496119_0144836 3300048922 Bacteria 1279
381 Ga0496120_0087444 3300048923 Bacteria 1673
382 Ga0496120_0129705 3300048923 Bacteria 1293
383 Ga0496121_0007399 3300048924 Bacteria 13268
384 Ga0496121_0025247 3300048924 Bacteria 5646
385 Ga0496121_0027874 3300048924 Bacteria 5275
386 Ga0496121_0046008 3300048924 Bacteria 3741
387 Ga0496121_0053978 3300048924 Bacteria 3362
388 Ga0496121_0074794 3300048924 Bacteria 2708
389 Ga0496121_0233011 3300048924 Bacteria 1288
390 Ga0496122_0108145 3300048925 Bacteria 1835
391 Ga0496122_0344246 3300048925 Bacteria 781
392 Ga0496123_0093994 3300048926 Bacteria 1769
393 Ga0496123_0208429 3300048926 Bacteria 995
394 Ga0496124_0210117 3300048927 Bacteria 1473
395 Ga0496124_0387327 3300048927 Bacteria 975
396 Ga0496125_0000239 3300048928 Bacteria 112926
397 Ga0496125_0006575 3300048928 Bacteria 12525
398 Ga0496125_0018397 3300048928 Bacteria 6637
399 Ga0496125_0351390 3300048928 Bacteria 880
400 Ga0466983_0405011 3300048986 Bacteria 984
401 Ga0501046_0827952 3300049580 Bacteria 648
402 Ga0501047_0054837 3300049581 Bacteria 3855
403 Ga0501072_0120962 3300049588 Bacteria 2086
404 Ga0501073_0061826 3300049589 Bacteria 2612
405 Ga0501076_0671485 3300049592 Bacteria 855
406 Ga0501079_0765903 3300049741 Bacteria 760
407 Ga0501080_0805925 3300049742 Bacteria 823
408 Ga0501044_0427216 3300049823 Bacteria 1234
409 nmdc:mga03683_198575_c1 3300050489 Bacteria 920
410 nmdc:mga03n38_151452_c1 3300050490 Bacteria 1167
411 nmdc:mga03n38_162379_c1 3300050490 Bacteria 1132
412 nmdc:mga03n38_469135_c1 3300050490 Bacteria 702
413 nmdc:mga00v17_364964_c1 3300050491 Bacteria 939
414 nmdc:mga0yw44_363799_c1 3300050492 Bacteria 975
415 nmdc:mga0yw44_69085_c1 3300050492 Bacteria 2187
416 nmdc:mga0k408_441876_c1 3300050493 Bacteria 773
417 nmdc:mga0k408_836478_c1 3300050493 Bacteria 535
418 nmdc:mga07m45_58233_c1 3300050496 Bacteria 2186
419 nmdc:mga07m45_7095_c1 3300050496 Bacteria 2322
420 nmdc:mga0sz30_77330_c1 3300050516 Bacteria 1437
421 Ga0500578_0122655 3300053086 Bacteria 1633
422 Ga0500651_0079124 3300053093 Bacteria 2038
423 Ga0500651_0616645 3300053093 Bacteria 587
424 Ga0500555_056708 3300053103 Bacteria 1061
425 Ga0500592_026862 3300053116 Bacteria 928
426 Ga0500642_0010904 3300053130 Bacteria 3227
427 Ga0500642_0056910 3300053130 Bacteria 1744
428 Ga0500577_0028095 3300053142 Bacteria 1935
429 Ga0500589_020645 3300053147 Bacteria 3013
430 Ga0500627_0002803 3300053158 Bacteria 5248
431 Ga0500611_043114 3300053727 Bacteria 1001
432 Ga0500596_001967 3300053735 Bacteria 4114
433 Ga0501082_0121994 3300060353 Bacteria 2259
434 Ga0466962_0005972 3300061719 Bacteria 5849
435 Ga0466962_0066763 3300061719 Bacteria 1717
436 Ga0466962_0086734 3300061719 Bacteria 1499
437 Ga0466962_0401413 3300061719 Bacteria 686
438 2509128277 2508501125 Bacteria 7208311
439 2513876504 2513237139 Bacteria 8737671
440 2513904739 2513237143 Bacteria 6664116
441 2524534104 2524023228 Bacteria 10118060
442 2528854826 2528768022 Bacteria 10457665
443 2805919783 2802429603 Bacteria 8777136
444 2824668702 2824661429 Bacteria 9877870
445 2824699169 2824696289 Bacteria 8335049
446 2824710694 2824704595 Bacteria 9667483
447 2824758542 2824753945 Bacteria 9787441
448 2824768281 2824763712 Bacteria 9792355
449 2824779097 2824773399 Bacteria 8360218
450 2840766686 2840764183 Bacteria 6358399
451 2847945909 2847939898 Bacteria 8606328
452 2879102543 2879099564 Bacteria 10442239
453 2885375978 2885374607 Bacteria 8927485
454 2900582658 2900577576 Bacteria 5438534
455 2903753795 2903748898 Bacteria 9972761
456 2904456508 2904449895 Bacteria 6927402
457 2904461490 2904456579 Bacteria 6819253
458 2904486798 2904483920 Bacteria 7545285
459 2904702128
460 2904717212 2904711408 Bacteria 9771557
461 2919528129 2919527303 Bacteria 7718827
462 2921214815 2921208531 Bacteria 6745326
463 2922373555
464 2928162353 2928157003 Bacteria 7522202
465 2928166222 2928163908 Bacteria 7561269
466 2932813148 2932809354 Bacteria 9135765
467 2932820938 2932818245 Bacteria 9955613
468 2935645588 2935638405 Bacteria 10015038
469 2935667706 2935665750 Bacteria 9571747
470 2935688452 2935684952 Bacteria 9590419
471 2935706546 2935703347 Bacteria 10242284
472 2935715471 2935713505 Bacteria 9608509
473 2935725965 2935722832 Bacteria 9608746
474 2935734290 2935732158 Bacteria 9706831
475 2935743669 2935741537 Bacteria 9707219
476 2935754294 2935750917 Bacteria 9590372
477 2935768345 2935760218 Bacteria 9817913
478 2935813079 2935810662 Bacteria 9401221
479 2935830732 2935827899 Bacteria 10038562
480 2935840759 2935837841 Bacteria 9454360
481 2936006588 2936002035 Bacteria 9362176
482 2936043631 2936037263 Bacteria 9446081
483 2940560330 2940556831 Bacteria 9590747
484 2941541110 2941538514 Bacteria 9402094
485 2945909694 2945909444 Bacteria 7065066
486 2990703861 2990703756 Bacteria 7715990
487 642415845 641736154 Bacteria 7689995
488 642598639 642555112 Bacteria 8676562
489 8006940180 8006933436 Bacteria 10410654
490 8006979961 8006973647 Bacteria 10679141
491 8039099632 8039098773 Bacteria 6602928
492 8055273788 8055266321 Bacteria 7999742
493 rootL2_10011040
494 JGI24736J21556_1022104
495 JGI24740J21852_10008702
496 JGI24739J22299_10008800
497 JGI24737J22298_10003287
498 JGI24735J21928_10000488
499 JGI24735J21928_10008468
500 JGI24735J21928_10088720
501 JGI24738J21930_10094282
502 JGI25156J39149_1001846
503 JGI25165J46597_1001452
504 JGI25153J46596_10008573
505 rootH2_10080586
506 JGI25160J50197_1000939
507 Ga0006562J51391_1024813
508 Ga0055533_1000094
509 Ga0055532_1000003
510 Ga0055525_1007388
511 Ga0055527_1000006
512 Ga0055535_1000003
513 Ga0055542_1000007
514 Ga0055529_1000003
515 Ga0055526_1013980
516 Ga0055526_1052121
517 Ga0055526_1071499
518 Ga0055524_1006165
519 Ga0055540_1000585
520 Ga0055531_10000152
521 Ga0055531_10010581
522 Ga0065165_1001785
523 Ga0065165_1079731
524 Ga0070658_10222265
525 Ga0070660_100000049
526 Ga0070660_100011415
527 Ga0070661_100122310
528 Ga0070668_100203087
529 Ga0070659_100000085
530 Ga0070667_100333030
531 Ga0070663_100110064
532 Ga0068867_100352704
533 Ga0070684_100596319
534 Ga0070672_100376205
535 Ga0068855_100002443
536 Ga0068855_100003969
537 Ga0068855_100026293
538 Ga0068855_100054635
539 Ga0070664_100047962
540 Ga0068857_100003481
541 Ga0068854_100000387
542 Ga0068854_100001064
543 Ga0068854_100265088
544 Ga0068854_100909112
545 Ga0068856_100276689
546 Ga0068856_100299429
547 Ga0068852_100558119
548 Ga0068859_100223640
549 Ga0068859_101432584
550 Ga0068858_100016666
551 Ga0068858_100085823
552 Ga0068858_100916047
553 Ga0081540_1061194
554 Ga0075365_10031363
555 Ga0075365_10103314
556 Ga0075368_10047766
557 Ga0075368_10306725
558 Ga0075363_100232963
559 Ga0075364_10438235
560 Ga0075367_10015169
561 Ga0075369_10113458
562 Ga0075369_10164158
563 Ga0075366_10220777
564 Ga0075366_11076451
565 Ga0075370_10050795
566 Ga0075370_10057315
567 Ga0075370_10499844
568 Ga0075428_101031703
569 Ga0097620_100223654
570 Ga0097620_101432775
571 Ga0105251_10005911
572 Ga0105244_10209586
573 Ga0105250_10088062
574 Ga0105240_10004138
575 Ga0105240_10011960
576 Ga0105240_10044486
577 Ga0105240_10192535
578 Ga0105240_10297901
579 Ga0111539_10930979
580 Ga0105245_10760714
581 Ga0105247_10047329
582 Ga0105243_10035648
583 Ga0105241_10170389
584 Ga0105241_10281636
585 Ga0105241_10637564
586 Ga0105248_10003289
587 Ga0105237_10001725
588 Ga0105237_10005341
589 Ga0105237_10139720
590 Ga0105238_10150727
591 Ga0105238_10796072
592 Ga0105249_10876237
593 Ga0105239_10000892
594 Ga0105239_10324382
595 Ga0105239_10655088
596 Ga0105239_10766523
597 Ga0105246_10215031
598 Ga0157314_1000087
599 Ga0157373_10000726
600 Ga0157370_10009772
601 Ga0157370_10534346
602 Ga0157370_10612369
603 Ga0157370_10995786
604 Ga0157369_10024117
605 Ga0157369_10776474
606 Ga0157374_10000050
607 Ga0157374_10580428
608 Ga0163162_10212272
609 Ga0157372_10007801
610 Ga0157372_10322975
611 Ga0163163_10073410
612 Ga0157380_11352094
613 Ga0182008_10083098
614 Ga0182008_10519626
615 Ga0157377_10845185
616 Ga0157379_10788489
617 Ga0182006_1021114
618 Ga0182006_1114238
619 Ga0182006_1165793
620 Ga0182006_1221833
621 Ga0182007_10255229
622 Ga0182005_1005237
623 Ga0163161_10000927
624 Ga0209566_104847
625 Ga0209674_100025
626 Ga0209672_100002
627 Ga0209672_100104
628 Ga0209147_100003
629 Ga0209563_100987
630 Ga0207427_100527
631 Ga0209258_100005
632 Ga0209148_1000006
633 Ga0209759_1000014
634 Ga0209759_1001879
635 Ga0209129_1007663
636 Ga0209233_1000018
637 Ga0209455_1000003
638 Ga0209673_1022290
639 Ga0209673_1059231
640 Ga0209130_1003933
641 Ga0209675_1020451
642 Ga0209676_1001918
643 Ga0209025_1020317
644 Ga0209025_1036536
645 Ga0209564_1002754
646 Ga0209564_1006901
647 Ga0209564_1013904
648 Ga0209758_1001258
649 Ga0209758_1001375
650 Ga0209758_1010715
651 Ga0209758_1012901
652 Ga0209758_1032098
653 Ga0209758_1033865
654 Ga0209256_1021470
655 Ga0207426_1000577
656 Ga0207426_1002334
657 Ga0207426_1005842
658 Ga0209051_1000059
659 Ga0209257_1000022
660 Ga0209257_1048101
661 Ga0209257_1124696
662 Ga0207713_1137738
663 Ga0207680_10456059
664 Ga0207647_10000819
665 Ga0207647_10003908
666 Ga0207647_10106684
667 Ga0207647_10140744
668 Ga0207705_10021815
669 Ga0207654_10225259
670 Ga0207695_10000901
671 Ga0207695_10010746
672 Ga0207695_10069510
673 Ga0207695_10191663
674 Ga0207695_10274059
675 Ga0207671_10000011
676 Ga0207671_10020603
677 Ga0207671_10250025
678 Ga0207657_10000593
679 Ga0207657_10012713
680 Ga0207649_10806646
681 Ga0207690_10000097
682 Ga0207709_10026557
683 Ga0207711_10020061
684 Ga0207667_10000249
685 Ga0207667_10000753
686 Ga0207667_10081548
687 Ga0207667_10110938
688 Ga0207667_10380499
689 Ga0207712_10580002
690 Ga0207640_10000414
691 Ga0207640_10004511
692 Ga0207640_10456195
693 Ga0207658_10299090
694 Ga0207677_10866808
695 Ga0207703_10012844
696 Ga0207703_10103286
697 Ga0207703_10841540
698 Ga0207678_10002389
699 Ga0207678_10037743
700 Ga0207702_10138819
701 Ga0207702_10179488
702 Ga0207702_10188996
703 Ga0207648_10242267
704 Ga0207674_10002329
705 Ga0207674_10317313
706 Ga0207674_10488421
707 Ga0207683_10341219
708 Ga0207698_10056896
709 Ga0207698_10232956
710 Ga0207698_10524507
711 Ga0207698_10660958
712 Ga0209813_10168239
713 Ga0307513_10119032
714 Ga0307408_100061612
715 Ga0307408_101131872
716 Ga0307405_10466853
717 Ga0307416_100341614
718 Ga0307510_10153597
719 Ga0395899_0003001
720 Ga0395899_0059890
721 Ga0395899_0189553
722 Ga0395900_0045029
723 Ga0395900_0055075
724 Ga0395900_0096478
725 Ga0395900_0250044
726 Ga0395898_0000254
727 Ga0395898_0018936
728 Ga0395898_0020552
729 Ga0395898_0098290
730 Ga0395898_0107033
731 Ga0395898_0937651
732 Ga0395898_1420171
733 Ga0395905_0000043
734 Ga0395905_0000121
735 Ga0395905_0002866
736 Ga0395905_0018878
737 Ga0395905_0117080
738 Ga0395905_0133085
739 Ga0395905_1235491
740 Ga0395901_0000009
741 Ga0395901_0001288
742 Ga0395901_0013930
743 Ga0395901_0150680
744 Ga0395901_0264502
745 Ga0395901_0515970
746 Ga0439436_0013874
747 Ga0439465_0034252
748 Ga0451802_0657324
749 Ga0439448_0000175
750 Ga0439449_0044461
751 Ga0439452_007012
752 Ga0439446_0017539
753 Ga0466969_0058244
754 Ga0466972_0012098
755 Ga0466972_0283254
756 Ga0466972_0373108
757 Ga0466981_0292268
758 Ga0466978_0057944
759 Ga0466982_0049260
760 Ga0466965_0099032
761 Ga0466966_0000143
762 Ga0466966_0009683
763 Ga0466961_0000370
764 Ga0466961_0002555
765 Ga0466961_0013660
766 Ga0466963_0010324
767 Ga0466963_0100915
768 Ga0466963_0204895
769 Ga0466964_0060483
770 Ga0466964_0727179
771 Ga0466971_0011281
772 Ga0466971_0047771
773 Ga0466971_0073019
774 Ga0466968_0041065
775 Ga0466968_0699102
776 Ga0466970_0003006
777 Ga0466970_0063911
778 Ga0466970_0083130
779 Ga0466970_0469623
780 Ga0466957_0015976
781 Ga0466957_0033636
782 Ga0466957_0083613
783 Ga0466957_0117288
784 Ga0466960_0029957
785 Ga0466960_0071553
786 Ga0466959_0014115
787 Ga0466959_0041759
788 Ga0466958_0000374
789 Ga0466958_0007738
790 Ga0466958_0023350
791 Ga0466958_0106787
792 Ga0466958_0325974
793 Ga0466958_0402402
794 Ga0466967_0007347
795 Ga0495590_0019029
796 Ga0495580_0000995
797 Ga0495580_0610769
798 Ga0495605_0080985
799 Ga0495584_0429552
800 Ga0495606_0150881
801 Ga0495610_0298081
802 Ga0495616_0208341
803 Ga0495628_0683052
804 Ga0495648_0091759
805 Ga0495654_0075964
806 Ga0495668_0091090
807 Ga0495625_0183373
808 Ga0495625_0289161
809 Ga0495625_0354752
810 Ga0495661_0067087
811 Ga0495588_0055307
812 Ga0495646_0030566
813 Ga0495649_0047816
814 Ga0495660_0179028
815 Ga0495674_0035145
816 Ga0495680_0388737
817 Ga0495687_002927
818 Ga0495687_003483
819 Ga0495687_149635
820 Ga0495675_0441789
821 Ga0495673_0045476
822 Ga0495686_0032571
823 Ga0495686_0070431
824 Ga0495602_0003875
825 Ga0495602_0611332
826 Ga0496100_0034519
827 Ga0496100_0099847
828 Ga0496101_0026741
829 Ga0496101_0048226
830 Ga0496101_0145649
831 Ga0496102_0001560
832 Ga0496102_0100460
833 Ga0496103_0006627
834 Ga0496103_0210712
835 Ga0496104_0021477
836 Ga0496104_0085733
837 Ga0496104_0086734
838 Ga0496104_0208818
839 Ga0496105_0045689
840 Ga0496105_0355376
841 Ga0496105_0462602
842 Ga0496106_0062578
843 Ga0496106_0334558
844 Ga0496107_0033674
845 Ga0496107_0610044
846 Ga0496108_0192467
847 Ga0496108_0607058
848 Ga0496109_0044432
849 Ga0496110_0002240
850 Ga0496110_0862327
851 Ga0496111_0239928
852 Ga0496112_0013175
853 Ga0496112_0042191
854 Ga0496113_0443020
855 Ga0496113_0548288
856 Ga0496114_0207356
857 Ga0496115_0402720
858 Ga0496116_0017603
859 Ga0496116_0292194
860 Ga0496117_0037909
861 Ga0496117_0086360
862 Ga0496117_0123995
863 Ga0496117_0460982
864 Ga0496118_0013055
865 Ga0496118_0030237
866 Ga0496118_0087954
867 Ga0496118_0105539
868 Ga0496118_0171117
869 Ga0496118_0179468
870 Ga0496119_0032436
871 Ga0496119_0104812
872 Ga0496119_0144836
873 Ga0496120_0087444
874 Ga0496120_0129705
875 Ga0496121_0007399
876 Ga0496121_0025247
877 Ga0496121_0027874
878 Ga0496121_0046008
879 Ga0496121_0053978
880 Ga0496121_0074794
881 Ga0496121_0233011
882 Ga0496122_0108145
883 Ga0496122_0344246
884 Ga0496123_0093994
885 Ga0496123_0208429
886 Ga0496124_0210117
887 Ga0496124_0387327
888 Ga0496125_0000239
889 Ga0496125_0006575
890 Ga0496125_0018397
891 Ga0496125_0351390
892 Ga0466983_0405011
893 Ga0501046_0827952
894 Ga0501047_0054837
895 Ga0501072_0120962
896 Ga0501073_0061826
897 Ga0501076_0671485
898 Ga0501079_0765903
899 Ga0501080_0805925
900 Ga0501044_0427216
901 nmdc:mga03683_198575_c1
902 nmdc:mga03n38_151452_c1
903 nmdc:mga03n38_162379_c1
904 nmdc:mga03n38_469135_c1
905 nmdc:mga00v17_364964_c1
906 nmdc:mga0yw44_363799_c1
907 nmdc:mga0yw44_69085_c1
908 nmdc:mga0k408_441876_c1
909 nmdc:mga0k408_836478_c1
910 nmdc:mga07m45_58233_c1
911 nmdc:mga07m45_7095_c1
912 nmdc:mga0sz30_77330_c1
913 Ga0500578_0122655
914 Ga0500651_0079124
915 Ga0500651_0616645
916 Ga0500555_056708
917 Ga0500592_026862
918 Ga0500642_0010904
919 Ga0500642_0056910
920 Ga0500577_0028095
921 Ga0500589_020645
922 Ga0500627_0002803
923 Ga0500611_043114
924 Ga0500596_001967
925 Ga0501082_0121994
926 Ga0466962_0005972
927 Ga0466962_0066763
928 Ga0466962_0086734
929 Ga0466962_0401413
930 2509128277
931 2513876504
932 2513904739
933 2524534104
934 2528854826
935 2805919783
936 2824668702
937 2824699169
938 2824710694
939 2824758542
940 2824768281
941 2824779097
942 2840766686
943 2847945909
944 2879102543
945 2885375978
946 2900582658
947 2903753795
948 2904456508
949 2904461490
950 2904486798
951 2904702128
952 2904717212
953 2919528129
954 2921214815
955 2922373555
956 2928162353
957 2928166222
958 2932813148
959 2932820938
960 2935645588
961 2935667706
962 2935688452
963 2935706546
964 2935715471
965 2935725965
966 2935734290
967 2935743669
968 2935754294
969 2935768345
970 2935813079
971 2935830732
972 2935840759
973 2936006588
974 2936043631
975 2940560330
976 2941541110
977 2945909694
978 2990703861
979 642415845
980 642598639
981 8006940180
982 8006979961
983 8039099632
984 8055273788

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02627

CMD

Carboxymuconolactone decarboxylase family

12

94

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
7xw1-assembly1.cif.gz_A the crystal structure of ahpd from pseudomonas aeruginosa 0.9628 10 141
2ijc-assembly2.cif.gz_I structure of a conserved protein of unknown function pa0269 from pseudomonas aeruginosa 0.9538 1 139
7xw1-assembly1.cif.gz_A the crystal structure of ahpd from pseudomonas aeruginosa 0.9419 10 141
2gmy-assembly1.cif.gz_C crystal structure of a protein of unknown function atu0492 from agrobacterium tumefaciens, putative antioxidant defence protein ahpd 0.9382 2 144
2gmy-assembly1.cif.gz_C crystal structure of a protein of unknown function atu0492 from agrobacterium tumefaciens, putative antioxidant defence protein ahpd 0.9077 2 144
ID Description Score Start End Superfamily
2ijcF00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9542 2 139 1.20.1290.10
2o4dA00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9478 2 139 1.20.1290.10
2gmyF00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9429 2 144 1.20.1290.10
af_Q2FVE0_2_139_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9338 6 142 1.20.1290.10
2ijcF00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.921 2 139 1.20.1290.10
ID Description Score Start End GO Terms
AF-A0A512N1X1-F1-model_v4 Alkyl hydroperoxide reductase AhpD 0.9846 16 145 GO:0051920
AF-A0A2V9JIF7-F1-model_v4 Carboxymuconolactone decarboxylase 0.9788 20 145 GO:0051920
AF-A0A2N3TBP8-F1-model_v4 AhpD family alkylhydroperoxidase 0.9777 4 139 GO:0051920
AF-A0A1E7RL96-F1-model_v4 Alkylhydroperoxidase 0.9775 4 137 GO:0051920
AF-A0A1J5SBA1-F1-model_v4 Alkyl hydroperoxide reductase AhpD (EC 1.11.1.15) 0.9756 7 138 GO:0051920

Map