F454170

General Info

Members Datasets Scaffolds Average Seq Length
491 229 468 315

Family's Representative Sequence

Representative Sequence 3300048928|Ga0496125_0003043|Ga0496125_0003043_6736_7815
Length 359
Sequence MSLNRYSGRAAAHYSFSSRLAGLASRPREPLLAVLIALXXLLVGLRAPAFLTMRSMDNLLTDSALPVMLALTQMLVIVTRGIDLSVASNLALSGMMSALLAMHFPQLPLGLVVACALCIGLGLGLINGWLIGYLSLPPIVVTLGSMSVYRGLVFVLSGGAWVSSRNMPADFIAFPLGRLMGLTHLVWLAALAIVVLWCVARHTRFGRDLYAIGNDPVAAGYVGIASPRRLFWTYGLSGAMAGLCGYLWVARYAVAYTEIAYGFELTVIAACVIGGISIAGGVGNISGAVLGALFLAVINNALPMVQISPFWQSALTGLVILSAVIINARGEKKRNKQILPLHYHTELKTDAARIARTPS

Samples

Sample ID Description Type Environment
1 2508501050 Microvirga lupini Lut6 Isolate Nodule
2 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
3 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
4 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
5 2643221556 Massilia sp. Root1485 Isolate Unclassified
6 2643221645 Massilia sp. Root351 Isolate Unclassified
7 2643221664 Massilia sp. Root418 Isolate Unclassified
8 2643221684 Massilia sp. Root133 Isolate Unclassified
9 2738541280 Massilia sp. GV090 Isolate Unclassified
10 2738541300 Massilia sp. GV016 Isolate Unclassified
11 2738543018 Massilia sp. GV045 Isolate Unclassified
12 2738543030 Massilia sp. GV097 Isolate Unclassified
13 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
14 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
15 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
16 2842711865 Duganella sp. R-73148 Isolate Unclassified
17 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
18 2857558681 Duganella sp. R-74565 Isolate Unclassified
19 2857564685 Duganella sp. R-74599 Isolate Unclassified
20 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
21 2904424332 Duganella sp. 1411 Isolate Rhizosphere
22 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
23 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
24 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
25 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
26 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
27 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
28 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
29 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
30 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
31 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
32 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
33 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
34 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
35 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
36 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
37 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
38 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
39 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
40 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
41 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
42 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
43 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
44 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
45 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
46 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
47 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
48 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
61 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
73 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
75 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
77 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
80 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
82 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
84 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
87 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
113 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
114 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
115 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
116 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
117 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
118 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
119 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
120 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
121 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
122 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
123 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
124 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
125 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
126 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
127 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
128 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
129 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
130 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
131 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
132 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
133 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
134 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
135 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
136 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
137 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
138 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
139 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
140 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
141 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
142 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
143 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
144 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
145 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
146 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
147 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
148 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
149 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
150 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
151 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
152 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
153 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
154 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
155 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
156 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
157 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
158 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
159 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
160 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
161 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
162 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
163 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
164 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
165 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
166 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
167 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
168 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
169 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
170 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
171 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
172 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
173 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
174 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
175 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
176 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
177 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
178 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
179 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
180 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
181 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
182 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
183 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
184 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
185 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
186 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
187 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
188 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
189 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
190 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
191 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
192 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
193 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
194 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
195 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
196 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
197 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
198 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
199 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
200 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
201 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
202 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
203 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
204 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
205 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
206 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
207 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
208 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
209 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
210 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
211 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
212 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
213 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
214 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
215 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
216 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
217 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
218 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
219 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
220 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
221 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
222 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
224 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
225 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
226 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
227 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
228 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
229 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.32
Metatranscriptomes 0
Isolates 4.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.2
Nodule 1.63
Rhizoplane 1.83
Rhizosphere 78.62
Stem 0
Stem Tuber 0
Unclassified 6.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1000604 3300002739 Bacteria 7145
2 JGI25150J39212_1004487 3300002774 Bacteria 3102
3 JGI25159J45721_1001322 3300002987 Bacteria 10453
4 JGI25151J46595_10028459 3300003187 Bacteria 2226
5 rootL2_10193562 3300003322 Bacteria 6175
6 Ga0055525_1000136 3300003759 Bacteria 107751
7 Ga0055542_1012188 3300003762 Bacteria 1496
8 Ga0055526_1009424 3300003771 Bacteria 4696
9 Ga0055526_1010383 3300003771 Bacteria 4339
10 Ga0055537_1000076 3300003773 Bacteria 70798
11 Ga0055537_1000260 3300003773 Bacteria 38657
12 Ga0055524_1000017 3300003775 Bacteria 235608
13 Ga0055524_1004143 3300003775 Bacteria 6789
14 Ga0055524_1006868 3300003775 Bacteria 4906
15 Ga0055534_1000124 3300003784 Bacteria 57565
16 Ga0055528_1000184 3300003790 Bacteria 52910
17 Ga0055528_1011001 3300003790 Bacteria 3630
18 Ga0055530_10004218 3300003791 Bacteria 7549
19 Ga0055530_10013500 3300003791 Bacteria 2784
20 Ga0055540_1021515 3300003792 Bacteria 1672
21 Ga0055531_10003399 3300003794 Bacteria 10167
22 Ga0055531_10026571 3300003794 Bacteria 2059
23 Ga0055543_1013959 3300004625 Bacteria 1574
24 Ga0065165_1000003 3300005262 Bacteria 390701
25 Ga0070658_10215097 3300005327 Bacteria 1624
26 Ga0070670_100000001 3300005331 Bacteria 728788
27 Ga0070666_10040383 3300005335 Bacteria 3114
28 Ga0070660_100006686 3300005339 Bacteria 8003
29 Ga0070668_100174502 3300005347 Bacteria 1752
30 Ga0070671_100000008 3300005355 Bacteria 207831
31 Ga0070688_100000584 3300005365 Bacteria 18368
32 Ga0070659_100184189 3300005366 Bacteria 1714
33 Ga0070667_100000023 3300005367 Bacteria 199687
34 Ga0070685_10000007 3300005466 Bacteria 180539
35 Ga0070665_100120415 3300005548 Bacteria 2626
36 Ga0068855_100000220 3300005563 Bacteria 72936
37 Ga0068855_100028617 3300005563 Bacteria 6667
38 Ga0068855_100029329 3300005563 Bacteria 6579
39 Ga0068859_100037676 3300005617 Bacteria 4853
40 Ga0068864_100000012 3300005618 Bacteria 335070
41 Ga0068858_100018893 3300005842 Bacteria 6449
42 Ga0068860_100001761 3300005843 Bacteria 23105
43 Ga0068862_100005593 3300005844 Bacteria 10501
44 Ga0070717_10139922 3300006028 Bacteria 2087
45 Ga0075366_10202172 3300006195 Bacteria 1208
46 Ga0097620_100037671 3300006931 Bacteria 4853
47 Ga0099826_10000008 3300006948 Bacteria 380974
48 Ga0105244_10015707 3300009036 Bacteria 4334
49 Ga0105240_10036881 3300009093 Bacteria 6285
50 Ga0105247_10004943 3300009101 Bacteria 8474
51 Ga0105241_10050016 3300009174 Bacteria 3185
52 Ga0105242_10102535 3300009176 Bacteria 2427
53 Ga0105242_10221745 3300009176 Bacteria 1690
54 Ga0105248_10076793 3300009177 Bacteria 3754
55 Ga0105249_10164812 3300009553 Bacteria 2145
56 Ga0157373_10039175 3300013100 Bacteria 3394
57 Ga0163163_10000397 3300014325 Bacteria 41142
58 Ga0157380_10311026 3300014326 Bacteria 1456
59 Ga0163161_10004278 3300017792 Bacteria 9957
60 Ga0209436_100320 3300025208 Bacteria 22042
61 Ga0209563_100003 3300025230 Bacteria 1932942
62 Ga0207425_1000110 3300025245 Bacteria 77431
63 Ga0207425_1007136 3300025245 Bacteria 2983
64 Ga0209148_1002356 3300025254 Bacteria 6672
65 Ga0209129_1001089 3300025258 Bacteria 15888
66 Ga0209565_1000018 3300025263 Bacteria 460940
67 Ga0209565_1004968 3300025263 Bacteria 3950
68 Ga0209565_1013456 3300025263 Bacteria 1914
69 Ga0209673_1000006 3300025273 Bacteria 650600
70 Ga0209673_1011152 3300025273 Bacteria 3727
71 Ga0209130_1000036 3300025284 Bacteria 284111
72 Ga0209675_1000005 3300025291 Bacteria 849192
73 Ga0209025_1004632 3300025294 Bacteria 11763
74 Ga0209564_1000144 3300025295 Bacteria 175328
75 Ga0209758_1000515 3300025297 Bacteria 62045
76 Ga0209050_1000519 3300025298 Bacteria 64306
77 Ga0209050_1005791 3300025298 Bacteria 7601
78 Ga0209050_1005858 3300025298 Bacteria 7526
79 Ga0209256_1000018 3300025299 Bacteria 568467
80 Ga0209256_1000325 3300025299 Bacteria 81358
81 Ga0207426_1004689 3300025302 Bacteria 6559
82 Ga0209051_1003205 3300025303 Bacteria 10923
83 Ga0209257_1000123 3300025304 Bacteria 219092
84 Ga0209257_1005941 3300025304 Bacteria 8202
85 Ga0209257_1052610 3300025304 Bacteria 1143
86 Ga0207710_10105949 3300025900 Bacteria 1331
87 Ga0207705_10009064 3300025909 Bacteria 7252
88 Ga0207654_10064240 3300025911 Bacteria 2157
89 Ga0207695_10028655 3300025913 Bacteria 6166
90 Ga0207657_10001032 3300025919 Bacteria 29487
91 Ga0207657_10023303 3300025919 Bacteria 5767
92 Ga0207657_10105309 3300025919 Bacteria 2335
93 Ga0207649_10195471 3300025920 Bacteria 1425
94 Ga0207681_10001769 3300025923 Bacteria 13881
95 Ga0207650_10000002 3300025925 Bacteria 1439222
96 Ga0207644_10001241 3300025931 Bacteria 16400
97 Ga0207690_10056689 3300025932 Bacteria 2644
98 Ga0207706_10115386 3300025933 Bacteria 2362
99 Ga0207709_10038023 3300025935 Bacteria 2863
100 Ga0207711_10023111 3300025941 Bacteria 5206
101 Ga0207667_10000044 3300025949 Bacteria 248251
102 Ga0207667_10017870 3300025949 Bacteria 7971
103 Ga0207667_10024480 3300025949 Bacteria 6628
104 Ga0207667_10049764 3300025949 Bacteria 4424
105 Ga0207667_10049817 3300025949 Bacteria 4421
106 Ga0207668_10093323 3300025972 Bacteria 2218
107 Ga0207658_10000001 3300025986 Bacteria 1439333
108 Ga0207703_10075162 3300026035 Bacteria 2799
109 Ga0207641_10077145 3300026088 Bacteria 2882
110 Ga0207676_10000001 3300026095 Bacteria 1439222
111 Ga0209282_1000005 3300027666 Bacteria 380858
112 Ga0268266_10002534 3300028379 Bacteria 19411
113 Ga0268265_10000436 3300028380 Bacteria 44235
114 Ga0268264_10000061 3300028381 Bacteria 303123
115 Ga0316182_1074442 3300030745 Bacteria 2277
116 Ga0316182_1217112 3300030745 Bacteria 1793
117 Ga0307408_100000156 3300031548 Bacteria 76233
118 Ga0307408_100003242 3300031548 Bacteria 11193
119 Ga0307408_100011556 3300031548 Bacteria 5834
120 Ga0307408_100350961 3300031548 Bacteria 1252
121 Ga0307405_10050444 3300031731 Bacteria 2577
122 Ga0307518_10001720 3300031838 Bacteria 16148
123 Ga0307410_10085387 3300031852 Bacteria 2227
124 Ga0307412_10154269 3300031911 Bacteria 1698
125 Ga0307416_100087373 3300032002 Bacteria 2661
126 Ga0307414_10050176 3300032004 Bacteria 2889
127 Ga0307411_10103480 3300032005 Bacteria 2020
128 Ga0307510_10012249 3300033180 Bacteria 10166
129 Ga0395899_0000012 3300037312 Bacteria 517561
130 Ga0395899_0057537 3300037312 Bacteria 2870
131 Ga0395900_0000426 3300037418 Bacteria 60657
132 Ga0395900_0017934 3300037418 Bacteria 7225
133 Ga0395900_0026515 3300037418 Bacteria 5933
134 Ga0395900_0043717 3300037418 Bacteria 4618
135 Ga0395900_0054175 3300037418 Bacteria 4129
136 Ga0395900_0117850 3300037418 Bacteria 2724
137 Ga0395900_0206459 3300037418 Bacteria 1985
138 Ga0395900_0409555 3300037418 Bacteria 1318
139 Ga0395898_0029857 3300037466 Bacteria 5457
140 Ga0395898_0166051 3300037466 Bacteria 2111
141 Ga0395898_0347053 3300037466 Bacteria 1415
142 Ga0395898_0379780 3300037466 Bacteria 1347
143 Ga0395898_0420179 3300037466 Bacteria 1274
144 Ga0395905_0041894 3300037471 Bacteria 4297
145 Ga0395905_0096961 3300037471 Bacteria 2768
146 Ga0395901_0000345 3300038443 Bacteria 56604
147 Ga0395901_0072229 3300038443 Bacteria 3597
148 Ga0395901_0496916 3300038443 Bacteria 1242
149 Ga0400484_07196 3300038725 Bacteria 13405
150 Ga0400488_52627 3300038741 Bacteria 3660
151 Ga0400483_093444 3300039062 Bacteria 18939
152 Ga0439448_0014397 3300042005 Bacteria 2385
153 Ga0466972_0077329 3300044658 Bacteria 1585
154 Ga0466965_0062806 3300044683 Bacteria 1858
155 Ga0466966_0006807 3300044684 Bacteria 7573
156 Ga0466963_0053503 3300044694 Bacteria 2680
157 Ga0466964_0000328 3300044706 Bacteria 14165
158 Ga0466968_0000248 3300044735 Bacteria 17059
159 Ga0466970_0022089 3300044765 Bacteria 3321
160 Ga0466957_0093533 3300044842 Bacteria 1887
161 Ga0466959_0010694 3300045049 Bacteria 6571
162 Ga0495617_000130 3300046452 Bacteria 49888
163 Ga0495617_002223 3300046452 Bacteria 7894
164 Ga0495617_002279 3300046452 Bacteria 7776
165 Ga0495627_000001 3300046453 Bacteria 1104709
166 Ga0495627_073328 3300046453 Bacteria 998
167 Ga0495603_0007350 3300046455 Bacteria 6626
168 Ga0495590_0000618 3300046457 Bacteria 16546
169 Ga0495590_0008210 3300046457 Bacteria 3994
170 Ga0495590_0022335 3300046457 Bacteria 2238
171 Ga0495638_0007732 3300046460 Bacteria 7681
172 Ga0495638_0023061 3300046460 Bacteria 4076
173 Ga0495638_0043653 3300046460 Bacteria 2827
174 Ga0495638_0099990 3300046460 Bacteria 1735
175 Ga0495638_0216129 3300046460 Bacteria 1074
176 Ga0495653_0046654 3300046463 Bacteria 3354
177 Ga0495650_0000001 3300046471 Bacteria 1085492
178 Ga0495580_0167276 3300046472 Bacteria 1520
179 Ga0495582_0002835 3300046473 Bacteria 9693
180 Ga0495605_0000073 3300046474 Bacteria 131765
181 Ga0495605_0000104 3300046474 Bacteria 105745
182 Ga0495605_0002136 3300046474 Bacteria 12361
183 Ga0495605_0002423 3300046474 Bacteria 11528
184 Ga0495605_0012340 3300046474 Bacteria 4743
185 Ga0495605_0013512 3300046474 Bacteria 4495
186 Ga0495584_0000002 3300046491 Bacteria 512179
187 Ga0495584_0000147 3300046491 Bacteria 48786
188 Ga0495584_0000317 3300046491 Bacteria 33691
189 Ga0495584_0000497 3300046491 Bacteria 26919
190 Ga0495584_0000793 3300046491 Bacteria 20837
191 Ga0495584_0028294 3300046491 Bacteria 2839
192 Ga0495584_0033510 3300046491 Bacteria 2598
193 Ga0495585_0000002 3300046492 Bacteria 529316
194 Ga0495585_0000039 3300046492 Bacteria 131202
195 Ga0495585_0001426 3300046492 Bacteria 18785
196 Ga0495585_0001547 3300046492 Bacteria 17845
197 Ga0495585_0003241 3300046492 Bacteria 11096
198 Ga0495585_0009267 3300046492 Bacteria 5914
199 Ga0495585_0009670 3300046492 Bacteria 5772
200 Ga0495585_0038100 3300046492 Bacteria 2706
201 Ga0495585_0108199 3300046492 Bacteria 1481
202 Ga0495594_0025908 3300046499 Bacteria 3153
203 Ga0495594_0032264 3300046499 Bacteria 2842
204 Ga0495596_0000111 3300046500 Bacteria 56505
205 Ga0495596_0002375 3300046500 Bacteria 10180
206 Ga0495596_0004616 3300046500 Bacteria 6671
207 Ga0495596_0011025 3300046500 Bacteria 3913
208 Ga0495596_0018459 3300046500 Bacteria 2874
209 Ga0495607_0001142 3300046501 Bacteria 24025
210 Ga0495607_0002573 3300046501 Bacteria 14647
211 Ga0495607_0003998 3300046501 Bacteria 11071
212 Ga0495607_0004639 3300046501 Bacteria 10059
213 Ga0495607_0007603 3300046501 Bacteria 7472
214 Ga0495607_0009612 3300046501 Bacteria 6536
215 Ga0495607_0016643 3300046501 Bacteria 4742
216 Ga0495607_0039483 3300046501 Bacteria 2818
217 Ga0495583_0000008 3300046506 Bacteria 411092
218 Ga0495583_0000009 3300046506 Bacteria 372527
219 Ga0495583_0000053 3300046506 Bacteria 210542
220 Ga0495583_0000098 3300046506 Bacteria 148776
221 Ga0495583_0006361 3300046506 Bacteria 7742
222 Ga0495583_0006745 3300046506 Bacteria 7427
223 Ga0495583_0015887 3300046506 Bacteria 4072
224 Ga0495583_0017886 3300046506 Bacteria 3748
225 Ga0495583_0020143 3300046506 Bacteria 3464
226 Ga0495606_0000049 3300046507 Bacteria 204038
227 Ga0495606_0000152 3300046507 Bacteria 119522
228 Ga0495606_0002108 3300046507 Bacteria 24161
229 Ga0495606_0006601 3300046507 Bacteria 10659
230 Ga0495606_0014177 3300046507 Bacteria 6239
231 Ga0495606_0025845 3300046507 Bacteria 4196
232 Ga0495606_0105734 3300046507 Bacteria 1705
233 Ga0495606_0140786 3300046507 Bacteria 1425
234 Ga0495610_0005569 3300046512 Bacteria 8909
235 Ga0495610_0011685 3300046512 Bacteria 5342
236 Ga0495610_0030026 3300046512 Bacteria 2853
237 Ga0495610_0039751 3300046512 Bacteria 2376
238 Ga0495610_0064562 3300046512 Bacteria 1730
239 Ga0495610_0100124 3300046512 Bacteria 1299
240 Ga0495616_0000034 3300046513 Bacteria 129394
241 Ga0495616_0001047 3300046513 Bacteria 19730
242 Ga0495616_0001206 3300046513 Bacteria 18232
243 Ga0495616_0003659 3300046513 Bacteria 9820
244 Ga0495616_0006183 3300046513 Bacteria 7282
245 Ga0495616_0008721 3300046513 Bacteria 5978
246 Ga0495616_0009416 3300046513 Bacteria 5714
247 Ga0495616_0023962 3300046513 Bacteria 3279
248 Ga0495616_0024188 3300046513 Bacteria 3260
249 Ga0495616_0048846 3300046513 Bacteria 2123
250 Ga0495630_0002965 3300046517 Bacteria 11784
251 Ga0495631_0000647 3300046518 Bacteria 22571
252 Ga0495631_0001368 3300046518 Bacteria 14884
253 Ga0495631_0002535 3300046518 Bacteria 10260
254 Ga0495631_0024550 3300046518 Bacteria 2783
255 Ga0495631_0066359 3300046518 Bacteria 1561
256 Ga0495632_0000018 3300046519 Bacteria 228282
257 Ga0495632_0000029 3300046519 Bacteria 171022
258 Ga0495632_0000056 3300046519 Bacteria 124483
259 Ga0495632_0002342 3300046519 Bacteria 14521
260 Ga0495632_0005324 3300046519 Bacteria 8540
261 Ga0495632_0025826 3300046519 Bacteria 3102
262 Ga0495637_0000051 3300046520 Bacteria 100076
263 Ga0495643_0000172 3300046522 Bacteria 102566
264 Ga0495643_0002487 3300046522 Bacteria 14505
265 Ga0495643_0005825 3300046522 Bacteria 8244
266 Ga0495643_0006631 3300046522 Bacteria 7602
267 Ga0495643_0018072 3300046522 Bacteria 4105
268 Ga0495643_0024629 3300046522 Bacteria 3412
269 Ga0495644_0000766 3300046523 Bacteria 13236
270 Ga0495644_0000768 3300046523 Bacteria 13228
271 Ga0495644_0002902 3300046523 Bacteria 6802
272 Ga0495644_0051239 3300046523 Bacteria 1550
273 Ga0495644_0063207 3300046523 Bacteria 1391
274 Ga0495648_0000027 3300046524 Bacteria 228881
275 Ga0495648_0002548 3300046524 Bacteria 16698
276 Ga0495648_0010041 3300046524 Bacteria 7256
277 Ga0495663_0005435 3300046525 Bacteria 3532
278 Ga0495666_0044848 3300046526 Bacteria 2134
279 Ga0495642_0000061 3300046528 Bacteria 65572
280 Ga0495642_0000349 3300046528 Bacteria 25086
281 Ga0495642_0002011 3300046528 Bacteria 8478
282 Ga0495642_0002421 3300046528 Bacteria 7601
283 Ga0495642_0044804 3300046528 Bacteria 1806
284 Ga0495642_0050008 3300046528 Bacteria 1717
285 Ga0495642_0060575 3300046528 Bacteria 1570
286 Ga0495652_0028347 3300046529 Bacteria 4927
287 Ga0495654_0000011 3300046530 Bacteria 363172
288 Ga0495654_0005102 3300046530 Bacteria 7675
289 Ga0495654_0025870 3300046530 Bacteria 3022
290 Ga0495654_0043499 3300046530 Bacteria 2226
291 Ga0495665_0007031 3300046531 Bacteria 6072
292 Ga0495587_0045822 3300046536 Bacteria 2597
293 Ga0495609_0000095 3300046538 Bacteria 104807
294 Ga0495609_0000180 3300046538 Bacteria 63952
295 Ga0495609_0000227 3300046538 Bacteria 54650
296 Ga0495609_0001047 3300046538 Bacteria 19407
297 Ga0495609_0010376 3300046538 Bacteria 4470
298 Ga0495609_0022466 3300046538 Bacteria 2906
299 Ga0495597_0000073 3300046542 Bacteria 87767
300 Ga0495597_0000102 3300046542 Bacteria 76204
301 Ga0495597_0004338 3300046542 Bacteria 7819
302 Ga0495597_0006322 3300046542 Bacteria 6137
303 Ga0495597_0008666 3300046542 Bacteria 5083
304 Ga0495597_0015075 3300046542 Bacteria 3665
305 Ga0495597_0030490 3300046542 Bacteria 2458
306 Ga0495645_0032911 3300046543 Bacteria 3782
307 Ga0495622_0000001 3300046557 Bacteria 365248
308 Ga0495622_0068954 3300046557 Bacteria 1633
309 Ga0495633_0000047 3300046558 Bacteria 165890
310 Ga0495633_0000091 3300046558 Bacteria 122383
311 Ga0495633_0001026 3300046558 Bacteria 22831
312 Ga0495633_0001648 3300046558 Bacteria 16860
313 Ga0495633_0001785 3300046558 Bacteria 15899
314 Ga0495633_0002897 3300046558 Bacteria 11763
315 Ga0495633_0002939 3300046558 Bacteria 11659
316 Ga0495633_0005700 3300046558 Bacteria 7535
317 Ga0495633_0007427 3300046558 Bacteria 6306
318 Ga0495633_0039821 3300046558 Bacteria 2241
319 Ga0495656_0002389 3300046615 Bacteria 6222
320 Ga0495656_0011091 3300046615 Bacteria 3299
321 Ga0495656_0015227 3300046615 Bacteria 2900
322 Ga0495656_0051758 3300046615 Bacteria 1759
323 Ga0495668_0000077 3300046616 Bacteria 159120
324 Ga0495668_0004087 3300046616 Bacteria 10576
325 Ga0495668_0007041 3300046616 Bacteria 7253
326 Ga0495668_0018580 3300046616 Bacteria 4017
327 Ga0495668_0021366 3300046616 Bacteria 3712
328 Ga0495668_0044000 3300046616 Bacteria 2481
329 Ga0495668_0122816 3300046616 Bacteria 1421
330 Ga0495634_0014246 3300046642 Bacteria 5737
331 Ga0495611_0000973 3300046648 Bacteria 15268
332 Ga0495611_0002795 3300046648 Bacteria 7807
333 Ga0495611_0075042 3300046648 Bacteria 1549
334 Ga0495611_0123012 3300046648 Bacteria 1210
335 Ga0495625_0012866 3300046660 Bacteria 6763
336 Ga0495625_0013559 3300046660 Bacteria 6540
337 Ga0495625_0013954 3300046660 Bacteria 6433
338 Ga0495625_0019960 3300046660 Bacteria 5183
339 Ga0495625_0021134 3300046660 Bacteria 5015
340 Ga0495625_0031980 3300046660 Bacteria 3908
341 Ga0495625_0149085 3300046660 Bacteria 1573
342 Ga0495659_0000066 3300046664 Bacteria 46410
343 Ga0495659_0000375 3300046664 Bacteria 17343
344 Ga0495661_0000012 3300046665 Bacteria 276804
345 Ga0495661_0002583 3300046665 Bacteria 13894
346 Ga0495661_0004916 3300046665 Bacteria 9563
347 Ga0495661_0014989 3300046665 Bacteria 5180
348 Ga0495661_0016551 3300046665 Bacteria 4885
349 Ga0495661_0045661 3300046665 Bacteria 2677
350 Ga0495661_0126462 3300046665 Bacteria 1406
351 Ga0495588_0000099 3300046674 Bacteria 164015
352 Ga0495588_0000118 3300046674 Bacteria 134942
353 Ga0495588_0015285 3300046674 Bacteria 3690
354 Ga0495599_0060172 3300046678 Bacteria 2375
355 Ga0495623_0063988 3300046679 Bacteria 2302
356 Ga0495669_0001370 3300046684 Bacteria 10055
357 Ga0495669_0079434 3300046684 Bacteria 1504
358 Ga0495670_0000155 3300046691 Bacteria 29929
359 Ga0495670_0002059 3300046691 Bacteria 9914
360 Ga0495670_0008506 3300046691 Bacteria 5049
361 Ga0495670_0096162 3300046691 Bacteria 1520
362 Ga0495671_0000119 3300046692 Bacteria 71430
363 Ga0495671_0000861 3300046692 Bacteria 21695
364 Ga0495649_0001053 3300046694 Bacteria 21624
365 Ga0495649_0147486 3300046694 Bacteria 1236
366 Ga0495589_0000007 3300046794 Bacteria 276444
367 Ga0495589_0000082 3300046794 Bacteria 87068
368 Ga0495589_0000091 3300046794 Bacteria 85670
369 Ga0495589_0006439 3300046794 Bacteria 6194
370 Ga0495660_0000024 3300046810 Bacteria 268209
371 Ga0495660_0000050 3300046810 Bacteria 140329
372 Ga0495660_0001053 3300046810 Bacteria 19967
373 Ga0495660_0003186 3300046810 Bacteria 10206
374 Ga0495660_0009629 3300046810 Bacteria 5632
375 Ga0495660_0011860 3300046810 Bacteria 5055
376 Ga0495660_0020108 3300046810 Bacteria 3829
377 Ga0495660_0038683 3300046810 Bacteria 2651
378 Ga0495636_0001544 3300047318 Bacteria 8766
379 Ga0495636_0001582 3300047318 Bacteria 8660
380 Ga0495672_0000023 3300047320 Bacteria 419080
381 Ga0495672_0000091 3300047320 Bacteria 147538
382 Ga0495672_0000222 3300047320 Bacteria 81058
383 Ga0495672_0006907 3300047320 Bacteria 8652
384 Ga0495672_0008784 3300047320 Bacteria 7401
385 Ga0495672_0033291 3300047320 Bacteria 3194
386 Ga0495683_0000308 3300047323 Bacteria 41296
387 Ga0495683_0001182 3300047323 Bacteria 17820
388 Ga0495683_0002349 3300047323 Bacteria 11495
389 Ga0495683_0015490 3300047323 Bacteria 3967
390 Ga0495683_0015805 3300047323 Bacteria 3919
391 Ga0495683_0020465 3300047323 Bacteria 3413
392 Ga0495687_000002 3300047443 Bacteria 1085770
393 Ga0495687_000003 3300047443 Bacteria 859509
394 Ga0495687_000016 3300047443 Bacteria 359237
395 Ga0495687_000097 3300047443 Bacteria 132755
396 Ga0495687_000509 3300047443 Bacteria 46803
397 Ga0495687_000782 3300047443 Bacteria 34235
398 Ga0495687_020819 3300047443 Bacteria 3189
399 Ga0495687_027317 3300047443 Bacteria 2672
400 Ga0495687_035800 3300047443 Bacteria 2228
401 Ga0495687_044118 3300047443 Bacteria 1940
402 Ga0495675_0007908 3300047444 Bacteria 6569
403 Ga0495677_0000005 3300047445 Bacteria 243336
404 Ga0495677_0000064 3300047445 Bacteria 56938
405 Ga0495677_0001579 3300047445 Bacteria 9193
406 Ga0495677_0006796 3300047445 Bacteria 4304
407 Ga0495677_0007169 3300047445 Bacteria 4173
408 Ga0495677_0034247 3300047445 Bacteria 1852
409 Ga0495679_010480 3300047446 Bacteria 3636
410 Ga0495685_008888 3300047447 Bacteria 3348
411 Ga0495685_009932 3300047447 Bacteria 3186
412 Ga0495673_0011118 3300047469 Bacteria 4858
413 Ga0495681_0000016 3300047470 Bacteria 181322
414 Ga0495681_0000175 3300047470 Bacteria 53913
415 Ga0495681_0002440 3300047470 Bacteria 13266
416 Ga0495681_0004883 3300047470 Bacteria 9057
417 Ga0495681_0008215 3300047470 Bacteria 6561
418 Ga0495681_0012582 3300047470 Bacteria 4963
419 Ga0495681_0116626 3300047470 Bacteria 1150
420 Ga0495686_0010833 3300047472 Bacteria 6462
421 Ga0495686_0012080 3300047472 Bacteria 6064
422 Ga0495686_0024318 3300047472 Bacteria 3982
423 Ga0495686_0108824 3300047472 Bacteria 1664
424 Ga0495615_0000766 3300048090 Bacteria 4505
425 Ga0495626_0000081 3300048091 Bacteria 128894
426 Ga0495626_0006671 3300048091 Bacteria 6542
427 Ga0495626_0021410 3300048091 Bacteria 3208
428 Ga0495626_0024022 3300048091 Bacteria 2993
429 Ga0495626_0028475 3300048091 Bacteria 2708
430 Ga0495626_0043258 3300048091 Bacteria 2114
431 Ga0495626_0065622 3300048091 Bacteria 1642
432 Ga0496101_0101069 3300048904 Bacteria 2158
433 Ga0496102_0216456 3300048905 Bacteria 1805
434 Ga0496103_0002534 3300048906 Bacteria 11450
435 Ga0496103_0011020 3300048906 Bacteria 5351
436 Ga0496105_0228481 3300048908 Bacteria 1513
437 Ga0496106_0001179 3300048909 Bacteria 19465
438 Ga0496108_0442658 3300048911 Bacteria 1135
439 Ga0496113_0004860 3300048916 Bacteria 8320
440 Ga0496121_0105686 3300048924 Bacteria 2160
441 Ga0496122_0000509 3300048925 Bacteria 80337
442 Ga0496122_0006299 3300048925 Bacteria 13680
443 Ga0496123_0002980 3300048926 Bacteria 19663
444 Ga0496123_0042029 3300048926 Bacteria 3161
445 Ga0496123_0045495 3300048926 Bacteria 2989
446 Ga0496124_0007226 3300048927 Bacteria 11865
447 Ga0496124_0018760 3300048927 Bacteria 6465
448 Ga0496124_0020449 3300048927 Bacteria 6113
449 Ga0496124_0020784 3300048927 Bacteria 6058
450 Ga0496125_0003043 3300048928 Bacteria 20963
451 Ga0496125_0130781 3300048928 Bacteria 1768
452 Ga0496126_0254175 3300048929 Bacteria 1463
453 Ga0495678_000002 3300049459 Bacteria 999613
454 Ga0495678_000818 3300049459 Bacteria 27872
455 Ga0495678_000999 3300049459 Bacteria 24216
456 Ga0495678_001177 3300049459 Bacteria 21547
457 Ga0495678_007185 3300049459 Bacteria 5807
458 Ga0495682_0000035 3300049460 Bacteria 126349
459 Ga0495682_0000041 3300049460 Bacteria 119154
460 Ga0495682_0000654 3300049460 Bacteria 23034
461 Ga0501047_0406060 3300049581 Bacteria 1195
462 Ga0501269_000021 3300049766 Bacteria 53792
463 Ga0501035_0000507 3300049822 Bacteria 43979
464 nmdc:mga0k408_17512_c1 3300050493 Bacteria 3992
465 Ga0500618_000052 3300053125 Bacteria 102436
466 Ga0500618_002045 3300053125 Bacteria 8150
467 Ga0500573_0054197 3300053140 Bacteria 2302
468 Ga0500586_000019 3300053145 Bacteria 32263

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047470 Ga0495681_0116626 Ga0495681_0116626_10_870 255
2 3300047472 Ga0495686_0012080 Ga0495686_0012080_65_1063 268
3 3300037471 Ga0395905_0041894 Ga0395905_0041894_1416_2435 271
4 3300005347 Ga0070668_100174502 Ga0070668_1001745022 273
5 3300009553 Ga0105249_10164812 Ga0105249_101648122 273
6 3300014326 Ga0157380_10311026 Ga0157380_103110262 273
7 3300025972 Ga0207668_10093323 Ga0207668_100933232 273
8 3300047443 Ga0495687_020819 Ga0495687_020819_1672_2661 280
9 3300053140 Ga0500573_0054197 Ga0500573_0054197_390_1403 281
10 3300046453 Ga0495627_073328 Ga0495627_073328_12_929 282
11 3300048904 Ga0496101_0101069 Ga0496101_0101069_1137_2126 282
12 3300006028 Ga0070717_10139922 Ga0070717_101399222 284
13 3300009036 Ga0105244_10015707 Ga0105244_100157074 286
14 3300046512 Ga0495610_0039751 Ga0495610_0039751_89_1090 286
15 3300046512 Ga0495610_0100124 Ga0495610_0100124_206_1207 286
16 3300046542 Ga0495597_0000102 Ga0495597_0000102_5701_6690 286
17 3300046660 Ga0495625_0013559 Ga0495625_0013559_3065_4066 286
18 3300046794 Ga0495589_0000091 Ga0495589_0000091_76867_77856 286
19 3300048906 Ga0496103_0002534 Ga0496103_0002534_4760_5761 286
20 3300046525 Ga0495663_0005435 Ga0495663_0005435_135_1130 287
21 3300046528 Ga0495642_0000349 Ga0495642_0000349_22333_23331 287
22 3300046615 Ga0495656_0011091 Ga0495656_0011091_480_1475 287
23 3300047445 Ga0495677_0034247 Ga0495677_0034247_526_1524 287
24 3300048090 Ga0495615_0000766 Ga0495615_0000766_648_1643 287
25 3300030745 Ga0316182_1074442 Ga0316182_10744422 289
26 3300046500 Ga0495596_0000111 Ga0495596_0000111_5394_6392 289
27 3300046513 Ga0495616_0009416 Ga0495616_0009416_2042_3040 289
28 3300046558 Ga0495633_0005700 Ga0495633_0005700_510_1508 289
29 3300046506 Ga0495583_0006745 Ga0495583_0006745_661_1686 290
30 3300037418 Ga0395900_0409555 Ga0395900_0409555_185_1183 292
31 3300003759 Ga0055525_1000136 Ga0055525_100013635 293
32 3300005339 Ga0070660_100006686 Ga0070660_1000066862 293
33 3300009176 Ga0105242_10102535 Ga0105242_101025352 293
34 3300025230 Ga0209563_100003 Ga0209563_1000031655 293
35 3300025919 Ga0207657_10001032 Ga0207657_1000103221 293
36 3300025933 Ga0207706_10115386 Ga0207706_101153862 293
37 3300037312 Ga0395899_0057537 Ga0395899_0057537_177_1175 293
38 3300037418 Ga0395900_0206459 Ga0395900_0206459_803_1801 293
39 3300046457 Ga0495590_0022335 Ga0495590_0022335_1045_2043 293
40 3300046474 Ga0495605_0000104 Ga0495605_0000104_62388_63386 293
41 3300046491 Ga0495584_0000793 Ga0495584_0000793_7978_8976 293
42 3300046501 Ga0495607_0001142 Ga0495607_0001142_22526_23524 293
43 3300046507 Ga0495606_0002108 Ga0495606_0002108_14380_15378 293
44 3300046522 Ga0495643_0002487 Ga0495643_0002487_3165_4163 293
45 3300046523 Ga0495644_0002902 Ga0495644_0002902_205_1158 293
46 3300046528 Ga0495642_0044804 Ga0495642_0044804_524_1477 293
47 3300046615 Ga0495656_0015227 Ga0495656_0015227_1563_2561 293
48 3300046616 Ga0495668_0044000 Ga0495668_0044000_28_981 293
49 3300046648 Ga0495611_0002795 Ga0495611_0002795_1629_2582 293
50 3300046665 Ga0495661_0045661 Ga0495661_0045661_1179_2132 293
51 3300046684 Ga0495669_0079434 Ga0495669_0079434_512_1465 293
52 3300046691 Ga0495670_0096162 Ga0495670_0096162_34_987 293
53 3300046794 Ga0495589_0000082 Ga0495589_0000082_23981_24979 293
54 3300046810 Ga0495660_0000050 Ga0495660_0000050_10476_11474 293
55 3300046810 Ga0495660_0003186 Ga0495660_0003186_5241_6194 293
56 3300047323 Ga0495683_0002349 Ga0495683_0002349_5301_6299 293
57 3300047443 Ga0495687_000016 Ga0495687_000016_34515_35513 293
58 3300047443 Ga0495687_000097 Ga0495687_000097_111408_112406 293
59 3300047445 Ga0495677_0001579 Ga0495677_0001579_2862_3860 293
60 3300047446 Ga0495679_010480 Ga0495679_010480_2509_3462 293
61 3300048091 Ga0495626_0000081 Ga0495626_0000081_55797_56795 293
62 3300049459 Ga0495678_007185 Ga0495678_007185_102_1055 293
63 3300003762 Ga0055542_1012188 Ga0055542_10121882 294
64 3300013100 Ga0157373_10039175 Ga0157373_100391753 294
65 3300025254 Ga0209148_1002356 Ga0209148_10023566 294
66 3300025949 Ga0207667_10049764 Ga0207667_100497644 294
67 3300037418 Ga0395900_0054175 Ga0395900_0054175_2997_3995 294
68 3300037466 Ga0395898_0166051 Ga0395898_0166051_595_1593 294
69 3300037471 Ga0395905_0096961 Ga0395905_0096961_185_1183 294
70 3300038443 Ga0395901_0496916 Ga0395901_0496916_130_1128 294
71 3300044694 Ga0466963_0053503 Ga0466963_0053503_968_1966 294
72 3300046501 Ga0495607_0016643 Ga0495607_0016643_3243_4241 294
73 3300046507 Ga0495606_0014177 Ga0495606_0014177_581_1579 294
74 3300046513 Ga0495616_0023962 Ga0495616_0023962_805_1803 294
75 3300046522 Ga0495643_0018072 Ga0495643_0018072_696_1694 294
76 3300046524 Ga0495648_0010041 Ga0495648_0010041_6002_7000 294
77 3300046665 Ga0495661_0014989 Ga0495661_0014989_3486_4484 294
78 3300046674 Ga0495588_0000118 Ga0495588_0000118_61043_62041 294
79 3300047443 Ga0495687_044118 Ga0495687_044118_506_1504 294
80 3300048905 Ga0496102_0216456 Ga0496102_0216456_207_1205 294
81 3300048909 Ga0496106_0001179 Ga0496106_0001179_2839_3849 294
82 3300048927 Ga0496124_0018760 Ga0496124_0018760_1011_2009 294
83 3300048928 Ga0496125_0130781 Ga0496125_0130781_593_1591 294
84 3300037466 Ga0395898_0379780 Ga0395898_0379780_183_1181 295
85 3300046452 Ga0495617_000130 Ga0495617_000130_2527_3525 295
86 3300046492 Ga0495585_0000002 Ga0495585_0000002_56136_57134 295
87 3300046513 Ga0495616_0001047 Ga0495616_0001047_17053_18051 295
88 3300046524 Ga0495648_0000027 Ga0495648_0000027_56136_57134 295
89 3300046616 Ga0495668_0004087 Ga0495668_0004087_2882_3877 296
90 3300047323 Ga0495683_0020465 Ga0495683_0020465_338_1336 296
91 3300005366 Ga0070659_100184189 Ga0070659_1001841892 297
92 3300025932 Ga0207690_10056689 Ga0207690_100566892 297
93 3300046460 Ga0495638_0099990 Ga0495638_0099990_113_1108 297
94 3300046507 Ga0495606_0000152 Ga0495606_0000152_44855_45853 297
95 3300047472 Ga0495686_0108824 Ga0495686_0108824_535_1551 297
96 3300046492 Ga0495585_0000039 Ga0495585_0000039_5330_6328 298
97 3300046492 Ga0495585_0001426 Ga0495585_0001426_5122_6120 298
98 3300046492 Ga0495585_0108199 Ga0495585_0108199_260_1258 298
99 3300046506 Ga0495583_0000009 Ga0495583_0000009_364324_365322 298
100 3300046558 Ga0495633_0002939 Ga0495633_0002939_3420_4418 298
101 3300046665 Ga0495661_0004916 Ga0495661_0004916_5697_6695 298
102 3300046691 Ga0495670_0000155 Ga0495670_0000155_15142_16140 298
103 3300046691 Ga0495670_0002059 Ga0495670_0002059_5724_6722 298
104 3300046528 Ga0495642_0002011 Ga0495642_0002011_3587_4585 299
105 3300046648 Ga0495611_0075042 Ga0495611_0075042_265_1263 299
106 3300048906 Ga0496103_0011020 Ga0496103_0011020_1727_2716 299
107 3300048926 Ga0496123_0002980 Ga0496123_0002980_16561_17559 299
108 3300048927 Ga0496124_0020449 Ga0496124_0020449_3964_4956 299
109 3300046542 Ga0495597_0000073 Ga0495597_0000073_36467_37492 300
110 3300046678 Ga0495599_0060172 Ga0495599_0060172_1327_2322 300
111 3300048091 Ga0495626_0006671 Ga0495626_0006671_2212_3237 300
112 3300048927 Ga0496124_0020784 Ga0496124_0020784_3605_4594 300
113 3300005327 Ga0070658_10215097 Ga0070658_102150972 301
114 3300005563 Ga0068855_100029329 Ga0068855_1000293296 301
115 3300025909 Ga0207705_10009064 Ga0207705_100090645 301
116 3300025949 Ga0207667_10017870 Ga0207667_100178702 301
117 3300025949 Ga0207667_10049817 Ga0207667_100498174 301
118 3300031548 Ga0307408_100000156 Ga0307408_10000015615 301
119 3300037418 Ga0395900_0017934 Ga0395900_0017934_844_1842 301
120 3300037418 Ga0395900_0043717 Ga0395900_0043717_722_1711 301
121 3300037466 Ga0395898_0347053 Ga0395898_0347053_358_1356 301
122 3300037466 Ga0395898_0420179 Ga0395898_0420179_61_1050 301
123 3300038443 Ga0395901_0072229 Ga0395901_0072229_834_1832 301
124 3300046453 Ga0495627_000001 Ga0495627_000001_298421_299446 301
125 3300046460 Ga0495638_0023061 Ga0495638_0023061_1676_2674 301
126 3300046500 Ga0495596_0018459 Ga0495596_0018459_1527_2525 301
127 3300046519 Ga0495632_0025826 Ga0495632_0025826_607_1605 301
128 3300046523 Ga0495644_0051239 Ga0495644_0051239_529_1524 301
129 3300046538 Ga0495609_0010376 Ga0495609_0010376_3044_4042 301
130 3300046660 Ga0495625_0149085 Ga0495625_0149085_433_1431 301
131 3300046674 Ga0495588_0000099 Ga0495588_0000099_85718_86707 301
132 3300048091 Ga0495626_0024022 Ga0495626_0024022_302_1300 301
133 3300048908 Ga0496105_0228481 Ga0496105_0228481_367_1365 301
134 3300048916 Ga0496113_0004860 Ga0496113_0004860_2196_3194 301
135 3300048925 Ga0496122_0000509 Ga0496122_0000509_11905_12903 301
136 3300048926 Ga0496123_0042029 Ga0496123_0042029_409_1407 301
137 3300009176 Ga0105242_10221745 Ga0105242_102217452 302
138 3300031548 Ga0307408_100350961 Ga0307408_1003509611 302
139 3300031731 Ga0307405_10050444 Ga0307405_100504442 302
140 3300031852 Ga0307410_10085387 Ga0307410_100853872 302
141 3300031911 Ga0307412_10154269 Ga0307412_101542692 302
142 3300032002 Ga0307416_100087373 Ga0307416_1000873732 302
143 3300032005 Ga0307411_10103480 Ga0307411_101034802 302
144 3300046518 Ga0495631_0066359 Ga0495631_0066359_60_1085 302
145 3300046522 Ga0495643_0024629 Ga0495643_0024629_2205_3203 302
146 3300046543 Ga0495645_0032911 Ga0495645_0032911_1469_2467 302
147 3300046665 Ga0495661_0016551 Ga0495661_0016551_2263_3258 302
148 3300046810 Ga0495660_0011860 Ga0495660_0011860_3636_4634 302
149 3300048925 Ga0496122_0006299 Ga0496122_0006299_10850_11839 302
150 3300048926 Ga0496123_0045495 Ga0496123_0045495_343_1332 302
151 3300005331 Ga0070670_100000001 Ga0070670_100000001438 303
152 3300005335 Ga0070666_10040383 Ga0070666_100403832 303
153 3300005355 Ga0070671_100000008 Ga0070671_100000008164 303
154 3300005365 Ga0070688_100000584 Ga0070688_1000005849 303
155 3300005367 Ga0070667_100000023 Ga0070667_10000002310 303
156 3300005466 Ga0070685_10000007 Ga0070685_1000000751 303
157 3300005548 Ga0070665_100120415 Ga0070665_1001204152 303
158 3300005617 Ga0068859_100037676 Ga0068859_1000376764 303
159 3300005618 Ga0068864_100000012 Ga0068864_10000001278 303
160 3300005842 Ga0068858_100018893 Ga0068858_1000188933 303
161 3300005843 Ga0068860_100001761 Ga0068860_1000017617 303
162 3300005844 Ga0068862_100005593 Ga0068862_1000055932 303
163 3300006195 Ga0075366_10202172 Ga0075366_102021722 303
164 3300006931 Ga0097620_100037671 Ga0097620_1000376714 303
165 3300009101 Ga0105247_10004943 Ga0105247_100049434 303
166 3300009174 Ga0105241_10050016 Ga0105241_100500162 303
167 3300009177 Ga0105248_10076793 Ga0105248_100767932 303
168 3300014325 Ga0163163_10000397 Ga0163163_1000039734 303
169 3300025900 Ga0207710_10105949 Ga0207710_101059492 303
170 3300025911 Ga0207654_10064240 Ga0207654_100642402 303
171 3300025923 Ga0207681_10001769 Ga0207681_100017692 303
172 3300025925 Ga0207650_10000002 Ga0207650_100000021113 303
173 3300025931 Ga0207644_10001241 Ga0207644_1000124110 303
174 3300025941 Ga0207711_10023111 Ga0207711_100231113 303
175 3300025986 Ga0207658_10000001 Ga0207658_10000001242 303
176 3300026035 Ga0207703_10075162 Ga0207703_100751622 303
177 3300026088 Ga0207641_10077145 Ga0207641_100771453 303
178 3300026095 Ga0207676_10000001 Ga0207676_100000011113 303
179 3300028379 Ga0268266_10002534 Ga0268266_100025349 303
180 3300028380 Ga0268265_10000436 Ga0268265_1000043624 303
181 3300028381 Ga0268264_10000061 Ga0268264_10000061238 303
182 3300037418 Ga0395900_0117850 Ga0395900_0117850_638_1636 303
183 3300037466 Ga0395898_0029857 Ga0395898_0029857_3150_4148 303
184 3300044842 Ga0466957_0093533 Ga0466957_0093533_416_1414 303
185 3300046474 Ga0495605_0000073 Ga0495605_0000073_45065_46048 303
186 3300048929 Ga0496126_0254175 Ga0496126_0254175_220_1200 303
187 3300050493 nmdc:mga0k408_17512_c1 nmdc:mga0k408_17512_c1_1272_2264 303
188 3300009093 Ga0105240_10036881 Ga0105240_100368817 304
189 3300046457 Ga0495590_0000618 Ga0495590_0000618_12991_13989 304
190 3300046530 Ga0495654_0025870 Ga0495654_0025870_1087_2082 304
191 3300046558 Ga0495633_0000091 Ga0495633_0000091_35477_36472 304
192 3300049460 Ga0495682_0000654 Ga0495682_0000654_20305_21300 304
193 3300031838 Ga0307518_10001720 Ga0307518_100017206 305
194 3300046491 Ga0495584_0000147 Ga0495584_0000147_43662_44657 305
195 3300046492 Ga0495585_0001547 Ga0495585_0001547_11028_12023 305
196 3300046500 Ga0495596_0004616 Ga0495596_0004616_2492_3487 305
197 3300046513 Ga0495616_0003659 Ga0495616_0003659_5963_6958 305
198 3300046558 Ga0495633_0001026 Ga0495633_0001026_19798_20793 305
199 3300047320 Ga0495672_0000222 Ga0495672_0000222_52828_53856 305
200 3300047323 Ga0495683_0000308 Ga0495683_0000308_27503_28498 305
201 3300048091 Ga0495626_0021410 Ga0495626_0021410_901_1896 305
202 3300003771 Ga0055526_1009424 Ga0055526_10094242 306
203 3300003773 Ga0055537_1000076 Ga0055537_10000766 306
204 3300003773 Ga0055537_1000260 Ga0055537_100026017 306
205 3300003775 Ga0055524_1004143 Ga0055524_10041433 306
206 3300003784 Ga0055534_1000124 Ga0055534_100012432 306
207 3300003790 Ga0055528_1000184 Ga0055528_100018417 306
208 3300025263 Ga0209565_1000018 Ga0209565_1000018304 306
209 3300025273 Ga0209673_1000006 Ga0209673_1000006468 306
210 3300025291 Ga0209675_1000005 Ga0209675_1000005304 306
211 3300025295 Ga0209564_1000144 Ga0209564_100014442 306
212 3300025299 Ga0209256_1000325 Ga0209256_100032546 306
213 3300032004 Ga0307414_10050176 Ga0307414_100501763 306
214 3300046471 Ga0495650_0000001 Ga0495650_0000001_118956_119942 306
215 3300046474 Ga0495605_0013512 Ga0495605_0013512_3068_4063 306
216 3300046491 Ga0495584_0000497 Ga0495584_0000497_1880_2875 306
217 3300046492 Ga0495585_0009670 Ga0495585_0009670_4243_5238 306
218 3300046500 Ga0495596_0011025 Ga0495596_0011025_2301_3296 306
219 3300046501 Ga0495607_0039483 Ga0495607_0039483_1609_2604 306
220 3300046506 Ga0495583_0000098 Ga0495583_0000098_62843_63838 306
221 3300046507 Ga0495606_0140786 Ga0495606_0140786_59_1054 306
222 3300046513 Ga0495616_0048846 Ga0495616_0048846_452_1447 306
223 3300046518 Ga0495631_0000647 Ga0495631_0000647_7061_8056 306
224 3300046519 Ga0495632_0005324 Ga0495632_0005324_6224_7219 306
225 3300046523 Ga0495644_0063207 Ga0495644_0063207_86_1093 306
226 3300046528 Ga0495642_0060575 Ga0495642_0060575_164_1168 306
227 3300046538 Ga0495609_0001047 Ga0495609_0001047_14773_15780 306
228 3300046558 Ga0495633_0001648 Ga0495633_0001648_1035_2030 306
229 3300046794 Ga0495589_0006439 Ga0495589_0006439_4708_5703 306
230 3300046810 Ga0495660_0001053 Ga0495660_0001053_4116_5123 306
231 3300047320 Ga0495672_0033291 Ga0495672_0033291_1372_2367 306
232 3300047323 Ga0495683_0015490 Ga0495683_0015490_1153_2148 306
233 3300047470 Ga0495681_0012582 Ga0495681_0012582_3679_4674 306
234 3300005563 Ga0068855_100000220 Ga0068855_10000022045 307
235 3300025919 Ga0207657_10023303 Ga0207657_100233035 307
236 3300025920 Ga0207649_10195471 Ga0207649_101954712 307
237 3300025949 Ga0207667_10000044 Ga0207667_1000004494 307
238 3300037418 Ga0395900_0026515 Ga0395900_0026515_3980_4978 307
239 3300046501 Ga0495607_0002573 Ga0495607_0002573_2121_3116 307
240 3300046519 Ga0495632_0002342 Ga0495632_0002342_11110_12105 307
241 3300046522 Ga0495643_0000172 Ga0495643_0000172_8412_9407 307
242 3300046522 Ga0495643_0006631 Ga0495643_0006631_6334_7329 307
243 3300046538 Ga0495609_0022466 Ga0495609_0022466_981_1976 307
244 3300046542 Ga0495597_0006322 Ga0495597_0006322_2391_3386 307
245 3300046660 Ga0495625_0019960 Ga0495625_0019960_1033_2028 307
246 3300046665 Ga0495661_0002583 Ga0495661_0002583_11275_12270 307
247 3300046665 Ga0495661_0126462 Ga0495661_0126462_361_1356 307
248 3300046694 Ga0495649_0001053 Ga0495649_0001053_16817_17812 307
249 3300047445 Ga0495677_0000064 Ga0495677_0000064_2702_3697 307
250 3300047445 Ga0495677_0006796 Ga0495677_0006796_1597_2592 307
251 3300025913 Ga0207695_10028655 Ga0207695_100286552 308
252 3300037418 Ga0395900_0000426 Ga0395900_0000426_38660_39658 308
253 3300038443 Ga0395901_0000345 Ga0395901_0000345_13082_14080 308
254 3300044658 Ga0466972_0077329 Ga0466972_0077329_48_1046 308
255 3300044683 Ga0466965_0062806 Ga0466965_0062806_18_1016 308
256 3300044706 Ga0466964_0000328 Ga0466964_0000328_9734_10732 308
257 3300044735 Ga0466968_0000248 Ga0466968_0000248_6413_7411 308
258 3300046474 Ga0495605_0002423 Ga0495605_0002423_7451_8464 308
259 3300046491 Ga0495584_0033510 Ga0495584_0033510_133_1146 308
260 3300046501 Ga0495607_0003998 Ga0495607_0003998_4098_5111 308
261 3300046513 Ga0495616_0001206 Ga0495616_0001206_1862_2875 308
262 3300046522 Ga0495643_0005825 Ga0495643_0005825_797_1822 308
263 3300046538 Ga0495609_0000095 Ga0495609_0000095_37506_38519 308
264 3300046557 Ga0495622_0000001 Ga0495622_0000001_348992_350002 308
265 3300046648 Ga0495611_0123012 Ga0495611_0123012_129_1166 308
266 3300046665 Ga0495661_0000012 Ga0495661_0000012_209503_210516 308
267 3300046794 Ga0495589_0000007 Ga0495589_0000007_209143_210156 308
268 3300047320 Ga0495672_0000091 Ga0495672_0000091_46024_47049 308
269 3300047443 Ga0495687_000003 Ga0495687_000003_335183_336196 308
270 3300047445 Ga0495677_0000005 Ga0495677_0000005_66511_67524 308
271 3300048091 Ga0495626_0065622 Ga0495626_0065622_37_1050 308
272 3300048911 Ga0496108_0442658 Ga0496108_0442658_66_1067 308
273 3300048924 Ga0496121_0105686 Ga0496121_0105686_761_1852 308
274 3300049581 Ga0501047_0406060 Ga0501047_0406060_156_1154 308
275 3300049822 Ga0501035_0000507 Ga0501035_0000507_36111_37109 308
276 iso_pu_bacteria 2508501050 2508729194 308
277 iso_pu_bacteria 2835312727 2835312833 308
278 iso_pu_bacteria 2894232714 2894237119 308
279 3300002987 JGI25159J45721_1001322 JGI25159J45721_10013225 309
280 3300004625 Ga0055543_1013959 Ga0055543_10139592 309
281 3300005262 Ga0065165_1000003 Ga0065165_100000387 309
282 3300005563 Ga0068855_100028617 Ga0068855_1000286175 309
283 3300025284 Ga0209130_1000036 Ga0209130_1000036243 309
284 3300025919 Ga0207657_10105309 Ga0207657_101053092 309
285 3300025949 Ga0207667_10024480 Ga0207667_100244802 309
286 3300037312 Ga0395899_0000012 Ga0395899_0000012_20530_21528 309
287 3300042005 Ga0439448_0014397 Ga0439448_0014397_996_1994 309
288 3300044765 Ga0466970_0022089 Ga0466970_0022089_365_1354 309
289 3300045049 Ga0466959_0010694 Ga0466959_0010694_4525_5523 309
290 3300046455 Ga0495603_0007350 Ga0495603_0007350_1677_2666 309
291 3300046474 Ga0495605_0012340 Ga0495605_0012340_3672_4661 309
292 3300046491 Ga0495584_0000002 Ga0495584_0000002_290857_291855 309
293 3300046492 Ga0495585_0038100 Ga0495585_0038100_1396_2394 309
294 3300046499 Ga0495594_0032264 Ga0495594_0032264_1603_2592 309
295 3300046500 Ga0495596_0002375 Ga0495596_0002375_1375_2412 309
296 3300046506 Ga0495583_0000008 Ga0495583_0000008_25105_26100 309
297 3300046506 Ga0495583_0017886 Ga0495583_0017886_2234_3271 309
298 3300046512 Ga0495610_0064562 Ga0495610_0064562_284_1309 309
299 3300046513 Ga0495616_0000034 Ga0495616_0000034_17975_18964 309
300 3300046518 Ga0495631_0001368 Ga0495631_0001368_9364_10353 309
301 3300046518 Ga0495631_0024550 Ga0495631_0024550_120_1118 309
302 3300046519 Ga0495632_0000056 Ga0495632_0000056_39279_40268 309
303 3300046528 Ga0495642_0000061 Ga0495642_0000061_60588_61577 309
304 3300046528 Ga0495642_0050008 Ga0495642_0050008_72_1070 309
305 3300046530 Ga0495654_0005102 Ga0495654_0005102_679_1668 309
306 3300046542 Ga0495597_0015075 Ga0495597_0015075_1497_2495 309
307 3300046616 Ga0495668_0007041 Ga0495668_0007041_714_1712 309
308 3300046684 Ga0495669_0001370 Ga0495669_0001370_7242_8231 309
309 3300046810 Ga0495660_0000024 Ga0495660_0000024_43896_44903 309
310 3300047443 Ga0495687_000782 Ga0495687_000782_17190_18227 309
311 3300047443 Ga0495687_035800 Ga0495687_035800_455_1453 309
312 3300047470 Ga0495681_0000016 Ga0495681_0000016_83246_84235 309
313 3300048927 Ga0496124_0007226 Ga0496124_0007226_8609_9616 309
314 3300049459 Ga0495678_000002 Ga0495678_000002_250481_251488 309
315 3300053125 Ga0500618_000052 Ga0500618_000052_86107_87108 309
316 iso_pu_bacteria 2508501114 2509078014 309
317 3300003775 Ga0055524_1000017 Ga0055524_1000017107 310
318 3300006948 Ga0099826_10000008 Ga0099826_10000008363 310
319 3300017792 Ga0163161_10004278 Ga0163161_100042784 310
320 3300025263 Ga0209565_1013456 Ga0209565_10134562 310
321 3300025299 Ga0209256_1000018 Ga0209256_1000018371 310
322 3300027666 Ga0209282_1000005 Ga0209282_1000005361 310
323 3300044684 Ga0466966_0006807 Ga0466966_0006807_332_1330 310
324 3300046506 Ga0495583_0006361 Ga0495583_0006361_208_1233 310
325 3300046506 Ga0495583_0020143 Ga0495583_0020143_661_1686 310
326 3300046507 Ga0495606_0000049 Ga0495606_0000049_90638_91627 310
327 3300046507 Ga0495606_0025845 Ga0495606_0025845_850_1848 310
328 3300046507 Ga0495606_0105734 Ga0495606_0105734_208_1233 310
329 3300046512 Ga0495610_0011685 Ga0495610_0011685_1995_2990 310
330 3300046512 Ga0495610_0030026 Ga0495610_0030026_574_1563 310
331 3300046518 Ga0495631_0002535 Ga0495631_0002535_4120_5145 310
332 3300046519 Ga0495632_0000029 Ga0495632_0000029_41988_43013 310
333 3300046520 Ga0495637_0000051 Ga0495637_0000051_51656_52651 310
334 3300046528 Ga0495642_0002421 Ga0495642_0002421_4959_5984 310
335 3300046530 Ga0495654_0000011 Ga0495654_0000011_96110_97105 310
336 3300046542 Ga0495597_0030490 Ga0495597_0030490_933_1958 310
337 3300046558 Ga0495633_0002897 Ga0495633_0002897_7733_8722 310
338 3300046558 Ga0495633_0007427 Ga0495633_0007427_1044_2039 310
339 3300046558 Ga0495633_0039821 Ga0495633_0039821_525_1550 310
340 3300046616 Ga0495668_0000077 Ga0495668_0000077_90591_91580 310
341 3300046616 Ga0495668_0021366 Ga0495668_0021366_556_1581 310
342 3300046660 Ga0495625_0012866 Ga0495625_0012866_2956_3954 310
343 3300046674 Ga0495588_0015285 Ga0495588_0015285_1279_2316 310
344 3300047323 Ga0495683_0015805 Ga0495683_0015805_1876_2901 310
345 3300047443 Ga0495687_000002 Ga0495687_000002_811519_812544 310
346 3300047470 Ga0495681_0000175 Ga0495681_0000175_45814_46839 310
347 3300047470 Ga0495681_0002440 Ga0495681_0002440_11688_12713 310
348 3300047470 Ga0495681_0008215 Ga0495681_0008215_4871_5878 310
349 3300047472 Ga0495686_0010833 Ga0495686_0010833_796_1785 310
350 3300048091 Ga0495626_0028475 Ga0495626_0028475_930_1955 310
351 3300048091 Ga0495626_0043258 Ga0495626_0043258_186_1211 310
352 3300049459 Ga0495678_000818 Ga0495678_000818_23200_24225 310
353 3300049459 Ga0495678_000999 Ga0495678_000999_3119_4144 310
354 3300049460 Ga0495682_0000035 Ga0495682_0000035_30392_31417 310
355 3300053145 Ga0500586_000019 Ga0500586_000019_29501_30496 310
356 3300033180 Ga0307510_10012249 Ga0307510_100122496 311
357 3300038725 Ga0400484_07196 Ga0400484_07196_8925_9905 311
358 3300038741 Ga0400488_52627 Ga0400488_52627_1726_2709 311
359 3300039062 Ga0400483_093444 Ga0400483_093444_7682_8665 311
360 3300046463 Ga0495653_0046654 Ga0495653_0046654_2050_3051 311
361 3300046472 Ga0495580_0167276 Ga0495580_0167276_152_1153 311
362 3300046473 Ga0495582_0002835 Ga0495582_0002835_4600_5601 311
363 3300046499 Ga0495594_0025908 Ga0495594_0025908_400_1401 311
364 3300046517 Ga0495630_0002965 Ga0495630_0002965_2715_3716 311
365 3300046519 Ga0495632_0000018 Ga0495632_0000018_77361_78386 311
366 3300046526 Ga0495666_0044848 Ga0495666_0044848_947_1969 311
367 3300046529 Ga0495652_0028347 Ga0495652_0028347_300_1301 311
368 3300046531 Ga0495665_0007031 Ga0495665_0007031_1256_2257 311
369 3300046536 Ga0495587_0045822 Ga0495587_0045822_1098_2099 311
370 3300046558 Ga0495633_0000047 Ga0495633_0000047_34767_35762 311
371 3300046642 Ga0495634_0014246 Ga0495634_0014246_3834_4835 311
372 3300046679 Ga0495623_0063988 Ga0495623_0063988_658_1659 311
373 3300046810 Ga0495660_0038683 Ga0495660_0038683_1333_2370 311
374 3300047444 Ga0495675_0007908 Ga0495675_0007908_4234_5235 311
375 3300003794 Ga0055531_10026571 Ga0055531_100265712 312
376 3300025304 Ga0209257_1005941 Ga0209257_10059415 312
377 3300046460 Ga0495638_0043653 Ga0495638_0043653_1693_2685 312
378 3300046491 Ga0495584_0028294 Ga0495584_0028294_188_1180 312
379 3300046501 Ga0495607_0009612 Ga0495607_0009612_3280_4272 312
380 3300046506 Ga0495583_0015887 Ga0495583_0015887_531_1523 312
381 3300046507 Ga0495606_0006601 Ga0495606_0006601_2532_3533 312
382 3300046512 Ga0495610_0005569 Ga0495610_0005569_6389_7390 312
383 3300046513 Ga0495616_0024188 Ga0495616_0024188_1504_2496 312
384 3300046538 Ga0495609_0000227 Ga0495609_0000227_38581_39573 312
385 3300046615 Ga0495656_0051758 Ga0495656_0051758_530_1522 312
386 3300046616 Ga0495668_0018580 Ga0495668_0018580_2256_3248 312
387 3300046660 Ga0495625_0021134 Ga0495625_0021134_2967_3959 312
388 3300046694 Ga0495649_0147486 Ga0495649_0147486_74_1075 312
389 3300047318 Ga0495636_0001582 Ga0495636_0001582_6986_7978 312
390 3300047443 Ga0495687_027317 Ga0495687_027317_350_1342 312
391 3300047447 Ga0495685_009932 Ga0495685_009932_864_1856 312
392 3300047470 Ga0495681_0004883 Ga0495681_0004883_765_1757 312
393 3300053125 Ga0500618_002045 Ga0500618_002045_2049_3086 312
394 iso_pu_bacteria 2643221556 2643800780 313
395 iso_pu_bacteria 2643221684 2644471010 313
396 iso_pu_bacteria 2928130867 2928132844 313
397 iso_pu_bacteria 8047673197 8047677334 313
398 iso_pu_bacteria 2857564685 2857566455 314
399 3300049766 Ga0501269_000021 Ga0501269_000021_18704_19705 315
400 iso_pu_bacteria 2600255292 2601671513 315
401 iso_pu_bacteria 2643221664 2644355036 315
402 iso_pu_bacteria 2738541280 2738737809 315
403 iso_pu_bacteria 2857547612 2857548653 315
404 3300025935 Ga0207709_10038023 Ga0207709_100380232 316
405 3300046460 Ga0495638_0216129 Ga0495638_0216129_50_1060 316
406 3300046530 Ga0495654_0043499 Ga0495654_0043499_50_1060 316
407 3300046542 Ga0495597_0004338 Ga0495597_0004338_4072_5082 316
408 3300046664 Ga0495659_0000066 Ga0495659_0000066_6794_7804 316
409 3300046692 Ga0495671_0000119 Ga0495671_0000119_48696_49706 316
410 3300047320 Ga0495672_0000023 Ga0495672_0000023_330158_331168 316
411 iso_pu_bacteria 2842711865 2842713492 316
412 iso_pu_bacteria 2857558681 2857561403 316
413 iso_pu_bacteria 2904424332 2904424679 316
414 iso_pu_bacteria 2548876994 2550696110 317
415 3300002774 JGI25150J39212_1004487 JGI25150J39212_10044872 318
416 3300003187 JGI25151J46595_10028459 JGI25151J46595_100284592 318
417 3300003322 rootL2_10193562 rootL2_101935622 318
418 3300003792 Ga0055540_1021515 Ga0055540_10215151 318
419 3300025245 Ga0207425_1007136 Ga0207425_10071362 318
420 3300025294 Ga0209025_1004632 Ga0209025_10046327 318
421 3300025297 Ga0209758_1000515 Ga0209758_100051516 318
422 3300025303 Ga0209051_1003205 Ga0209051_10032055 318
423 3300025304 Ga0209257_1052610 Ga0209257_10526101 318
424 3300046542 Ga0495597_0008666 Ga0495597_0008666_2908_3915 318
425 3300046660 Ga0495625_0031980 Ga0495625_0031980_647_1654 318
426 3300046810 Ga0495660_0009629 Ga0495660_0009629_420_1430 318
427 3300046810 Ga0495660_0020108 Ga0495660_0020108_2633_3640 318
428 3300047472 Ga0495686_0024318 Ga0495686_0024318_1649_2659 318
429 iso_pu_bacteria 2765235838 2765567915 318
430 iso_pu_bacteria 2839094727 2839097798 318
431 3300002739 JGI25158J39367_1000604 JGI25158J39367_10006044 319
432 3300003771 Ga0055526_1010383 Ga0055526_10103834 319
433 3300003775 Ga0055524_1006868 Ga0055524_10068683 319
434 3300003790 Ga0055528_1011001 Ga0055528_10110012 319
435 3300003791 Ga0055530_10004218 Ga0055530_100042184 319
436 3300003791 Ga0055530_10013500 Ga0055530_100135002 319
437 3300003794 Ga0055531_10003399 Ga0055531_100033996 319
438 3300025208 Ga0209436_100320 Ga0209436_10032010 319
439 3300025245 Ga0207425_1000110 Ga0207425_100011014 319
440 3300025258 Ga0209129_1001089 Ga0209129_10010895 319
441 3300025263 Ga0209565_1004968 Ga0209565_10049682 319
442 3300025273 Ga0209673_1011152 Ga0209673_10111523 319
443 3300025298 Ga0209050_1000519 Ga0209050_100051914 319
444 3300025298 Ga0209050_1005791 Ga0209050_10057915 319
445 3300025298 Ga0209050_1005858 Ga0209050_10058584 319
446 3300025302 Ga0207426_1004689 Ga0207426_10046895 319
447 3300025304 Ga0209257_1000123 Ga0209257_100012365 319
448 3300030745 Ga0316182_1217112 Ga0316182_12171122 319
449 3300031548 Ga0307408_100003242 Ga0307408_1000032426 319
450 3300031548 Ga0307408_100011556 Ga0307408_1000115563 319
451 3300046452 Ga0495617_002223 Ga0495617_002223_1353_2351 319
452 3300046452 Ga0495617_002279 Ga0495617_002279_2026_3024 319
453 3300046457 Ga0495590_0008210 Ga0495590_0008210_1076_2074 319
454 3300046460 Ga0495638_0007732 Ga0495638_0007732_2427_3425 319
455 3300046474 Ga0495605_0002136 Ga0495605_0002136_11297_12295 319
456 3300046491 Ga0495584_0000317 Ga0495584_0000317_4734_5732 319
457 3300046492 Ga0495585_0003241 Ga0495585_0003241_7117_8115 319
458 3300046492 Ga0495585_0009267 Ga0495585_0009267_4032_5030 319
459 3300046501 Ga0495607_0004639 Ga0495607_0004639_3149_4147 319
460 3300046501 Ga0495607_0007603 Ga0495607_0007603_1314_2312 319
461 3300046506 Ga0495583_0000053 Ga0495583_0000053_71063_72061 319
462 3300046513 Ga0495616_0006183 Ga0495616_0006183_4995_5993 319
463 3300046513 Ga0495616_0008721 Ga0495616_0008721_2270_3268 319
464 3300046523 Ga0495644_0000766 Ga0495644_0000766_1659_2657 319
465 3300046523 Ga0495644_0000768 Ga0495644_0000768_10572_11570 319
466 3300046524 Ga0495648_0002548 Ga0495648_0002548_1728_2726 319
467 3300046538 Ga0495609_0000180 Ga0495609_0000180_17956_18954 319
468 3300046557 Ga0495622_0068954 Ga0495622_0068954_612_1610 319
469 3300046558 Ga0495633_0001785 Ga0495633_0001785_13543_14541 319
470 3300046615 Ga0495656_0002389 Ga0495656_0002389_1461_2459 319
471 3300046616 Ga0495668_0122816 Ga0495668_0122816_45_1067 319
472 3300046648 Ga0495611_0000973 Ga0495611_0000973_1570_2568 319
473 3300046660 Ga0495625_0013954 Ga0495625_0013954_3996_4994 319
474 3300046664 Ga0495659_0000375 Ga0495659_0000375_9801_10799 319
475 3300046691 Ga0495670_0008506 Ga0495670_0008506_1341_2339 319
476 3300046692 Ga0495671_0000861 Ga0495671_0000861_18299_19297 319
477 3300047318 Ga0495636_0001544 Ga0495636_0001544_3773_4771 319
478 3300047320 Ga0495672_0006907 Ga0495672_0006907_4981_5979 319
479 3300047320 Ga0495672_0008784 Ga0495672_0008784_3999_4997 319
480 3300047323 Ga0495683_0001182 Ga0495683_0001182_14774_15772 319
481 3300047443 Ga0495687_000509 Ga0495687_000509_39885_40883 319
482 3300047445 Ga0495677_0007169 Ga0495677_0007169_1517_2515 319
483 3300047447 Ga0495685_008888 Ga0495685_008888_679_1677 319
484 3300047469 Ga0495673_0011118 Ga0495673_0011118_998_1996 319
485 3300048928 Ga0496125_0003043 Ga0496125_0003043_6736_7815 319
486 3300049459 Ga0495678_001177 Ga0495678_001177_6512_7510 319
487 3300049460 Ga0495682_0000041 Ga0495682_0000041_103065_104063 319
488 iso_pu_bacteria 2643221645 2644252917 319
489 iso_pu_bacteria 2738541300 2738842016 319
490 iso_pu_bacteria 2738543018 2739272875 319
491 iso_pu_bacteria 2738543030 2739341919 319

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02653

BPD_transp_2

Branched-chain amino acid transport system / permease component

55

324

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
7kyp-assembly4.cif.gz_N psabc from streptococcus pneumoniae in complex with fab 0.5493 37 297
7kyp-assembly4.cif.gz_N psabc from streptococcus pneumoniae in complex with fab 0.5138 37 297
7lb8-assembly1.cif.gz_B structure of a ferrichrome importer fhucdb from e. coli 0.4899 9 294
7lb8-assembly1.cif.gz_B structure of a ferrichrome importer fhucdb from e. coli 0.4512 9 294
5b57-assembly1.cif.gz_A inward-facing conformation of abc heme importer bhuuv from burkholderia cenocepacia 0.4506 8 299
ID Description Score Start End Superfamily
af_P0AE26_50_315_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.884 35 292 1.10.3470.10
af_P23200_41_325_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8765 35 292 1.10.3470.10
af_P0AGI1_45_314_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8759 35 292 1.10.3470.10
af_P0AGI4_56_383_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8742 36 292 1.10.3470.10
af_P77672_36_301_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8682 35 291 1.10.3470.10
ID Description Score Start End GO Terms
AF-A0A4U8Q3K5-F1-model_v4 Ribose transport system permease protein RbsC 0.9168 7 300 GO:0005886
GO:0022857
AF-A0A520T5J4-F1-model_v4 Autoinducer 2 import system permease protein LsrC 0.9153 2 298 GO:0005886
GO:0022857
AF-A0A3G8YQC5-F1-model_v4 Autoinducer 2 import system permease protein LsrC 0.9139 5 300 GO:0005886
GO:0022857
AF-A0A4R8V2Z9-F1-model_v4 ABC transporter permease 0.9126 6 300 GO:0005886
GO:0022857
AF-A0A2L1CSI7-F1-model_v4 deleted 0.9124 2 300

Feature Viewer

pLDDT pTM Quality
77.32 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map