F454138

General Info

Members Datasets Scaffolds Average Seq Length
491 224 491 135

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_1179775|Ga0395900_1179775_81_485
Length 134
Sequence MKRFVSVGLALAVLVTIGCTSAMAQQTAPPSNYKKVSTLVSLPDFLPGLGTLSSDPTTLPAGPFLAYDRQGNLTGNLVSSVYMIPIKDITAHKAFNNLTAAKEKVDHVDMYYNAGHPGVAEPHYHVVVWYVSPE

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
3 3300003503 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM Metagenome Rhizosphere
4 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
98 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
159 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
160 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
161 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
162 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
163 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
164 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
165 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
166 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
168 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
169 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
170 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
171 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
172 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
173 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
174 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
175 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
176 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
177 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
178 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
179 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
180 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
181 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
182 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
183 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
184 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
185 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
186 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
187 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
188 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
199 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
200 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
201 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
202 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
203 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
204 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
205 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
206 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
207 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
208 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
209 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
210 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
212 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
213 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
214 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
215 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
216 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
217 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
218 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
219 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
220 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
221 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
222 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
223 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
224 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.59
Metatranscriptomes 0.41
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.22
Rhizosphere 98.78
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_5267707 2162886012 Bacteria 911
2 JGI26129J50193_1003694 3300003349 Bacteria 1075
3 JGI26129J50193_1003731 3300003349 Bacteria 1070
4 JGI26141J51220_1004997 3300003503 Bacteria 826
5 Ga0058861_11463597 3300004800 Archaea 530
6 Ga0065715_10046420 3300005293 Bacteria 1283
7 Ga0065707_10817518 3300005295 Unclassified 593
8 Ga0070676_10001558 3300005328 Bacteria 11619
9 Ga0070683_100288738 3300005329 Bacteria 1560
10 Ga0070683_100325943 3300005329 Bacteria 1462
11 Ga0070670_100002153 3300005331 Bacteria 16171
12 Ga0070670_100004934 3300005331 Bacteria 11224
13 Ga0070677_10419344 3300005333 Bacteria 709
14 Ga0068869_100000915 3300005334 Bacteria 16997
15 Ga0070666_10125962 3300005335 Bacteria 1778
16 Ga0070680_100001714 3300005336 Bacteria 16108
17 Ga0070680_100004155 3300005336 Bacteria 10845
18 Ga0070682_100000361 3300005337 Bacteria 30657
19 Ga0070682_100010766 3300005337 Bacteria 5200
20 Ga0068868_100042524 3300005338 Bacteria 3547
21 Ga0070660_100000917 3300005339 Bacteria 19715
22 Ga0070660_100002424 3300005339 Bacteria 12816
23 Ga0070689_100164683 3300005340 Bacteria 1794
24 Ga0070691_10007358 3300005341 Bacteria 5039
25 Ga0070691_10008364 3300005341 Bacteria 4739
26 Ga0070691_10111598 3300005341 Unclassified 1368
27 Ga0070687_100042692 3300005343 Bacteria 2299
28 Ga0070687_100120032 3300005343 Bacteria 1502
29 Ga0070661_100001962 3300005344 Bacteria 14212
30 Ga0070661_100080322 3300005344 Bacteria 2407
31 Ga0070692_10004889 3300005345 Bacteria 5643
32 Ga0070692_10013809 3300005345 Bacteria 3775
33 Ga0070669_100093841 3300005353 Bacteria 2254
34 Ga0070669_100417398 3300005353 Unclassified 1101
35 Ga0070675_100669026 3300005354 Archaea 944
36 Ga0070671_100363783 3300005355 Unclassified 1235
37 Ga0070673_100021626 3300005364 Bacteria 4668
38 Ga0070673_100340743 3300005364 Bacteria 1328
39 Ga0070659_100000893 3300005366 Bacteria 21822
40 Ga0070659_100004010 3300005366 Bacteria 10478
41 Ga0070667_100042041 3300005367 Bacteria 3834
42 Ga0070703_10001818 3300005406 Bacteria 6304
43 Ga0070703_10004675 3300005406 Bacteria 3829
44 Ga0070701_10028151 3300005438 Bacteria 2761
45 Ga0070701_10179593 3300005438 Unclassified 1238
46 Ga0070705_100006293 3300005440 Bacteria 5817
47 Ga0070705_100036559 3300005440 Bacteria 2762
48 Ga0070700_100172270 3300005441 Bacteria 1499
49 Ga0070694_100000499 3300005444 Bacteria 21543
50 Ga0070694_100008750 3300005444 Bacteria 6202
51 Ga0070694_100021251 3300005444 Bacteria 4144
52 Ga0070694_100339941 3300005444 Unclassified 1160
53 Ga0070694_100642355 3300005444 Unclassified 858
54 Ga0070708_100197643 3300005445 Unclassified 1882
55 Ga0070708_100448463 3300005445 Unclassified 1217
56 Ga0070708_100483389 3300005445 Bacteria 1168
57 Ga0070663_100002089 3300005455 Bacteria 11172
58 Ga0070663_100013915 3300005455 Bacteria 5148
59 Ga0070662_100010504 3300005457 Bacteria 6080
60 Ga0070662_100010867 3300005457 Bacteria 5996
61 Ga0070662_100132864 3300005457 Unclassified 1921
62 Ga0070681_10009198 3300005458 Bacteria 9709
63 Ga0068867_100005900 3300005459 Bacteria 8690
64 Ga0068867_100010571 3300005459 Bacteria 6510
65 Ga0070706_100058016 3300005467 Bacteria 3573
66 Ga0070706_101044531 3300005467 Bacteria 753
67 Ga0070699_100024797 3300005518 Bacteria 5171
68 Ga0070699_100203895 3300005518 Bacteria 1759
69 Ga0070699_100219313 3300005518 Bacteria 1695
70 Ga0070699_100444568 3300005518 Bacteria 1175
71 Ga0070679_100022227 3300005530 Bacteria 6199
72 Ga0070679_100064903 3300005530 Bacteria 3639
73 Ga0070684_100074670 3300005535 Bacteria 2989
74 Ga0070697_100025172 3300005536 Bacteria 4745
75 Ga0070697_100029295 3300005536 Bacteria 4412
76 Ga0070697_100379952 3300005536 Bacteria 1223
77 Ga0070697_100435911 3300005536 Unclassified 1140
78 Ga0068853_100000718 3300005539 Bacteria 22893
79 Ga0068853_100004223 3300005539 Bacteria 11090
80 Ga0070672_100059311 3300005543 Bacteria 3011
81 Ga0070672_100084153 3300005543 Bacteria 2554
82 Ga0070695_100014855 3300005545 Bacteria 4698
83 Ga0070695_100017252 3300005545 Bacteria 4376
84 Ga0070695_100076568 3300005545 Bacteria 2203
85 Ga0070695_100232491 3300005545 Archaea 1333
86 Ga0070695_100234375 3300005545 Bacteria 1328
87 Ga0070696_100000744 3300005546 Bacteria 20821
88 Ga0070696_100628952 3300005546 Unclassified 868
89 Ga0070696_100934194 3300005546 Unclassified 721
90 Ga0070693_100001004 3300005547 Bacteria 12585
91 Ga0070693_100001876 3300005547 Bacteria 9604
92 Ga0070704_100002669 3300005549 Bacteria 10078
93 Ga0070704_100025591 3300005549 Bacteria 3887
94 Ga0070704_100350382 3300005549 Unclassified 1246
95 Ga0068855_100006676 3300005563 Bacteria 14009
96 Ga0068855_100016627 3300005563 Bacteria 8844
97 Ga0070664_100122367 3300005564 Bacteria 2279
98 Ga0070664_100397166 3300005564 Unclassified 1260
99 Ga0068857_100110584 3300005577 Bacteria 2469
100 Ga0068854_100001067 3300005578 Bacteria 16480
101 Ga0068854_100002481 3300005578 Bacteria 11419
102 Ga0068856_100000657 3300005614 Bacteria 37435
103 Ga0068856_100002693 3300005614 Bacteria 18214
104 Ga0068856_101708073 3300005614 Bacteria 642
105 Ga0068852_101684321 3300005616 Bacteria 657
106 Ga0068859_100002307 3300005617 Bacteria 19385
107 Ga0068859_100008017 3300005617 Bacteria 10707
108 Ga0068859_101746687 3300005617 Unclassified 687
109 Ga0068864_100007171 3300005618 Bacteria 9154
110 Ga0068864_100022555 3300005618 Bacteria 5279
111 Ga0068864_100263434 3300005618 Bacteria 1604
112 Ga0068861_100170589 3300005719 Bacteria 1803
113 Ga0068870_10001412 3300005840 Bacteria 9696
114 Ga0068870_10007916 3300005840 Bacteria 4755
115 Ga0068863_100014736 3300005841 Bacteria 7522
116 Ga0068858_100140914 3300005842 Bacteria 2263
117 Ga0068858_100988614 3300005842 Unclassified 824
118 Ga0068860_100016989 3300005843 Bacteria 7091
119 Ga0068860_100040043 3300005843 Bacteria 4481
120 Ga0068860_100469315 3300005843 Bacteria 1253
121 Ga0068862_100003169 3300005844 Bacteria 14277
122 Ga0068862_100023673 3300005844 Bacteria 5147
123 Ga0081455_10000459 3300005937 Bacteria 53464
124 Ga0097621_100215618 3300006237 Bacteria 1671
125 Ga0097621_100310751 3300006237 Unclassified 1394
126 Ga0068871_100913314 3300006358 Bacteria 814
127 Ga0075428_100016385 3300006844 Bacteria 8190
128 Ga0075430_100040832 3300006846 Bacteria 3926
129 Ga0075430_100053048 3300006846 Bacteria 3414
130 Ga0075431_100024330 3300006847 Bacteria 6204
131 Ga0075431_100050719 3300006847 Bacteria 4278
132 Ga0075431_100871004 3300006847 Unclassified 871
133 Ga0075433_10053938 3300006852 Bacteria 3506
134 Ga0075433_10075386 3300006852 Unclassified 2968
135 Ga0075433_10078579 3300006852 Bacteria 2907
136 Ga0075433_10427972 3300006852 Unclassified 1167
137 Ga0075433_11148062 3300006852 Unclassified 675
138 Ga0075434_100045789 3300006871 Bacteria 4340
139 Ga0075434_100056774 3300006871 Bacteria 3891
140 Ga0075434_100059059 3300006871 Bacteria 3813
141 Ga0075434_100683592 3300006871 Unclassified 1044
142 Ga0075434_101316881 3300006871 Unclassified 733
143 Ga0075429_100057820 3300006880 Bacteria 3377
144 Ga0075429_100069272 3300006880 Bacteria 3072
145 Ga0068865_100086254 3300006881 Bacteria 2266
146 Ga0068865_100383887 3300006881 Archaea 1146
147 Ga0075436_100024960 3300006914 Bacteria 4110
148 Ga0075436_100038970 3300006914 Unclassified 3279
149 Ga0075436_100343935 3300006914 Unclassified 1074
150 Ga0075436_100567628 3300006914 Unclassified 834
151 Ga0097620_100002307 3300006931 Bacteria 19385
152 Ga0097620_100008017 3300006931 Bacteria 10707
153 Ga0097620_101746685 3300006931 Unclassified 687
154 Ga0075435_100074178 3300007076 Unclassified 2782
155 Ga0075435_100115265 3300007076 Bacteria 2237
156 Ga0075435_100247500 3300007076 Archaea 1517
157 Ga0105245_10309898 3300009098 Bacteria 1552
158 Ga0114129_10000296 3300009147 Bacteria 57617
159 Ga0114129_10014823 3300009147 Bacteria 11108
160 Ga0114129_10186281 3300009147 Bacteria 2820
161 Ga0114129_10318392 3300009147 Unclassified 2068
162 Ga0114129_10396778 3300009147 Bacteria 1819
163 Ga0114129_10500867 3300009147 Archaea 1586
164 Ga0114129_10646298 3300009147 Unclassified 1366
165 Ga0105243_10308560 3300009148 Unclassified 1437
166 Ga0105241_10000117 3300009174 Bacteria 57559
167 Ga0105241_10000226 3300009174 Bacteria 42618
168 Ga0105241_11494472 3300009174 Bacteria 650
169 Ga0105248_10694971 3300009177 Unclassified 1148
170 Ga0105238_11562727 3300009551 Bacteria 689
171 Ga0105239_10157663 3300010375 Bacteria 2536
172 Ga0105246_10106502 3300011119 Bacteria 2051
173 Ga0157373_10001301 3300013100 Bacteria 19055
174 Ga0157373_10017135 3300013100 Bacteria 5276
175 Ga0157371_10328412 3300013102 Bacteria 1111
176 Ga0157371_11388632 3300013102 Unclassified 545
177 Ga0157370_10714060 3300013104 Unclassified 914
178 Ga0157369_10197703 3300013105 Bacteria 2110
179 Ga0157369_10222234 3300013105 Bacteria 1977
180 Ga0157374_10201360 3300013296 Bacteria 1950
181 Ga0157378_10186556 3300013297 Unclassified 1954
182 Ga0157378_11487532 3300013297 Archaea 722
183 Ga0163162_10611620 3300013306 Archaea 1215
184 Ga0157372_10000368 3300013307 Bacteria 50004
185 Ga0157372_10005197 3300013307 Bacteria 13834
186 Ga0157372_10096360 3300013307 Bacteria 3371
187 Ga0157375_10156776 3300013308 Bacteria 2416
188 Ga0163163_10078723 3300014325 Bacteria 3294
189 Ga0157380_10757549 3300014326 Unclassified 983
190 Ga0182008_10033732 3300014497 Bacteria 2568
191 Ga0157377_11697066 3300014745 Unclassified 509
192 Ga0182007_10022160 3300015262 Bacteria 2247
193 Ga0206353_11256221 3300020082 Archaea 1363
194 Ga0207653_10001798 3300025885 Bacteria 6851
195 Ga0207688_10019302 3300025901 Bacteria 3712
196 Ga0207680_10527309 3300025903 Archaea 842
197 Ga0207647_10047283 3300025904 Bacteria 2677
198 Ga0207647_10079931 3300025904 Unclassified 1962
199 Ga0207645_10001314 3300025907 Bacteria 20402
200 Ga0207645_10001584 3300025907 Bacteria 18542
201 Ga0207643_10000263 3300025908 Bacteria 36580
202 Ga0207684_10008247 3300025910 Bacteria 9276
203 Ga0207684_10012965 3300025910 Bacteria 7217
204 Ga0207684_10860387 3300025910 Bacteria 764
205 Ga0207654_10002844 3300025911 Bacteria 8773
206 Ga0207654_10016614 3300025911 Bacteria 3835
207 Ga0207654_10597232 3300025911 Bacteria 787
208 Ga0207707_10000092 3300025912 Bacteria 90462
209 Ga0207707_10000251 3300025912 Bacteria 58978
210 Ga0207707_11295942 3300025912 Bacteria 585
211 Ga0207660_10000638 3300025917 Bacteria 23576
212 Ga0207660_10005982 3300025917 Bacteria 7901
213 Ga0207662_10043478 3300025918 Bacteria 2650
214 Ga0207657_10000288 3300025919 Bacteria 53618
215 Ga0207657_10000385 3300025919 Bacteria 46501
216 Ga0207649_10001718 3300025920 Bacteria 12596
217 Ga0207649_10013442 3300025920 Bacteria 4571
218 Ga0207646_10621420 3300025922 Unclassified 969
219 Ga0207646_11228438 3300025922 Bacteria 656
220 Ga0207681_10044076 3300025923 Bacteria 2989
221 Ga0207681_10326824 3300025923 Archaea 1221
222 Ga0207650_10099198 3300025925 Bacteria 2239
223 Ga0207650_10411982 3300025925 Archaea 1120
224 Ga0207659_11439237 3300025926 Archaea 590
225 Ga0207690_10006256 3300025932 Bacteria 7049
226 Ga0207690_10011388 3300025932 Bacteria 5320
227 Ga0207706_10005447 3300025933 Bacteria 11859
228 Ga0207706_10013315 3300025933 Bacteria 7484
229 Ga0207706_10147799 3300025933 Bacteria 2067
230 Ga0207670_10218886 3300025936 Bacteria 1456
231 Ga0207670_10595476 3300025936 Unclassified 907
232 Ga0207704_10092330 3300025938 Bacteria 1992
233 Ga0207704_10468807 3300025938 Archaea 1009
234 Ga0207691_10089564 3300025940 Bacteria 2759
235 Ga0207691_10202175 3300025940 Unclassified 1729
236 Ga0207689_10000020 3300025942 Bacteria 110705
237 Ga0207689_10000204 3300025942 Bacteria 52389
238 Ga0207689_11168208 3300025942 Unclassified 648
239 Ga0207679_10001699 3300025945 Bacteria 13720
240 Ga0207679_10064005 3300025945 Bacteria 2747
241 Ga0207667_10004018 3300025949 Bacteria 18078
242 Ga0207667_10030230 3300025949 Bacteria 5862
243 Ga0207651_10034304 3300025960 Bacteria 3285
244 Ga0207651_10038491 3300025960 Bacteria 3145
245 Ga0207640_10005348 3300025981 Bacteria 6999
246 Ga0207658_10097166 3300025986 Bacteria 2299
247 Ga0207703_10095011 3300026035 Bacteria 2514
248 Ga0207639_10001053 3300026041 Bacteria 18742
249 Ga0207639_10002525 3300026041 Bacteria 12274
250 Ga0207678_10000861 3300026067 Bacteria 27863
251 Ga0207678_10002484 3300026067 Bacteria 16760
252 Ga0207708_10040856 3300026075 Bacteria 3537
253 Ga0207702_10070812 3300026078 Bacteria 3000
254 Ga0207702_10149663 3300026078 Bacteria 2122
255 Ga0207641_10095708 3300026088 Bacteria 2607
256 Ga0207641_10121992 3300026088 Bacteria 2327
257 Ga0207648_10001946 3300026089 Bacteria 22583
258 Ga0207648_10004244 3300026089 Bacteria 14810
259 Ga0207676_10075372 3300026095 Bacteria 2721
260 Ga0207676_10418798 3300026095 Bacteria 1256
261 Ga0207674_10004155 3300026116 Bacteria 17506
262 Ga0207675_100006043 3300026118 Bacteria 11517
263 Ga0207675_100025223 3300026118 Bacteria 5533
264 Ga0207675_100943935 3300026118 Bacteria 880
265 Ga0207698_11651313 3300026142 Bacteria 656
266 Ga0209969_1017093 3300027360 Bacteria 1067
267 Ga0209969_1076962 3300027360 Unclassified 532
268 Ga0209967_1010848 3300027364 Bacteria 1273
269 Ga0209981_1003008 3300027378 Unclassified 2169
270 Ga0209981_1003495 3300027378 Bacteria 2041
271 Ga0209996_1000773 3300027395 Bacteria 3791
272 Ga0209984_1002013 3300027424 Bacteria 2246
273 Ga0210000_1018882 3300027462 Bacteria 1048
274 Ga0209995_1007327 3300027471 Bacteria 1779
275 Ga0209995_1027362 3300027471 Bacteria 951
276 Ga0209968_1028535 3300027526 Bacteria 927
277 Ga0209968_1042450 3300027526 Unclassified 779
278 Ga0209968_1047925 3300027526 Unclassified 738
279 Ga0209999_1021250 3300027543 Bacteria 1191
280 Ga0209982_1028818 3300027552 Bacteria 870
281 Ga0209970_1003113 3300027614 Bacteria 2800
282 Ga0209970_1012271 3300027614 Bacteria 1415
283 Ga0210002_1002103 3300027617 Bacteria 2873
284 Ga0210002_1045896 3300027617 Unclassified 748
285 Ga0209983_1000285 3300027665 Bacteria 10567
286 Ga0209983_1001652 3300027665 Bacteria 4937
287 Ga0209971_1000012 3300027682 Bacteria 74016
288 Ga0209971_1000065 3300027682 Bacteria 33190
289 Ga0209966_1000364 3300027695 Bacteria 13847
290 Ga0209966_1001163 3300027695 Bacteria 4702
291 Ga0209998_10000178 3300027717 Bacteria 23073
292 Ga0209998_10000805 3300027717 Bacteria 8080
293 Ga0209998_10048111 3300027717 Unclassified 981
294 Ga0209974_10000062 3300027876 Bacteria 28637
295 Ga0209974_10000636 3300027876 Bacteria 11810
296 Ga0268266_12199187 3300028379 Bacteria 524
297 Ga0268265_10511270 3300028380 Unclassified 1133
298 Ga0268265_11672991 3300028380 Unclassified 642
299 Ga0268264_10010891 3300028381 Bacteria 7513
300 Ga0268264_10186629 3300028381 Bacteria 1887
301 Ga0268264_10321266 3300028381 Bacteria 1464
302 Ga0307409_100448344 3300031995 Unclassified 1245
303 Ga0373950_0008304 3300034818 Bacteria 1631
304 Ga0373940_0082815 3300035088 Archaea 951
305 Ga0373951_0010971 3300035091 Bacteria 2034
306 Ga0373951_0017377 3300035091 Archaea 1627
307 Ga0373932_0377463 3300035112 Bacteria 544
308 Ga0373960_0007164 3300035121 Bacteria 2635
309 Ga0373960_0060471 3300035121 Unclassified 1148
310 Ga0373961_0014436 3300035241 Bacteria 2006
311 Ga0373962_0026633 3300035242 Bacteria 1560
312 Ga0373962_0118423 3300035242 Bacteria 842
313 Ga0373937_0315962 3300036401 Bacteria 1478
314 Ga0395900_1179775 3300037418 Unclassified 681
315 Ga0395905_0149047 3300037471 Bacteria 2201
316 Ga0439448_0003118 3300042005 Bacteria 4566
317 Ga0439448_0182520 3300042005 Unclassified 734
318 Ga0439455_0110320 3300042012 Bacteria 765
319 Ga0439463_060167 3300042016 Bacteria 971
320 Ga0450889_008216 3300042144 Bacteria 1058
321 Ga0439446_0064670 3300042156 Bacteria 1111
322 Ga0439434_0187240 3300042435 Unclassified 695
323 Ga0439459_0001124 3300042438 Bacteria 3866
324 Ga0439464_0316731 3300042439 Unclassified 511
325 Ga0451577_0283377 3300042876 Bacteria 1501
326 Ga0451577_0831479 3300042876 Bacteria 833
327 Ga0439440_0076556 3300042993 Bacteria 879
328 Ga0453683_1006015 3300044673 Bacteria 554
329 Ga0453684_0177886 3300044712 Bacteria 2500
330 Ga0453684_1152627 3300044712 Bacteria 816
331 Ga0451576_0076879 3300045051 Bacteria 3474
332 Ga0451576_0103929 3300045051 Bacteria 2955
333 Ga0451576_0195156 3300045051 Bacteria 2114
334 Ga0451576_0246052 3300045051 Bacteria 1869
335 Ga0451576_0274791 3300045051 Unclassified 1761
336 Ga0451576_0394154 3300045051 Bacteria 1451
337 Ga0451576_0948839 3300045051 Unclassified 902
338 Ga0466967_2369055 3300045976 Bacteria 526
339 Ga0496102_0124890 3300048905 Bacteria 2405
340 Ga0496102_0320066 3300048905 Unclassified 1461
341 Ga0496106_0119036 3300048909 Bacteria 2063
342 Ga0496110_0133732 3300048913 Bacteria 2241
343 Ga0496112_0241108 3300048915 Bacteria 1760
344 Ga0496112_0392010 3300048915 Bacteria 1329
345 Ga0501298_077931 3300049521 Bacteria 725
346 Ga0501036_0246734 3300049572 Bacteria 1497
347 Ga0501036_0380543 3300049572 Bacteria 1178
348 Ga0501037_0622766 3300049573 Unclassified 723
349 Ga0501038_0153369 3300049574 Bacteria 1877
350 Ga0501039_0384394 3300049575 Bacteria 1103
351 Ga0501040_0035197 3300049576 Bacteria 3395
352 Ga0501040_0136794 3300049576 Bacteria 1725
353 Ga0501040_0292508 3300049576 Bacteria 1164
354 Ga0501041_0035817 3300049577 Bacteria 3008
355 Ga0501041_0729658 3300049577 Archaea 634
356 Ga0501041_0971307 3300049577 Unclassified 546
357 Ga0501042_0025537 3300049578 Unclassified 4150
358 Ga0501042_0104175 3300049578 Bacteria 2041
359 Ga0501042_0133040 3300049578 Unclassified 1792
360 Ga0501043_0060397 3300049579 Bacteria 2976
361 Ga0501043_0708608 3300049579 Unclassified 735
362 Ga0501043_0845745 3300049579 Unclassified 659
363 Ga0501046_0115196 3300049580 Bacteria 2050
364 Ga0501048_0197530 3300049582 Bacteria 1426
365 Ga0501067_0130347 3300049583 Bacteria 1400
366 Ga0501068_0107184 3300049584 Unclassified 1735
367 Ga0501068_0224202 3300049584 Bacteria 1195
368 Ga0501068_0387052 3300049584 Bacteria 901
369 Ga0501068_0663651 3300049584 Unclassified 681
370 Ga0501068_0989588 3300049584 Unclassified 555
371 Ga0501071_0049557 3300049587 Bacteria 3024
372 Ga0501071_0059429 3300049587 Bacteria 2766
373 Ga0501071_0080951 3300049587 Unclassified 2376
374 Ga0501071_0220697 3300049587 Bacteria 1427
375 Ga0501071_0808989 3300049587 Bacteria 723
376 Ga0501072_0006351 3300049588 Bacteria 8997
377 Ga0501072_0058365 3300049588 Bacteria 3042
378 Ga0501072_0081737 3300049588 Bacteria 2561
379 Ga0501072_0308993 3300049588 Bacteria 1257
380 Ga0501073_0266213 3300049589 Bacteria 1183
381 Ga0501074_0074888 3300049590 Bacteria 2431
382 Ga0501074_0341089 3300049590 Bacteria 1064
383 Ga0501074_0404214 3300049590 Bacteria 968
384 Ga0501074_0608400 3300049590 Bacteria 773
385 Ga0501075_0089845 3300049591 Bacteria 2330
386 Ga0501075_0112460 3300049591 Bacteria 2071
387 Ga0501075_0118239 3300049591 Bacteria 2015
388 Ga0501075_0135247 3300049591 Bacteria 1878
389 Ga0501075_0168454 3300049591 Bacteria 1671
390 Ga0501075_0989730 3300049591 Bacteria 639
391 Ga0501076_0015791 3300049592 Bacteria 5711
392 Ga0501076_0030047 3300049592 Bacteria 4231
393 Ga0501076_0078837 3300049592 Bacteria 2643
394 Ga0501076_0101698 3300049592 Unclassified 2317
395 Ga0501076_0141314 3300049592 Bacteria 1956
396 Ga0501076_1319278 3300049592 Bacteria 593
397 Ga0501076_1322068 3300049592 Unclassified 593
398 Ga0501076_1515527 3300049592 Unclassified 550
399 Ga0501077_0117425 3300049593 Bacteria 1686
400 Ga0501077_0253163 3300049593 Bacteria 1120
401 Ga0501077_0295773 3300049593 Bacteria 1031
402 Ga0501077_0299598 3300049593 Bacteria 1024
403 Ga0501077_0356198 3300049593 Unclassified 934
404 Ga0501077_0742570 3300049593 Archaea 631
405 Ga0501079_0033351 3300049741 Bacteria 3961
406 Ga0501079_0080747 3300049741 Bacteria 2514
407 Ga0501079_0189869 3300049741 Bacteria 1603
408 Ga0501079_0373734 3300049741 Unclassified 1117
409 Ga0501079_0397099 3300049741 Bacteria 1081
410 Ga0501079_0471141 3300049741 Bacteria 987
411 Ga0501079_0867446 3300049741 Bacteria 711
412 Ga0501079_1086957 3300049741 Bacteria 630
413 Ga0501080_0110587 3300049742 Bacteria 2546
414 Ga0501080_0221924 3300049742 Bacteria 1729
415 Ga0501080_0331479 3300049742 Unclassified 1376
416 Ga0501080_0380979 3300049742 Bacteria 1271
417 Ga0501081_0008894 3300049743 Bacteria 6525
418 Ga0501081_0014128 3300049743 Bacteria 5261
419 Ga0501081_0198367 3300049743 Bacteria 1455
420 Ga0501081_0202557 3300049743 Bacteria 1439
421 Ga0501081_0271611 3300049743 Bacteria 1240
422 Ga0501081_0917551 3300049743 Unclassified 661
423 Ga0501081_1323040 3300049743 Unclassified 546
424 Ga0501035_0248656 3300049822 Unclassified 1511
425 Ga0501035_0373441 3300049822 Unclassified 1190
426 Ga0501035_0495379 3300049822 Unclassified 1006
427 Ga0501035_0896173 3300049822 Bacteria 703
428 Ga0501045_0067218 3300049824 Bacteria 2632
429 Ga0501045_0112363 3300049824 Unclassified 2020
430 Ga0501045_0167305 3300049824 Bacteria 1637
431 Ga0501045_0210484 3300049824 Unclassified 1448
432 Ga0501045_0298442 3300049824 Bacteria 1199
433 Ga0501045_0455317 3300049824 Unclassified 951
434 Ga0501045_0564443 3300049824 Bacteria 844
435 Ga0501045_1103015 3300049824 Unclassified 580
436 nmdc:mga05p37_1026672_c1 3300050507 Unclassified 873
437 nmdc:mga05p37_1227943_c1 3300050507 Unclassified 771
438 nmdc:mga05p37_13258_c1 3300050507 Bacteria 9868
439 nmdc:mga05p37_194_c1 3300050507 Bacteria 60557
440 nmdc:mga05p37_239543_c1 3300050507 Bacteria 2182
441 nmdc:mga05p37_332161_c1 3300050507 Archaea 1795
442 nmdc:mga05p37_439274_c1 3300050507 Unclassified 1514
443 nmdc:mga05p37_477895_c1 3300050507 Archaea 1436
444 nmdc:mga09592_108339_c1 3300050508 Bacteria 2383
445 nmdc:mga09592_197962_c1 3300050508 Unclassified 1740
446 nmdc:mga09592_867270_c1 3300050508 Bacteria 760
447 nmdc:mga0qj67_315961_c1 3300050509 Bacteria 1265
448 nmdc:mga0qj67_5687_c1 3300050509 Bacteria 9115
449 nmdc:mga06r32_2269_c1 3300050510 Bacteria 17188
450 nmdc:mga06r32_275017_c1 3300050510 Archaea 1671
451 nmdc:mga06r32_76003_c1 3300050510 Unclassified 3261
452 nmdc:mga0n895_1306936_c1 3300050512 Unclassified 696
453 nmdc:mga0n895_1379692_c1 3300050512 Unclassified 674
454 nmdc:mga0n895_271639_c1 3300050512 Bacteria 1720
455 nmdc:mga0n895_34751_c1 3300050512 Bacteria 4855
456 nmdc:mga0n895_361785_c1 3300050512 Archaea 1469
457 nmdc:mga0n895_460821_c1 3300050512 Unclassified 1283
458 nmdc:mga0n895_46941_c1 3300050512 Bacteria 4222
459 nmdc:mga0rr50_16459_c1 3300050513 Bacteria 4914
460 nmdc:mga0rr50_1891313_c1 3300050513 Bacteria 502
461 nmdc:mga0rr50_387776_c1 3300050513 Archaea 1179
462 nmdc:mga0rr50_64960_c1 3300050513 Unclassified 2763
463 nmdc:mga08x19_129497_c1 3300050514 Bacteria 1696
464 nmdc:mga08x19_29374_c1 3300050514 Unclassified 3448
465 nmdc:mga08x19_81210_c1 3300050514 Bacteria 2129
466 nmdc:mga0a205_322952_c1 3300050515 Unclassified 1414
467 nmdc:mga0a205_44043_c1 3300050515 Unclassified 3520
468 nmdc:mga0a205_540661_c1 3300050515 Archaea 1021
469 nmdc:mga0a205_901501_c1 3300050515 Bacteria 731
470 Ga0501084_0003873 3300054114 Bacteria 12183
471 Ga0501084_0036462 3300054114 Bacteria 4107
472 Ga0501084_0072584 3300054114 Bacteria 2883
473 Ga0501084_0142110 3300054114 Bacteria 2021
474 Ga0501084_0264829 3300054114 Bacteria 1451
475 Ga0501084_0295469 3300054114 Bacteria 1368
476 Ga0501084_0375573 3300054114 Bacteria 1201
477 Ga0501084_0599912 3300054114 Unclassified 930
478 Ga0590071_126577 3300059421 Bacteria 654
479 Ga0590075_011491 3300059424 Unclassified 2141
480 Ga0501082_0035950 3300060353 Bacteria 4268
481 Ga0501082_0103494 3300060353 Unclassified 2463
482 Ga0501082_0144851 3300060353 Bacteria 2062
483 Ga0501082_0302051 3300060353 Unclassified 1394
484 Ga0501082_0914482 3300060353 Bacteria 767
485 Ga0530510_0000106 3300061734 Bacteria 46126
486 Ga0530510_0059927 3300061734 Bacteria 2754
487 Ga0530510_0066465 3300061734 Bacteria 2614
488 Ga0530510_0098011 3300061734 Bacteria 2143
489 Ga0530510_0294734 3300061734 Unclassified 1213
490 Ga0530510_0501018 3300061734 Unclassified 921
491 Ga0530510_1154740 3300061734 Bacteria 594

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005329 Ga0070683_100325943 Ga0070683_1003259432 120
2 3300005614 Ga0068856_101708073 Ga0068856_1017080732 120
3 3300005618 Ga0068864_100263434 Ga0068864_1002634343 120
4 3300009174 Ga0105241_11494472 Ga0105241_114944721 120
5 3300025912 Ga0207707_11295942 Ga0207707_112959422 120
6 3300026078 Ga0207702_10149663 Ga0207702_101496631 120
7 3300026095 Ga0207676_10418798 Ga0207676_104187982 120
8 3300005543 Ga0070672_100084153 Ga0070672_1000841533 121
9 3300028379 Ga0268266_12199187 Ga0268266_121991871 121
10 3300037471 Ga0395905_0149047 Ga0395905_0149047_64_450 121
11 3300050515 nmdc:mga0a205_322952_c1 nmdc:mga0a205_322952_c1_152_568 122
12 3300005328 Ga0070676_10001558 Ga0070676_1000155811 124
13 3300005329 Ga0070683_100288738 Ga0070683_1002887383 124
14 3300005343 Ga0070687_100120032 Ga0070687_1001200323 124
15 3300005344 Ga0070661_100001962 Ga0070661_1000019625 124
16 3300005345 Ga0070692_10013809 Ga0070692_100138093 124
17 3300005366 Ga0070659_100004010 Ga0070659_1000040104 124
18 3300005455 Ga0070663_100002089 Ga0070663_1000020894 124
19 3300005457 Ga0070662_100010867 Ga0070662_1000108673 124
20 3300005458 Ga0070681_10009198 Ga0070681_100091989 124
21 3300005459 Ga0068867_100005900 Ga0068867_1000059007 124
22 3300005545 Ga0070695_100232491 Ga0070695_1002324912 124
23 3300005549 Ga0070704_100025591 Ga0070704_1000255911 124
24 3300005618 Ga0068864_100022555 Ga0068864_1000225554 124
25 3300005840 Ga0068870_10001412 Ga0068870_100014121 124
26 3300009098 Ga0105245_10309898 Ga0105245_103098981 124
27 3300009174 Ga0105241_10000117 Ga0105241_1000011714 124
28 3300013308 Ga0157375_10156776 Ga0157375_101567762 124
29 3300025903 Ga0207680_10527309 Ga0207680_105273091 124
30 3300025904 Ga0207647_10047283 Ga0207647_100472831 124
31 3300025907 Ga0207645_10001314 Ga0207645_1000131412 124
32 3300025918 Ga0207662_10043478 Ga0207662_100434781 124
33 3300025920 Ga0207649_10001718 Ga0207649_100017189 124
34 3300025923 Ga0207681_10326824 Ga0207681_103268242 124
35 3300025925 Ga0207650_10411982 Ga0207650_104119822 124
36 3300025932 Ga0207690_10006256 Ga0207690_100062561 124
37 3300025933 Ga0207706_10013315 Ga0207706_100133157 124
38 3300025942 Ga0207689_10000204 Ga0207689_1000020412 124
39 3300026067 Ga0207678_10000861 Ga0207678_1000086121 124
40 3300026089 Ga0207648_10004244 Ga0207648_1000424411 124
41 3300026095 Ga0207676_10075372 Ga0207676_100753723 124
42 3300035088 Ga0373940_0082815 Ga0373940_0082815_125_544 124
43 3300035091 Ga0373951_0017377 Ga0373951_0017377_599_1018 124
44 3300035121 Ga0373960_0007164 Ga0373960_0007164_731_1150 124
45 3300035242 Ga0373962_0026633 Ga0373962_0026633_857_1276 124
46 3300042005 Ga0439448_0003118 Ga0439448_0003118_18_437 124
47 3300042876 Ga0451577_0283377 Ga0451577_0283377_641_1060 124
48 3300045051 Ga0451576_0274791 Ga0451576_0274791_626_1045 124
49 3300048905 Ga0496102_0124890 Ga0496102_0124890_1835_2254 124
50 3300004800 Ga0058861_11463597 Ga0058861_114635971 126
51 3300005335 Ga0070666_10125962 Ga0070666_101259622 126
52 3300005336 Ga0070680_100001714 Ga0070680_10000171411 126
53 3300005337 Ga0070682_100010766 Ga0070682_1000107662 126
54 3300005339 Ga0070660_100000917 Ga0070660_10000091711 126
55 3300005340 Ga0070689_100164683 Ga0070689_1001646831 126
56 3300005341 Ga0070691_10007358 Ga0070691_100073583 126
57 3300005364 Ga0070673_100021626 Ga0070673_1000216263 126
58 3300005440 Ga0070705_100036559 Ga0070705_1000365593 126
59 3300005518 Ga0070699_100219313 Ga0070699_1002193131 126
60 3300005536 Ga0070697_100435911 Ga0070697_1004359112 126
61 3300005539 Ga0068853_100004223 Ga0068853_1000042237 126
62 3300005547 Ga0070693_100001004 Ga0070693_1000010044 126
63 3300005563 Ga0068855_100006676 Ga0068855_10000667612 126
64 3300005564 Ga0070664_100397166 Ga0070664_1003971662 126
65 3300005578 Ga0068854_100002481 Ga0068854_1000024818 126
66 3300005842 Ga0068858_100988614 Ga0068858_1009886142 126
67 3300005843 Ga0068860_100040043 Ga0068860_1000400433 126
68 3300005844 Ga0068862_100003169 Ga0068862_1000031694 126
69 3300006237 Ga0097621_100215618 Ga0097621_1002156184 126
70 3300006871 Ga0075434_100059059 Ga0075434_1000590591 126
71 3300010375 Ga0105239_10157663 Ga0105239_101576632 126
72 3300011119 Ga0105246_10106502 Ga0105246_101065023 126
73 3300013104 Ga0157370_10714060 Ga0157370_107140602 126
74 3300013105 Ga0157369_10197703 Ga0157369_101977032 126
75 3300013297 Ga0157378_11487532 Ga0157378_114875321 126
76 3300013307 Ga0157372_10005197 Ga0157372_1000519711 126
77 3300014497 Ga0182008_10033732 Ga0182008_100337323 126
78 3300015262 Ga0182007_10022160 Ga0182007_100221603 126
79 3300025901 Ga0207688_10019302 Ga0207688_100193023 126
80 3300025911 Ga0207654_10002844 Ga0207654_100028448 126
81 3300025912 Ga0207707_10000251 Ga0207707_100002514 126
82 3300025917 Ga0207660_10000638 Ga0207660_1000063820 126
83 3300025919 Ga0207657_10000385 Ga0207657_100003852 126
84 3300025936 Ga0207670_10218886 Ga0207670_102188861 126
85 3300025945 Ga0207679_10001699 Ga0207679_100016991 126
86 3300025949 Ga0207667_10004018 Ga0207667_100040189 126
87 3300025960 Ga0207651_10034304 Ga0207651_100343043 126
88 3300026035 Ga0207703_10095011 Ga0207703_100950113 126
89 3300026041 Ga0207639_10002525 Ga0207639_1000252511 126
90 3300026088 Ga0207641_10121992 Ga0207641_101219921 126
91 3300028381 Ga0268264_10321266 Ga0268264_103212661 126
92 3300034818 Ga0373950_0008304 Ga0373950_0008304_1155_1574 126
93 3300035241 Ga0373961_0014436 Ga0373961_0014436_585_1004 126
94 3300048913 Ga0496110_0133732 Ga0496110_0133732_1693_2112 126
95 3300048915 Ga0496112_0392010 Ga0496112_0392010_811_1230 126
96 3300050512 nmdc:mga0n895_271639_c1 nmdc:mga0n895_271639_c1_920_1339 126
97 3300050513 nmdc:mga0rr50_1891313_c1 nmdc:mga0rr50_1891313_c1_36_455 126
98 3300005331 Ga0070670_100004934 Ga0070670_1000049342 127
99 3300005354 Ga0070675_100669026 Ga0070675_1006690262 127
100 3300005406 Ga0070703_10004675 Ga0070703_100046754 127
101 3300005438 Ga0070701_10028151 Ga0070701_100281512 127
102 3300005444 Ga0070694_100000499 Ga0070694_1000004995 127
103 3300005445 Ga0070708_100448463 Ga0070708_1004484631 127
104 3300005530 Ga0070679_100022227 Ga0070679_1000222274 127
105 3300005543 Ga0070672_100059311 Ga0070672_1000593112 127
106 3300005614 Ga0068856_100000657 Ga0068856_10000065725 127
107 3300005617 Ga0068859_100002307 Ga0068859_10000230717 127
108 3300005719 Ga0068861_100170589 Ga0068861_1001705893 127
109 3300005841 Ga0068863_100014736 Ga0068863_1000147362 127
110 3300006881 Ga0068865_100383887 Ga0068865_1003838873 127
111 3300006931 Ga0097620_100002307 Ga0097620_10000230717 127
112 3300013100 Ga0157373_10001301 Ga0157373_1000130116 127
113 3300013306 Ga0163162_10611620 Ga0163162_106116202 127
114 3300020082 Ga0206353_11256221 Ga0206353_112562212 127
115 3300025926 Ga0207659_11439237 Ga0207659_114392371 127
116 3300025938 Ga0207704_10468807 Ga0207704_104688072 127
117 3300025940 Ga0207691_10089564 Ga0207691_100895643 127
118 3300026118 Ga0207675_100025223 Ga0207675_1000252231 127
119 3300037418 Ga0395900_1179775 Ga0395900_1179775_81_485 127
120 3300042439 Ga0439464_0316731 Ga0439464_0316731_60_479 127
121 3300044712 Ga0453684_0177886 Ga0453684_0177886_1573_1974 127
122 3300013296 Ga0157374_10201360 Ga0157374_102013603 128
123 3300045976 Ga0466967_2369055 Ga0466967_2369055_26_445 128
124 3300049742 Ga0501080_0110587 Ga0501080_0110587_1230_1625 128
125 3300049743 Ga0501081_0198367 Ga0501081_0198367_325_720 128
126 3300054114 Ga0501084_0264829 Ga0501084_0264829_187_582 128
127 3300045051 Ga0451576_0103929 Ga0451576_0103929_2030_2428 129
128 3300049576 Ga0501040_0136794 Ga0501040_0136794_1073_1471 129
129 3300049587 Ga0501071_0080951 Ga0501071_0080951_1396_1794 129
130 3300049588 Ga0501072_0058365 Ga0501072_0058365_1230_1628 129
131 3300049593 Ga0501077_0356198 Ga0501077_0356198_438_836 129
132 3300049741 Ga0501079_0189869 Ga0501079_0189869_964_1362 129
133 3300049742 Ga0501080_0221924 Ga0501080_0221924_260_658 129
134 3300049743 Ga0501081_0202557 Ga0501081_0202557_616_1014 129
135 3300049822 Ga0501035_0495379 Ga0501035_0495379_347_745 129
136 3300049824 Ga0501045_0112363 Ga0501045_0112363_1468_1866 129
137 3300054114 Ga0501084_0295469 Ga0501084_0295469_657_1055 129
138 3300060353 Ga0501082_0144851 Ga0501082_0144851_319_717 129
139 3300061734 Ga0530510_0066465 Ga0530510_0066465_265_663 129
140 3300049590 Ga0501074_0341089 Ga0501074_0341089_39_443 131
141 3300049591 Ga0501075_0168454 Ga0501075_0168454_427_831 131
142 3300049592 Ga0501076_0078837 Ga0501076_0078837_1052_1456 131
143 3300049593 Ga0501077_0295773 Ga0501077_0295773_393_797 131
144 3300049741 Ga0501079_0397099 Ga0501079_0397099_20_424 131
145 3300049824 Ga0501045_0067218 Ga0501045_0067218_1297_1701 131
146 3300059421 Ga0590071_126577 Ga0590071_126577_16_420 131
147 3300059424 Ga0590075_011491 Ga0590075_011491_208_612 131
148 3300061734 Ga0530510_0059927 Ga0530510_0059927_411_815 131
149 3300013102 Ga0157371_10328412 Ga0157371_103284122 132
150 3300013307 Ga0157372_10096360 Ga0157372_100963603 132
151 3300025911 Ga0207654_10597232 Ga0207654_105972321 132
152 3300042876 Ga0451577_0831479 Ga0451577_0831479_129_539 132
153 3300045051 Ga0451576_0195156 Ga0451576_0195156_690_1100 132
154 3300054114 Ga0501084_0003873 Ga0501084_0003873_10562_10969 132
155 3300005353 Ga0070669_100417398 Ga0070669_1004173982 133
156 3300005444 Ga0070694_100642355 Ga0070694_1006423551 133
157 3300005445 Ga0070708_100197643 Ga0070708_1001976433 133
158 3300005467 Ga0070706_100058016 Ga0070706_1000580164 133
159 3300005546 Ga0070696_100628952 Ga0070696_1006289521 133
160 3300005617 Ga0068859_101746687 Ga0068859_1017466871 133
161 3300006931 Ga0097620_101746685 Ga0097620_1017466851 133
162 3300009147 Ga0114129_10500867 Ga0114129_105008672 133
163 3300025910 Ga0207684_10012965 Ga0207684_100129658 133
164 3300025922 Ga0207646_10621420 Ga0207646_106214202 133
165 3300025942 Ga0207689_11168208 Ga0207689_111682082 133
166 3300026118 Ga0207675_100943935 Ga0207675_1009439351 133
167 3300031995 Ga0307409_100448344 Ga0307409_1004483442 133
168 3300036401 Ga0373937_0315962 Ga0373937_0315962_122_535 133
169 3300042435 Ga0439434_0187240 Ga0439434_0187240_51_461 133
170 3300049575 Ga0501039_0384394 Ga0501039_0384394_77_487 133
171 3300049577 Ga0501041_0971307 Ga0501041_0971307_96_506 133
172 3300049584 Ga0501068_0989588 Ga0501068_0989588_114_524 133
173 3300049587 Ga0501071_0220697 Ga0501071_0220697_693_1103 133
174 3300049590 Ga0501074_0608400 Ga0501074_0608400_246_656 133
175 3300049591 Ga0501075_0112460 Ga0501075_0112460_871_1281 133
176 3300049592 Ga0501076_1322068 Ga0501076_1322068_78_488 133
177 3300049741 Ga0501079_0471141 Ga0501079_0471141_342_752 133
178 3300049743 Ga0501081_0271611 Ga0501081_0271611_585_995 133
179 3300049824 Ga0501045_0298442 Ga0501045_0298442_238_648 133
180 3300050507 nmdc:mga05p37_1026672_c1 nmdc:mga05p37_1026672_c1_134_550 133
181 3300050507 nmdc:mga05p37_332161_c1 nmdc:mga05p37_332161_c1_324_734 133
182 3300005295 Ga0065707_10817518 Ga0065707_108175181 134
183 3300005546 Ga0070696_100934194 Ga0070696_1009341942 134
184 3300006844 Ga0075428_100016385 Ga0075428_10001638510 134
185 3300006846 Ga0075430_100040832 Ga0075430_1000408324 134
186 3300006846 Ga0075430_100053048 Ga0075430_1000530482 134
187 3300006847 Ga0075431_100024330 Ga0075431_1000243302 134
188 3300006847 Ga0075431_100050719 Ga0075431_1000507195 134
189 3300006852 Ga0075433_10053938 Ga0075433_100539384 134
190 3300006852 Ga0075433_10075386 Ga0075433_100753864 134
191 3300006871 Ga0075434_100056774 Ga0075434_1000567744 134
192 3300006880 Ga0075429_100057820 Ga0075429_1000578202 134
193 3300006880 Ga0075429_100069272 Ga0075429_1000692722 134
194 3300007076 Ga0075435_100247500 Ga0075435_1002475002 134
195 3300009147 Ga0114129_10186281 Ga0114129_101862812 134
196 3300009147 Ga0114129_10396778 Ga0114129_103967782 134
197 3300027526 Ga0209968_1042450 Ga0209968_10424502 134
198 3300027717 Ga0209998_10048111 Ga0209998_100481112 134
199 3300042156 Ga0439446_0064670 Ga0439446_0064670_25_438 134
200 3300045051 Ga0451576_0948839 Ga0451576_0948839_414_827 134
201 3300049521 Ga0501298_077931 Ga0501298_077931_39_452 134
202 3300049572 Ga0501036_0246734 Ga0501036_0246734_1006_1419 134
203 3300049572 Ga0501036_0380543 Ga0501036_0380543_661_1074 134
204 3300049573 Ga0501037_0622766 Ga0501037_0622766_257_670 134
205 3300049574 Ga0501038_0153369 Ga0501038_0153369_792_1205 134
206 3300049576 Ga0501040_0292508 Ga0501040_0292508_675_1088 134
207 3300049577 Ga0501041_0035817 Ga0501041_0035817_2328_2741 134
208 3300049577 Ga0501041_0729658 Ga0501041_0729658_187_600 134
209 3300049578 Ga0501042_0025537 Ga0501042_0025537_287_700 134
210 3300049578 Ga0501042_0133040 Ga0501042_0133040_14_427 134
211 3300049579 Ga0501043_0708608 Ga0501043_0708608_175_591 134
212 3300049579 Ga0501043_0845745 Ga0501043_0845745_49_462 134
213 3300049580 Ga0501046_0115196 Ga0501046_0115196_1257_1670 134
214 3300049582 Ga0501048_0197530 Ga0501048_0197530_677_1090 134
215 3300049584 Ga0501068_0107184 Ga0501068_0107184_953_1366 134
216 3300049584 Ga0501068_0224202 Ga0501068_0224202_696_1112 134
217 3300049584 Ga0501068_0387052 Ga0501068_0387052_285_698 134
218 3300049587 Ga0501071_0049557 Ga0501071_0049557_1964_2377 134
219 3300049587 Ga0501071_0059429 Ga0501071_0059429_741_1154 134
220 3300049587 Ga0501071_0808989 Ga0501071_0808989_244_657 134
221 3300049588 Ga0501072_0006351 Ga0501072_0006351_2082_2495 134
222 3300049588 Ga0501072_0308993 Ga0501072_0308993_663_1082 134
223 3300049589 Ga0501073_0266213 Ga0501073_0266213_304_717 134
224 3300049590 Ga0501074_0074888 Ga0501074_0074888_1455_1868 134
225 3300049590 Ga0501074_0404214 Ga0501074_0404214_432_845 134
226 3300049591 Ga0501075_0089845 Ga0501075_0089845_1551_1964 134
227 3300049591 Ga0501075_0118239 Ga0501075_0118239_1447_1860 134
228 3300049591 Ga0501075_0989730 Ga0501075_0989730_71_484 134
229 3300049592 Ga0501076_0030047 Ga0501076_0030047_126_539 134
230 3300049592 Ga0501076_0101698 Ga0501076_0101698_174_587 134
231 3300049592 Ga0501076_1319278 Ga0501076_1319278_149_562 134
232 3300049592 Ga0501076_1515527 Ga0501076_1515527_85_498 134
233 3300049593 Ga0501077_0117425 Ga0501077_0117425_691_1104 134
234 3300049593 Ga0501077_0299598 Ga0501077_0299598_40_453 134
235 3300049741 Ga0501079_0080747 Ga0501079_0080747_1617_2030 134
236 3300049741 Ga0501079_0373734 Ga0501079_0373734_620_1033 134
237 3300049741 Ga0501079_0867446 Ga0501079_0867446_270_683 134
238 3300049741 Ga0501079_1086957 Ga0501079_1086957_132_551 134
239 3300049742 Ga0501080_0331479 Ga0501080_0331479_104_517 134
240 3300049743 Ga0501081_0008894 Ga0501081_0008894_307_720 134
241 3300049743 Ga0501081_0917551 Ga0501081_0917551_214_627 134
242 3300049822 Ga0501035_0248656 Ga0501035_0248656_546_959 134
243 3300049822 Ga0501035_0896173 Ga0501035_0896173_64_483 134
244 3300049824 Ga0501045_0167305 Ga0501045_0167305_1183_1596 134
245 3300049824 Ga0501045_0455317 Ga0501045_0455317_96_509 134
246 3300049824 Ga0501045_0564443 Ga0501045_0564443_384_803 134
247 3300049824 Ga0501045_1103015 Ga0501045_1103015_137_550 134
248 3300050507 nmdc:mga05p37_1227943_c1 nmdc:mga05p37_1227943_c1_333_749 134
249 3300050507 nmdc:mga05p37_239543_c1 nmdc:mga05p37_239543_c1_1381_1794 134
250 3300050507 nmdc:mga05p37_477895_c1 nmdc:mga05p37_477895_c1_197_610 134
251 3300050508 nmdc:mga09592_108339_c1 nmdc:mga09592_108339_c1_238_651 134
252 3300050508 nmdc:mga09592_197962_c1 nmdc:mga09592_197962_c1_727_1140 134
253 3300050508 nmdc:mga09592_867270_c1 nmdc:mga09592_867270_c1_278_691 134
254 3300050509 nmdc:mga0qj67_315961_c1 nmdc:mga0qj67_315961_c1_389_802 134
255 3300050509 nmdc:mga0qj67_5687_c1 nmdc:mga0qj67_5687_c1_2651_3064 134
256 3300050510 nmdc:mga06r32_2269_c1 nmdc:mga06r32_2269_c1_1798_2211 134
257 3300050510 nmdc:mga06r32_275017_c1 nmdc:mga06r32_275017_c1_944_1357 134
258 3300050510 nmdc:mga06r32_76003_c1 nmdc:mga06r32_76003_c1_2838_3251 134
259 3300050512 nmdc:mga0n895_34751_c1 nmdc:mga0n895_34751_c1_2161_2574 134
260 3300050512 nmdc:mga0n895_361785_c1 nmdc:mga0n895_361785_c1_999_1412 134
261 3300050513 nmdc:mga0rr50_387776_c1 nmdc:mga0rr50_387776_c1_580_993 134
262 3300050515 nmdc:mga0a205_44043_c1 nmdc:mga0a205_44043_c1_260_673 134
263 3300050515 nmdc:mga0a205_540661_c1 nmdc:mga0a205_540661_c1_159_572 134
264 3300054114 Ga0501084_0036462 Ga0501084_0036462_2575_2988 134
265 3300054114 Ga0501084_0072584 Ga0501084_0072584_698_1111 134
266 3300054114 Ga0501084_0375573 Ga0501084_0375573_501_914 134
267 3300054114 Ga0501084_0599912 Ga0501084_0599912_487_903 134
268 3300060353 Ga0501082_0035950 Ga0501082_0035950_1251_1664 134
269 3300060353 Ga0501082_0103494 Ga0501082_0103494_1522_1935 134
270 3300060353 Ga0501082_0302051 Ga0501082_0302051_441_854 134
271 3300061734 Ga0530510_0000106 Ga0530510_0000106_26413_26826 134
272 3300061734 Ga0530510_0098011 Ga0530510_0098011_1311_1724 134
273 3300061734 Ga0530510_0294734 Ga0530510_0294734_288_701 134
274 3300061734 Ga0530510_1154740 Ga0530510_1154740_66_485 134
275 3300003349 JGI26129J50193_1003694 JGI26129J50193_10036942 135
276 3300005445 Ga0070708_100483389 Ga0070708_1004833892 135
277 3300005467 Ga0070706_101044531 Ga0070706_1010445311 135
278 3300005518 Ga0070699_100203895 Ga0070699_1002038953 135
279 3300005518 Ga0070699_100444568 Ga0070699_1004445682 135
280 3300005536 Ga0070697_100025172 Ga0070697_1000251723 135
281 3300005545 Ga0070695_100234375 Ga0070695_1002343752 135
282 3300005616 Ga0068852_101684321 Ga0068852_1016843211 135
283 3300006852 Ga0075433_11148062 Ga0075433_111480622 135
284 3300006871 Ga0075434_101316881 Ga0075434_1013168811 135
285 3300009551 Ga0105238_11562727 Ga0105238_115627271 135
286 3300013102 Ga0157371_11388632 Ga0157371_113886321 135
287 3300025910 Ga0207684_10860387 Ga0207684_108603871 135
288 3300025986 Ga0207658_10097166 Ga0207658_100971661 135
289 3300027360 Ga0209969_1017093 Ga0209969_10170932 135
290 3300027378 Ga0209981_1003495 Ga0209981_10034953 135
291 3300027395 Ga0209996_1000773 Ga0209996_10007733 135
292 3300027471 Ga0209995_1007327 Ga0209995_10073273 135
293 3300027526 Ga0209968_1047925 Ga0209968_10479252 135
294 3300027614 Ga0209970_1012271 Ga0209970_10122712 135
295 3300027617 Ga0210002_1045896 Ga0210002_10458962 135
296 3300027665 Ga0209983_1001652 Ga0209983_10016523 135
297 3300027682 Ga0209971_1000012 Ga0209971_100001260 135
298 3300027695 Ga0209966_1001163 Ga0209966_10011635 135
299 3300027717 Ga0209998_10000805 Ga0209998_100008057 135
300 3300027876 Ga0209974_10000062 Ga0209974_100000629 135
301 3300044673 Ga0453683_1006015 Ga0453683_1006015_52_459 135
302 3300050512 nmdc:mga0n895_1306936_c1 nmdc:mga0n895_1306936_c1_187_618 135
303 3300050515 nmdc:mga0a205_901501_c1 nmdc:mga0a205_901501_c1_175_606 135
304 3300061734 Ga0530510_0501018 Ga0530510_0501018_393_821 135
305 2162886012 MBSR1b_contig_5267707 MBSR1b_0257.00004940 136
306 3300003349 JGI26129J50193_1003731 JGI26129J50193_10037312 136
307 3300003503 JGI26141J51220_1004997 JGI26141J51220_10049971 136
308 3300005293 Ga0065715_10046420 Ga0065715_100464202 136
309 3300005331 Ga0070670_100002153 Ga0070670_1000021535 136
310 3300005333 Ga0070677_10419344 Ga0070677_104193442 136
311 3300005334 Ga0068869_100000915 Ga0068869_1000009151 136
312 3300005336 Ga0070680_100004155 Ga0070680_1000041553 136
313 3300005337 Ga0070682_100000361 Ga0070682_1000003618 136
314 3300005338 Ga0068868_100042524 Ga0068868_1000425241 136
315 3300005339 Ga0070660_100002424 Ga0070660_10000242412 136
316 3300005341 Ga0070691_10008364 Ga0070691_100083646 136
317 3300005341 Ga0070691_10111598 Ga0070691_101115982 136
318 3300005343 Ga0070687_100042692 Ga0070687_1000426923 136
319 3300005344 Ga0070661_100080322 Ga0070661_1000803222 136
320 3300005345 Ga0070692_10004889 Ga0070692_100048893 136
321 3300005353 Ga0070669_100093841 Ga0070669_1000938413 136
322 3300005355 Ga0070671_100363783 Ga0070671_1003637832 136
323 3300005364 Ga0070673_100340743 Ga0070673_1003407433 136
324 3300005366 Ga0070659_100000893 Ga0070659_10000089318 136
325 3300005367 Ga0070667_100042041 Ga0070667_1000420415 136
326 3300005406 Ga0070703_10001818 Ga0070703_100018186 136
327 3300005438 Ga0070701_10179593 Ga0070701_101795931 136
328 3300005440 Ga0070705_100006293 Ga0070705_1000062933 136
329 3300005441 Ga0070700_100172270 Ga0070700_1001722702 136
330 3300005444 Ga0070694_100008750 Ga0070694_1000087501 136
331 3300005444 Ga0070694_100021251 Ga0070694_1000212513 136
332 3300005444 Ga0070694_100339941 Ga0070694_1003399412 136
333 3300005455 Ga0070663_100013915 Ga0070663_1000139154 136
334 3300005457 Ga0070662_100010504 Ga0070662_1000105043 136
335 3300005457 Ga0070662_100132864 Ga0070662_1001328643 136
336 3300005459 Ga0068867_100010571 Ga0068867_1000105713 136
337 3300005518 Ga0070699_100024797 Ga0070699_1000247973 136
338 3300005530 Ga0070679_100064903 Ga0070679_1000649033 136
339 3300005535 Ga0070684_100074670 Ga0070684_1000746703 136
340 3300005536 Ga0070697_100029295 Ga0070697_1000292953 136
341 3300005536 Ga0070697_100379952 Ga0070697_1003799521 136
342 3300005539 Ga0068853_100000718 Ga0068853_10000071820 136
343 3300005545 Ga0070695_100014855 Ga0070695_1000148553 136
344 3300005545 Ga0070695_100017252 Ga0070695_1000172522 136
345 3300005545 Ga0070695_100076568 Ga0070695_1000765683 136
346 3300005546 Ga0070696_100000744 Ga0070696_1000007443 136
347 3300005547 Ga0070693_100001876 Ga0070693_1000018766 136
348 3300005549 Ga0070704_100002669 Ga0070704_1000026695 136
349 3300005549 Ga0070704_100350382 Ga0070704_1003503822 136
350 3300005563 Ga0068855_100016627 Ga0068855_1000166278 136
351 3300005564 Ga0070664_100122367 Ga0070664_1001223673 136
352 3300005577 Ga0068857_100110584 Ga0068857_1001105842 136
353 3300005578 Ga0068854_100001067 Ga0068854_10000106710 136
354 3300005614 Ga0068856_100002693 Ga0068856_1000026933 136
355 3300005617 Ga0068859_100008017 Ga0068859_1000080172 136
356 3300005618 Ga0068864_100007171 Ga0068864_1000071713 136
357 3300005840 Ga0068870_10007916 Ga0068870_100079165 136
358 3300005842 Ga0068858_100140914 Ga0068858_1001409141 136
359 3300005843 Ga0068860_100016989 Ga0068860_1000169896 136
360 3300005843 Ga0068860_100469315 Ga0068860_1004693153 136
361 3300005844 Ga0068862_100023673 Ga0068862_1000236733 136
362 3300005937 Ga0081455_10000459 Ga0081455_1000045917 136
363 3300006237 Ga0097621_100310751 Ga0097621_1003107512 136
364 3300006358 Ga0068871_100913314 Ga0068871_1009133142 136
365 3300006847 Ga0075431_100871004 Ga0075431_1008710041 136
366 3300006852 Ga0075433_10078579 Ga0075433_100785794 136
367 3300006852 Ga0075433_10427972 Ga0075433_104279722 136
368 3300006871 Ga0075434_100045789 Ga0075434_1000457893 136
369 3300006871 Ga0075434_100683592 Ga0075434_1006835922 136
370 3300006881 Ga0068865_100086254 Ga0068865_1000862543 136
371 3300006914 Ga0075436_100024960 Ga0075436_1000249604 136
372 3300006914 Ga0075436_100038970 Ga0075436_1000389703 136
373 3300006914 Ga0075436_100343935 Ga0075436_1003439352 136
374 3300006914 Ga0075436_100567628 Ga0075436_1005676281 136
375 3300006931 Ga0097620_100008017 Ga0097620_1000080172 136
376 3300007076 Ga0075435_100074178 Ga0075435_1000741783 136
377 3300007076 Ga0075435_100115265 Ga0075435_1001152653 136
378 3300009147 Ga0114129_10000296 Ga0114129_1000029645 136
379 3300009147 Ga0114129_10014823 Ga0114129_100148239 136
380 3300009147 Ga0114129_10318392 Ga0114129_103183923 136
381 3300009147 Ga0114129_10646298 Ga0114129_106462981 136
382 3300009148 Ga0105243_10308560 Ga0105243_103085602 136
383 3300009174 Ga0105241_10000226 Ga0105241_100002269 136
384 3300009177 Ga0105248_10694971 Ga0105248_106949712 136
385 3300013100 Ga0157373_10017135 Ga0157373_100171355 136
386 3300013105 Ga0157369_10222234 Ga0157369_102222342 136
387 3300013297 Ga0157378_10186556 Ga0157378_101865562 136
388 3300013307 Ga0157372_10000368 Ga0157372_1000036851 136
389 3300014325 Ga0163163_10078723 Ga0163163_100787232 136
390 3300014326 Ga0157380_10757549 Ga0157380_107575491 136
391 3300014745 Ga0157377_11697066 Ga0157377_116970661 136
392 3300025885 Ga0207653_10001798 Ga0207653_100017986 136
393 3300025904 Ga0207647_10079931 Ga0207647_100799313 136
394 3300025907 Ga0207645_10001584 Ga0207645_1000158410 136
395 3300025908 Ga0207643_10000263 Ga0207643_1000026316 136
396 3300025910 Ga0207684_10008247 Ga0207684_100082475 136
397 3300025911 Ga0207654_10016614 Ga0207654_100166143 136
398 3300025912 Ga0207707_10000092 Ga0207707_1000009232 136
399 3300025917 Ga0207660_10005982 Ga0207660_100059823 136
400 3300025919 Ga0207657_10000288 Ga0207657_1000028812 136
401 3300025920 Ga0207649_10013442 Ga0207649_100134423 136
402 3300025922 Ga0207646_11228438 Ga0207646_112284382 136
403 3300025923 Ga0207681_10044076 Ga0207681_100440763 136
404 3300025925 Ga0207650_10099198 Ga0207650_100991983 136
405 3300025932 Ga0207690_10011388 Ga0207690_100113882 136
406 3300025933 Ga0207706_10005447 Ga0207706_100054473 136
407 3300025933 Ga0207706_10147799 Ga0207706_101477993 136
408 3300025936 Ga0207670_10595476 Ga0207670_105954762 136
409 3300025938 Ga0207704_10092330 Ga0207704_100923302 136
410 3300025940 Ga0207691_10202175 Ga0207691_102021752 136
411 3300025942 Ga0207689_10000020 Ga0207689_1000002029 136
412 3300025945 Ga0207679_10064005 Ga0207679_100640053 136
413 3300025949 Ga0207667_10030230 Ga0207667_100302305 136
414 3300025960 Ga0207651_10038491 Ga0207651_100384913 136
415 3300025981 Ga0207640_10005348 Ga0207640_100053483 136
416 3300026041 Ga0207639_10001053 Ga0207639_1000105317 136
417 3300026067 Ga0207678_10002484 Ga0207678_100024845 136
418 3300026075 Ga0207708_10040856 Ga0207708_100408565 136
419 3300026078 Ga0207702_10070812 Ga0207702_100708123 136
420 3300026088 Ga0207641_10095708 Ga0207641_100957081 136
421 3300026089 Ga0207648_10001946 Ga0207648_100019466 136
422 3300026116 Ga0207674_10004155 Ga0207674_100041552 136
423 3300026118 Ga0207675_100006043 Ga0207675_1000060435 136
424 3300026142 Ga0207698_11651313 Ga0207698_116513131 136
425 3300027360 Ga0209969_1076962 Ga0209969_10769621 136
426 3300027364 Ga0209967_1010848 Ga0209967_10108482 136
427 3300027378 Ga0209981_1003008 Ga0209981_10030082 136
428 3300027424 Ga0209984_1002013 Ga0209984_10020131 136
429 3300027462 Ga0210000_1018882 Ga0210000_10188821 136
430 3300027471 Ga0209995_1027362 Ga0209995_10273622 136
431 3300027526 Ga0209968_1028535 Ga0209968_10285352 136
432 3300027543 Ga0209999_1021250 Ga0209999_10212502 136
433 3300027552 Ga0209982_1028818 Ga0209982_10288181 136
434 3300027614 Ga0209970_1003113 Ga0209970_10031133 136
435 3300027617 Ga0210002_1002103 Ga0210002_10021032 136
436 3300027665 Ga0209983_1000285 Ga0209983_100028511 136
437 3300027682 Ga0209971_1000065 Ga0209971_100006528 136
438 3300027695 Ga0209966_1000364 Ga0209966_100036413 136
439 3300027717 Ga0209998_10000178 Ga0209998_1000017818 136
440 3300027876 Ga0209974_10000636 Ga0209974_100006367 136
441 3300028380 Ga0268265_10511270 Ga0268265_105112702 136
442 3300028380 Ga0268265_11672991 Ga0268265_116729911 136
443 3300028381 Ga0268264_10010891 Ga0268264_100108916 136
444 3300028381 Ga0268264_10186629 Ga0268264_101866293 136
445 3300035091 Ga0373951_0010971 Ga0373951_0010971_864_1274 136
446 3300035112 Ga0373932_0377463 Ga0373932_0377463_101_511 136
447 3300035121 Ga0373960_0060471 Ga0373960_0060471_228_638 136
448 3300035242 Ga0373962_0118423 Ga0373962_0118423_341_751 136
449 3300042005 Ga0439448_0182520 Ga0439448_0182520_277_699 136
450 3300042012 Ga0439455_0110320 Ga0439455_0110320_235_645 136
451 3300042016 Ga0439463_060167 Ga0439463_060167_162_572 136
452 3300042144 Ga0450889_008216 Ga0450889_008216_270_680 136
453 3300042438 Ga0439459_0001124 Ga0439459_0001124_2843_3253 136
454 3300042993 Ga0439440_0076556 Ga0439440_0076556_151_573 136
455 3300044712 Ga0453684_1152627 Ga0453684_1152627_95_505 136
456 3300045051 Ga0451576_0076879 Ga0451576_0076879_2542_2964 136
457 3300045051 Ga0451576_0246052 Ga0451576_0246052_132_554 136
458 3300045051 Ga0451576_0394154 Ga0451576_0394154_756_1166 136
459 3300048905 Ga0496102_0320066 Ga0496102_0320066_512_922 136
460 3300048909 Ga0496106_0119036 Ga0496106_0119036_744_1154 136
461 3300048915 Ga0496112_0241108 Ga0496112_0241108_889_1299 136
462 3300049576 Ga0501040_0035197 Ga0501040_0035197_1128_1550 136
463 3300049578 Ga0501042_0104175 Ga0501042_0104175_1479_1901 136
464 3300049579 Ga0501043_0060397 Ga0501043_0060397_73_495 136
465 3300049583 Ga0501067_0130347 Ga0501067_0130347_801_1229 136
466 3300049584 Ga0501068_0663651 Ga0501068_0663651_173_595 136
467 3300049588 Ga0501072_0081737 Ga0501072_0081737_1974_2396 136
468 3300049591 Ga0501075_0135247 Ga0501075_0135247_587_1024 136
469 3300049592 Ga0501076_0015791 Ga0501076_0015791_2774_3196 136
470 3300049592 Ga0501076_0141314 Ga0501076_0141314_646_1083 136
471 3300049593 Ga0501077_0253163 Ga0501077_0253163_338_775 136
472 3300049593 Ga0501077_0742570 Ga0501077_0742570_134_556 136
473 3300049741 Ga0501079_0033351 Ga0501079_0033351_1397_1819 136
474 3300049742 Ga0501080_0380979 Ga0501080_0380979_61_498 136
475 3300049743 Ga0501081_0014128 Ga0501081_0014128_4522_4944 136
476 3300049743 Ga0501081_1323040 Ga0501081_1323040_27_464 136
477 3300049822 Ga0501035_0373441 Ga0501035_0373441_640_1062 136
478 3300049824 Ga0501045_0210484 Ga0501045_0210484_577_999 136
479 3300050507 nmdc:mga05p37_13258_c1 nmdc:mga05p37_13258_c1_5585_6007 136
480 3300050507 nmdc:mga05p37_194_c1 nmdc:mga05p37_194_c1_56584_57006 136
481 3300050507 nmdc:mga05p37_439274_c1 nmdc:mga05p37_439274_c1_301_756 136
482 3300050512 nmdc:mga0n895_1379692_c1 nmdc:mga0n895_1379692_c1_54_476 136
483 3300050512 nmdc:mga0n895_460821_c1 nmdc:mga0n895_460821_c1_121_576 136
484 3300050512 nmdc:mga0n895_46941_c1 nmdc:mga0n895_46941_c1_682_1092 136
485 3300050513 nmdc:mga0rr50_16459_c1 nmdc:mga0rr50_16459_c1_777_1187 136
486 3300050513 nmdc:mga0rr50_64960_c1 nmdc:mga0rr50_64960_c1_1617_2072 136
487 3300050514 nmdc:mga08x19_129497_c1 nmdc:mga08x19_129497_c1_1265_1675 136
488 3300050514 nmdc:mga08x19_29374_c1 nmdc:mga08x19_29374_c1_2126_2581 136
489 3300050514 nmdc:mga08x19_81210_c1 nmdc:mga08x19_81210_c1_361_786 136
490 3300054114 Ga0501084_0142110 Ga0501084_0142110_874_1296 136
491 3300060353 Ga0501082_0914482 Ga0501082_0914482_139_564 136

Structural Annotation

Top 5 Hits

ID Description Score Start End
3vg8-assembly1.cif.gz_B crystal structure of hypothetical protein tthb210 from thermus thermophilus hb8 0.8417 41 135
3vg8-assembly1.cif.gz_I crystal structure of hypothetical protein tthb210 from thermus thermophilus hb8 0.8383 42 135
3vg8-assembly1.cif.gz_I crystal structure of hypothetical protein tthb210 from thermus thermophilus hb8 0.7264 42 135
3vg8-assembly1.cif.gz_B crystal structure of hypothetical protein tthb210 from thermus thermophilus hb8 0.6958 41 135
6ppf-assembly1.cif.gz_T bacterial 45srbga ribosomal particle class b 0.5196 75 128
ID Description Score Start End Superfamily
3vg8F00 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1; 0.822 41 135 3.30.200.270
3vg8F00 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1; 0.6961 41 135 3.30.200.270
af_P9WIT3_297_388_3.30.70.2520 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.5495 75 129 3.30.70.2520
3c19A01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Transcriptional regulatory protein pf0864 domain like 0.5143 74 134 3.30.70.1380
4garT00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.487 75 124 3.30.70.330
ID Description Score Start End GO Terms
AF-A0A1I3EW27-F1-model_v4 HIT domain-containing protein 0.9376 32 135
AF-A0A845H7D7-F1-model_v4 deleted 0.937 26 135
AF-B8IA45-F1-model_v4 TTHB210-like domain-containing protein 0.9353 32 135
AF-A0A1Q7R9M6-F1-model_v4 HIT domain-containing protein 0.9294 26 135
AF-A0A249Q4R0-F1-model_v4 deleted 0.9228 25 135

Feature Viewer

pLDDT pTM Quality
87.1 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map