F454122

General Info

Members Datasets Scaffolds Average Seq Length
491 223 446 528

Family's Representative Sequence

Representative Sequence 3300028563|Ga0265319_1002649|Ga0265319_10026494
Length 578
Sequence VTAISRLRERAAGWPPSLVSGARRAAQEWTFVRGMCDRARFRKRPELPIPKPNTVAPPSXXXVSPLQGLLEVTRLVRAEENLPDLLGAIARTIADSLGYETVVVNLYRPAWDDFTVTTVLGSDAAQAALMGQIRSVDEWDTLICDRYARRGAYVVPAGSYDWDTASYSYVPTAEPGDAADGWRPEDALFLPMRHSDGHLLGVLSVDEPVSRKRATDEELDVLVAVADHAALAIQAAQEAADAVRHRVSLEQLLEVSSRLTAEPAADEILRDVCRGVRDALGFQNVAAQLIHPASGRLEARAAVGWDLDGEALSSEFEFGDVEPLLDSAFEVSGCFLLPNDEAERRLSHDSLPYVSHRNGRGPHAWDRHWLLVPLHNNAGAVIGLIWADEPEDRLLPSEEKLQALRIFANQAAAAIVSAAHQRELRFLADHDPLTRLLNRRAFVERLDAEVALAIRYRRTFGLVICDLDGFKLLNDQFGHAAGDEALQVFARILHAAVRKGDEAFRIGGDEFALVLAEAGEAEAREVIKRIADDVAGPRASFGIASCPDNARDPQALFRLADQALYEAKRTGSGLEFVA

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
116 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
117 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
118 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
119 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
120 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
121 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
122 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
123 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
124 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
125 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
126 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
127 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
128 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
129 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
130 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
131 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
132 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
133 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
134 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
135 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
136 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
137 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
138 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
139 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
140 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
141 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
142 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
143 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
147 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
148 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
149 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
150 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
151 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
152 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
153 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
154 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
155 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
156 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
157 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
158 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
159 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
160 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
161 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
162 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
163 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
164 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
165 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
166 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
167 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
168 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
169 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
170 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
171 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
172 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
173 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
174 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
175 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
176 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
177 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
178 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
179 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
180 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
181 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
182 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
183 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
184 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
185 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
186 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
187 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
188 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
189 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
190 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
191 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
192 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
193 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
194 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
195 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
196 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
197 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
198 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
199 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
200 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
201 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
202 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
203 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
204 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
206 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
207 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
208 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
209 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
210 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
211 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
212 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
213 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
214 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
215 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
216 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
217 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
218 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
219 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
220 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
221 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
222 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
223 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.59
Metatranscriptomes 0.41
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.2
Nodule 0
Rhizoplane 21.18
Rhizosphere 78.21
Stem 0
Stem Tuber 0
Unclassified 0.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10028173 3300005327 Bacteria 4508
2 Ga0070658_10038592 3300005327 Bacteria 3851
3 Ga0070676_10039911 3300005328 Bacteria 2716
4 Ga0070683_100007102 3300005329 Bacteria 9437
5 Ga0070683_100064325 3300005329 Bacteria 3414
6 Ga0070683_100080643 3300005329 Bacteria 3046
7 Ga0068869_100007121 3300005334 Bacteria 7125
8 Ga0070680_100108955 3300005336 Bacteria 2304
9 Ga0070682_100044022 3300005337 Bacteria 2762
10 Ga0070682_100107158 3300005337 Bacteria 1856
11 Ga0068868_100031902 3300005338 Bacteria 4050
12 Ga0068868_100127106 3300005338 Bacteria 2083
13 Ga0070660_100001589 3300005339 Bacteria 15629
14 Ga0070675_100043848 3300005354 Bacteria 3658
15 Ga0070671_100111513 3300005355 Bacteria 2298
16 Ga0070659_100011416 3300005366 Bacteria 6570
17 Ga0070709_10034633 3300005434 Bacteria 3062
18 Ga0070709_10038585 3300005434 Bacteria 2926
19 Ga0070709_10044191 3300005434 Bacteria 2758
20 Ga0070714_100043938 3300005435 Bacteria 3781
21 Ga0070714_100068718 3300005435 Bacteria 3057
22 Ga0070714_100111454 3300005435 Bacteria 2423
23 Ga0070714_100129681 3300005435 Bacteria 2252
24 Ga0070713_100044227 3300005436 Bacteria 3644
25 Ga0070713_100051010 3300005436 Bacteria 3421
26 Ga0070710_10014613 3300005437 Bacteria 3955
27 Ga0070710_10033160 3300005437 Bacteria 2803
28 Ga0070711_100002446 3300005439 Bacteria 10597
29 Ga0070711_100011945 3300005439 Bacteria 5407
30 Ga0070711_100028307 3300005439 Bacteria 3686
31 Ga0070711_100066445 3300005439 Bacteria 2526
32 Ga0070700_100003216 3300005441 Bacteria 8392
33 Ga0070694_100015984 3300005444 Bacteria 4722
34 Ga0070708_100104955 3300005445 Bacteria 2592
35 Ga0070681_10026888 3300005458 Bacteria 5785
36 Ga0070681_10029974 3300005458 Bacteria 5460
37 Ga0070681_10114825 3300005458 Bacteria 2631
38 Ga0070681_10134911 3300005458 Bacteria 2399
39 Ga0070681_10203610 3300005458 Bacteria 1897
40 Ga0068867_100036543 3300005459 Bacteria 3566
41 Ga0070707_100102063 3300005468 Bacteria 2779
42 Ga0070707_100128928 3300005468 Bacteria 2458
43 Ga0070707_100156970 3300005468 Bacteria 2217
44 Ga0070707_100208361 3300005468 Bacteria 1906
45 Ga0070698_100060616 3300005471 Bacteria 3818
46 Ga0070698_100114668 3300005471 Bacteria 2659
47 Ga0070698_100207369 3300005471 Bacteria 1895
48 Ga0070699_100037830 3300005518 Bacteria 4176
49 Ga0070699_100056571 3300005518 Bacteria 3397
50 Ga0070679_100027957 3300005530 Bacteria 5557
51 Ga0070679_100056818 3300005530 Bacteria 3900
52 Ga0070679_100099556 3300005530 Bacteria 2894
53 Ga0070684_100013631 3300005535 Bacteria 6560
54 Ga0070684_100028512 3300005535 Bacteria 4724
55 Ga0070684_100042525 3300005535 Bacteria 3923
56 Ga0070684_100103893 3300005535 Bacteria 2542
57 Ga0070697_100055667 3300005536 Bacteria 3216
58 Ga0068853_100020279 3300005539 Bacteria 5527
59 Ga0070686_100034604 3300005544 Bacteria 3114
60 Ga0070695_100066441 3300005545 Bacteria 2350
61 Ga0070696_100087139 3300005546 Unclassified 2217
62 Ga0070693_100021099 3300005547 Bacteria 3446
63 Ga0070704_100007955 3300005549 Bacteria 6328
64 Ga0070704_100048546 3300005549 Bacteria 2972
65 Ga0068855_100009022 3300005563 Bacteria 12051
66 Ga0068855_100075743 3300005563 Bacteria 3906
67 Ga0068855_100195116 3300005563 Unclassified 2281
68 Ga0068857_100007342 3300005577 Bacteria 9491
69 Ga0068857_100084183 3300005577 Bacteria 2842
70 Ga0068854_100024931 3300005578 Bacteria 4101
71 Ga0068854_100071643 3300005578 Bacteria 2536
72 Ga0068856_100014165 3300005614 Bacteria 7710
73 Ga0068856_100153974 3300005614 Bacteria 2309
74 Ga0070702_100035775 3300005615 Bacteria 2745
75 Ga0068852_100088136 3300005616 Bacteria 2771
76 Ga0068859_100024026 3300005617 Bacteria 6116
77 Ga0068859_100038228 3300005617 Bacteria 4815
78 Ga0068866_10009069 3300005718 Bacteria 4216
79 Ga0068861_100042803 3300005719 Bacteria 3396
80 Ga0068851_10034344 3300005834 Bacteria 2531
81 Ga0068858_100055003 3300005842 Bacteria 3679
82 Ga0068860_100273221 3300005843 Bacteria 1650
83 Ga0081455_10001455 3300005937 Bacteria 29310
84 Ga0081540_1000314 3300005983 Bacteria 50231
85 Ga0081539_10003435 3300005985 Bacteria 19473
86 Ga0081539_10014597 3300005985 Bacteria 5794
87 Ga0081539_10025465 3300005985 Bacteria 3809
88 Ga0070717_10011836 3300006028 Bacteria 6637
89 Ga0070717_10014587 3300006028 Bacteria 6049
90 Ga0070717_10078487 3300006028 Bacteria 2766
91 Ga0070717_10084505 3300006028 Bacteria 2670
92 Ga0070717_10136649 3300006028 Bacteria 2112
93 Ga0075432_10001933 3300006058 Bacteria 6877
94 Ga0070712_100001811 3300006175 Bacteria 13024
95 Ga0070712_100022220 3300006175 Bacteria 4175
96 Ga0075367_10052443 3300006178 Bacteria 2414
97 Ga0097621_100039775 3300006237 Bacteria 3779
98 Ga0068871_100049539 3300006358 Bacteria 3395
99 Ga0068871_100087849 3300006358 Bacteria 2585
100 Ga0075428_100047206 3300006844 Bacteria 4731
101 Ga0075431_100006298 3300006847 Bacteria 11790
102 Ga0075433_10024198 3300006852 Bacteria 5122
103 Ga0075433_10085179 3300006852 Bacteria 2790
104 Ga0075434_100001151 3300006871 Bacteria 21864
105 Ga0075434_100002405 3300006871 Bacteria 16436
106 Ga0075434_100004005 3300006871 Bacteria 13192
107 Ga0075434_100033254 3300006871 Bacteria 5088
108 Ga0068865_100074585 3300006881 Bacteria 2416
109 Ga0075436_100000676 3300006914 Bacteria 22467
110 Ga0075436_100005473 3300006914 Bacteria 8732
111 Ga0075436_100007629 3300006914 Bacteria 7393
112 Ga0075436_100046651 3300006914 Bacteria 2988
113 Ga0097620_100024027 3300006931 Bacteria 6116
114 Ga0097620_100038228 3300006931 Bacteria 4815
115 Ga0075435_100000660 3300007076 Bacteria 21225
116 Ga0075435_100016527 3300007076 Bacteria 5564
117 Ga0075435_100027352 3300007076 Bacteria 4460
118 Ga0105240_10012061 3300009093 Bacteria 11975
119 Ga0111539_10029793 3300009094 Bacteria 6643
120 Ga0105245_10042050 3300009098 Bacteria 4076
121 Ga0105245_10059049 3300009098 Bacteria 3453
122 Ga0105245_10060297 3300009098 Bacteria 3417
123 Ga0105245_10168134 3300009098 Bacteria 2086
124 Ga0105247_10010281 3300009101 Bacteria 5663
125 Ga0114129_10007775 3300009147 Bacteria 15253
126 Ga0114129_10035346 3300009147 Bacteria 7058
127 Ga0114129_10153550 3300009147 Bacteria 3150
128 Ga0105243_10006016 3300009148 Bacteria 9395
129 Ga0105243_10098984 3300009148 Bacteria 2417
130 Ga0105241_10027922 3300009174 Bacteria 4202
131 Ga0105242_10054335 3300009176 Bacteria 3273
132 Ga0105238_10016714 3300009551 Bacteria 7435
133 Ga0105238_10019112 3300009551 Bacteria 6980
134 Ga0105249_10053486 3300009553 Bacteria 3690
135 Ga0157369_10021993 3300013105 Bacteria 7127
136 Ga0157369_10026927 3300013105 Bacteria 6377
137 Ga0157369_10066984 3300013105 Bacteria 3862
138 Ga0157369_10118032 3300013105 Bacteria 2816
139 Ga0157374_10006008 3300013296 Bacteria 10274
140 Ga0157374_10049600 3300013296 Bacteria 3900
141 Ga0163162_10070363 3300013306 Bacteria 3550
142 Ga0157372_10032792 3300013307 Bacteria 5698
143 Ga0157372_10047944 3300013307 Bacteria 4748
144 Ga0157372_10203748 3300013307 Bacteria 2292
145 Ga0157375_10153491 3300013308 Bacteria 2440
146 Ga0157375_10247655 3300013308 Bacteria 1942
147 Ga0163163_10117747 3300014325 Bacteria 2689
148 Ga0157379_10091241 3300014968 Bacteria 2733
149 Ga0157376_10039470 3300014969 Bacteria 3851
150 Ga0206354_10587087 3300020081 Bacteria 2137
151 Ga0206353_10676799 3300020082 Bacteria 1974
152 Ga0207692_10027984 3300025898 Bacteria 2661
153 Ga0207688_10015606 3300025901 Unclassified 4119
154 Ga0207688_10090959 3300025901 Bacteria 1752
155 Ga0207707_10027306 3300025912 Bacteria 4992
156 Ga0207707_10152609 3300025912 Bacteria 2019
157 Ga0207707_10217170 3300025912 Bacteria 1665
158 Ga0207695_10036100 3300025913 Bacteria 5347
159 Ga0207695_10074871 3300025913 Bacteria 3446
160 Ga0207693_10002338 3300025915 Bacteria 16478
161 Ga0207693_10003020 3300025915 Bacteria 14542
162 Ga0207693_10005822 3300025915 Bacteria 10230
163 Ga0207693_10008102 3300025915 Bacteria 8618
164 Ga0207693_10033511 3300025915 Bacteria 4053
165 Ga0207693_10036361 3300025915 Bacteria 3882
166 Ga0207663_10001399 3300025916 Bacteria 11185
167 Ga0207663_10011307 3300025916 Bacteria 4790
168 Ga0207657_10002639 3300025919 Bacteria 19358
169 Ga0207657_10006634 3300025919 Bacteria 11979
170 Ga0207652_10079985 3300025921 Bacteria 2856
171 Ga0207646_10084537 3300025922 Bacteria 2839
172 Ga0207646_10099124 3300025922 Bacteria 2612
173 Ga0207694_10092333 3300025924 Bacteria 2389
174 Ga0207687_10003126 3300025927 Bacteria 11226
175 Ga0207687_10013143 3300025927 Bacteria 5409
176 Ga0207687_10043081 3300025927 Bacteria 3109
177 Ga0207687_10114285 3300025927 Unclassified 2009
178 Ga0207700_10101072 3300025928 Bacteria 2300
179 Ga0207664_10015429 3300025929 Bacteria 5545
180 Ga0207664_10017207 3300025929 Bacteria 5294
181 Ga0207644_10124812 3300025931 Bacteria 1964
182 Ga0207706_10108102 3300025933 Bacteria 2447
183 Ga0207706_10197956 3300025933 Bacteria 1762
184 Ga0207670_10149887 3300025936 Bacteria 1729
185 Ga0207669_10060404 3300025937 Bacteria 2324
186 Ga0207665_10004184 3300025939 Bacteria 9605
187 Ga0207665_10015956 3300025939 Bacteria 4931
188 Ga0207665_10030217 3300025939 Bacteria 3581
189 Ga0207689_10046723 3300025942 Bacteria 3577
190 Ga0207667_10031497 3300025949 Bacteria 5725
191 Ga0207667_10114985 3300025949 Unclassified 2773
192 Ga0207640_10062278 3300025981 Bacteria 2474
193 Ga0207640_10119089 3300025981 Bacteria 1887
194 Ga0207677_10039657 3300026023 Bacteria 3098
195 Ga0207703_10031423 3300026035 Bacteria 4198
196 Ga0207703_10146483 3300026035 Bacteria 2054
197 Ga0207708_10001598 3300026075 Bacteria 16874
198 Ga0207702_10003636 3300026078 Bacteria 13983
199 Ga0207702_10035811 3300026078 Bacteria 4150
200 Ga0207702_10099200 3300026078 Bacteria 2567
201 Ga0207648_10030719 3300026089 Bacteria 4755
202 Ga0207648_10129017 3300026089 Bacteria 2225
203 Ga0207674_10054030 3300026116 Bacteria 4091
204 Ga0207674_10070902 3300026116 Bacteria 3503
205 Ga0207675_100042992 3300026118 Bacteria 4219
206 Ga0207675_100084130 3300026118 Bacteria 2985
207 Ga0207683_10001825 3300026121 Bacteria 18827
208 Ga0207683_10049189 3300026121 Bacteria 3690
209 Ga0207698_10041099 3300026142 Bacteria 3442
210 Ga0207698_10057182 3300026142 Bacteria 3016
211 Ga0207428_10007122 3300027907 Bacteria 10229
212 Ga0268264_10108247 3300028381 Bacteria 2429
213 Ga0265337_1009408 3300028556 Bacteria 3490
214 Ga0265319_1002649 3300028563 Bacteria 9620
215 Ga0265319_1006935 3300028563 Bacteria 5165
216 Ga0265318_10000065 3300028577 Bacteria 102014
217 Ga0265338_10008114 3300028800 Bacteria 12824
218 Ga0265338_10010391 3300028800 Bacteria 10923
219 Ga0265338_10015899 3300028800 Bacteria 8232
220 Ga0265332_10006048 3300031238 Bacteria 5527
221 Ga0265328_10006266 3300031239 Bacteria 5051
222 Ga0265320_10024573 3300031240 Bacteria 3185
223 Ga0265325_10001733 3300031241 Bacteria 15141
224 Ga0265329_10007386 3300031242 Bacteria 4260
225 Ga0265340_10003106 3300031247 Bacteria 9418
226 Ga0265327_10001182 3300031251 Bacteria 35346
227 Ga0265327_10036338 3300031251 Bacteria 2708
228 Ga0265316_10007012 3300031344 Bacteria 10676
229 Ga0265316_10013879 3300031344 Bacteria 7127
230 Ga0265313_10005955 3300031595 Bacteria 8811
231 Ga0265314_10012798 3300031711 Bacteria 6817
232 Ga0265342_10005194 3300031712 Bacteria 10004
233 Ga0307415_100059184 3300032126 Bacteria 2641
234 Ga0373930_0003418 3300034816 Bacteria 2515
235 Ga0373959_0003187 3300034820 Bacteria 2614
236 Ga0373926_0026748 3300035083 Bacteria 2020
237 Ga0373940_0000244 3300035088 Bacteria 7801
238 Ga0373951_0002498 3300035091 Bacteria 4630
239 Ga0373932_0001551 3300035112 Bacteria 6348
240 Ga0373939_0005788 3300035114 Bacteria 2952
241 Ga0373943_0022998 3300035170 Bacteria 2894
242 Ga0373955_0033245 3300035172 Bacteria 2715
243 Ga0373961_0002090 3300035241 Bacteria 5316
244 Ga0373931_0000692 3300035691 Bacteria 13933
245 Ga0373935_0071147 3300035692 Bacteria 2244
246 Ga0373935_0098172 3300035692 Bacteria 1927
247 Ga0373947_0094799 3300035725 Bacteria 1867
248 Ga0373937_0064209 3300036401 Bacteria 3377
249 Ga0373925_0004875 3300037068 Bacteria 10098
250 Ga0395899_0039514 3300037312 Bacteria 3531
251 Ga0395899_0049216 3300037312 Bacteria 3134
252 Ga0395900_0004208 3300037418 Bacteria 15271
253 Ga0395900_0069122 3300037418 Bacteria 3630
254 Ga0395900_0078518 3300037418 Bacteria 3391
255 Ga0395898_0010456 3300037466 Bacteria 9702
256 Ga0395898_0015020 3300037466 Bacteria 7948
257 Ga0395898_0038057 3300037466 Bacteria 4770
258 Ga0395905_0004895 3300037471 Bacteria 13800
259 Ga0395905_0010536 3300037471 Bacteria 8979
260 Ga0395905_0194487 3300037471 Bacteria 1902
261 Ga0395901_0000733 3300038443 Bacteria 37083
262 Ga0395901_0040707 3300038443 Bacteria 4813
263 Ga0395901_0300250 3300038443 Bacteria 1665
264 Ga0242420_001728 3300038996 Bacteria 2988
265 Ga0436360_0126379 3300039438 Bacteria 11685
266 Ga0436360_0917953 3300039438 Bacteria 2482
267 Ga0451839_0000609 3300041496 Bacteria 2632
268 Ga0451851_1018579 3300041507 Bacteria 2259
269 Ga0466963_0000874 3300044694 Bacteria 15271
270 Ga0466963_0011789 3300044694 Bacteria 5331
271 Ga0466964_0000245 3300044706 Bacteria 15666
272 Ga0466968_0011112 3300044735 Bacteria 3505
273 Ga0466957_0008193 3300044842 Bacteria 5934
274 Ga0466957_0034093 3300044842 Bacteria 3054
275 Ga0466960_0006573 3300044901 Bacteria 4670
276 Ga0466958_0005213 3300045836 Bacteria 6963
277 Ga0466958_0091580 3300045836 Bacteria 1882
278 Ga0466967_0001083 3300045976 Bacteria 15065
279 Ga0466967_0022458 3300045976 Bacteria 5149
280 Ga0466967_0023670 3300045976 Bacteria 5037
281 Ga0466967_0024573 3300045976 Bacteria 4956
282 Ga0466967_0035056 3300045976 Bacteria 4267
283 Ga0466967_0095268 3300045976 Bacteria 2712
284 Ga0466967_0100070 3300045976 Bacteria 2648
285 Ga0466967_0164974 3300045976 Bacteria 2081
286 Ga0466967_0174735 3300045976 Bacteria 2023
287 Ga0495603_0032575 3300046455 Bacteria 3136
288 Ga0495651_0072763 3300046462 Bacteria 2610
289 Ga0495653_0045262 3300046463 Bacteria 3412
290 Ga0495582_0003879 3300046473 Bacteria 8419
291 Ga0495639_0001038 3300046475 Bacteria 12525
292 Ga0495662_0002913 3300046476 Bacteria 8645
293 Ga0495664_0026252 3300046477 Bacteria 3393
294 Ga0495584_0069132 3300046491 Bacteria 1774
295 Ga0495608_0004234 3300046511 Bacteria 10284
296 Ga0495665_0002442 3300046531 Bacteria 10035
297 Ga0495640_0014783 3300046533 Bacteria 5895
298 Ga0495667_0018535 3300046559 Bacteria 4702
299 Ga0495656_0008540 3300046615 Bacteria 3659
300 Ga0495634_0009793 3300046642 Bacteria 7053
301 Ga0495635_0018127 3300046663 Bacteria 4915
302 Ga0495588_0005968 3300046674 Bacteria 5461
303 Ga0495657_0005435 3300046675 Bacteria 10088
304 Ga0495657_0033048 3300046675 Bacteria 3606
305 Ga0495647_0002246 3300046681 Bacteria 6056
306 Ga0495658_0002914 3300046683 Bacteria 8588
307 Ga0495613_0005198 3300046689 Bacteria 9772
308 Ga0495624_0016169 3300046690 Bacteria 5025
309 Ga0495600_0011687 3300046809 Bacteria 5476
310 Ga0495604_0042811 3300047317 Bacteria 3547
311 Ga0495674_0018169 3300047319 Bacteria 6546
312 Ga0495674_0027619 3300047319 Bacteria 5184
313 Ga0495676_0029108 3300047321 Bacteria 4705
314 Ga0495676_0038917 3300047321 Bacteria 3945
315 Ga0495680_0019548 3300047322 Bacteria 5715
316 Ga0495680_0020200 3300047322 Bacteria 5610
317 Ga0495680_0097278 3300047322 Bacteria 2197
318 Ga0496100_0003357 3300048903 Bacteria 8336
319 Ga0496100_0022607 3300048903 Bacteria 3806
320 Ga0496100_0035130 3300048903 Bacteria 3151
321 Ga0496100_0042249 3300048903 Bacteria 2911
322 Ga0496100_0042643 3300048903 Bacteria 2899
323 Ga0496101_0004355 3300048904 Bacteria 8889
324 Ga0496101_0014782 3300048904 Bacteria 5251
325 Ga0496101_0026413 3300048904 Bacteria 4037
326 Ga0496101_0079805 3300048904 Bacteria 2416
327 Ga0496102_0003224 3300048905 Bacteria 13844
328 Ga0496102_0052623 3300048905 Bacteria 3710
329 Ga0496102_0062219 3300048905 Bacteria 3418
330 Ga0496102_0121230 3300048905 Bacteria 2442
331 Ga0496102_0143496 3300048905 Bacteria 2240
332 Ga0496103_0048938 3300048906 Bacteria 2613
333 Ga0496103_0058647 3300048906 Bacteria 2391
334 Ga0496104_0001632 3300048907 Bacteria 19365
335 Ga0496104_0010570 3300048907 Bacteria 8243
336 Ga0496104_0094431 3300048907 Bacteria 2861
337 Ga0496105_0009655 3300048908 Bacteria 7554
338 Ga0496105_0010350 3300048908 Bacteria 7333
339 Ga0496105_0012182 3300048908 Bacteria 6807
340 Ga0496105_0031394 3300048908 Bacteria 4355
341 Ga0496105_0066400 3300048908 Bacteria 2978
342 Ga0496106_0001671 3300048909 Bacteria 16633
343 Ga0496106_0002385 3300048909 Bacteria 13997
344 Ga0496106_0003960 3300048909 Bacteria 11066
345 Ga0496106_0004686 3300048909 Bacteria 10133
346 Ga0496106_0005194 3300048909 Bacteria 9641
347 Ga0496106_0047503 3300048909 Bacteria 3230
348 Ga0496106_0069156 3300048909 Bacteria 2694
349 Ga0496107_0002346 3300048910 Bacteria 12226
350 Ga0496107_0003972 3300048910 Bacteria 9954
351 Ga0496107_0082710 3300048910 Bacteria 2341
352 Ga0496108_0000880 3300048911 Bacteria 23404
353 Ga0496108_0006656 3300048911 Bacteria 9358
354 Ga0496108_0009135 3300048911 Bacteria 8023
355 Ga0496108_0014119 3300048911 Bacteria 6515
356 Ga0496108_0023780 3300048911 Bacteria 5042
357 Ga0496108_0031828 3300048911 Bacteria 4379
358 Ga0496108_0078603 3300048911 Bacteria 2792
359 Ga0496108_0099466 3300048911 Bacteria 2479
360 Ga0496108_0133450 3300048911 Bacteria 2134
361 Ga0496109_0005462 3300048912 Bacteria 10630
362 Ga0496109_0006589 3300048912 Bacteria 9777
363 Ga0496109_0010607 3300048912 Bacteria 7880
364 Ga0496109_0017018 3300048912 Bacteria 6362
365 Ga0496109_0018491 3300048912 Bacteria 6122
366 Ga0496109_0029595 3300048912 Bacteria 4906
367 Ga0496109_0037510 3300048912 Bacteria 4378
368 Ga0496109_0067085 3300048912 Bacteria 3286
369 Ga0496109_0085755 3300048912 Bacteria 2907
370 Ga0496109_0128998 3300048912 Bacteria 2359
371 Ga0496110_0004524 3300048913 Bacteria 10788
372 Ga0496110_0005152 3300048913 Bacteria 10215
373 Ga0496110_0011083 3300048913 Bacteria 7363
374 Ga0496110_0018203 3300048913 Bacteria 5887
375 Ga0496110_0032555 3300048913 Bacteria 4503
376 Ga0496110_0040528 3300048913 Bacteria 4058
377 Ga0496110_0111477 3300048913 Bacteria 2459
378 Ga0496111_0004148 3300048914 Bacteria 9109
379 Ga0496111_0042181 3300048914 Bacteria 3275
380 Ga0496111_0127427 3300048914 Bacteria 1882
381 Ga0496111_0131031 3300048914 Bacteria 1855
382 Ga0496112_0001131 3300048915 Bacteria 19837
383 Ga0496112_0002527 3300048915 Bacteria 14773
384 Ga0496112_0060795 3300048915 Bacteria 3723
385 Ga0496112_0063065 3300048915 Bacteria 3656
386 Ga0496112_0075679 3300048915 Bacteria 3329
387 Ga0496112_0080680 3300048915 Bacteria 3217
388 Ga0496112_0081909 3300048915 Bacteria 3192
389 Ga0496112_0238122 3300048915 Bacteria 1773
390 Ga0496113_0005163 3300048916 Bacteria 8121
391 Ga0496113_0013448 3300048916 Bacteria 5547
392 Ga0496113_0052273 3300048916 Bacteria 3051
393 Ga0496113_0058857 3300048916 Bacteria 2893
394 Ga0496113_0059076 3300048916 Bacteria 2888
395 Ga0496113_0070893 3300048916 Bacteria 2650
396 Ga0496114_0007338 3300048917 Bacteria 8704
397 Ga0496114_0012361 3300048917 Bacteria 6831
398 Ga0496114_0030233 3300048917 Bacteria 4456
399 Ga0496114_0040009 3300048917 Bacteria 3880
400 Ga0496114_0046753 3300048917 Bacteria 3597
401 Ga0496114_0063062 3300048917 Bacteria 3103
402 Ga0496114_0075301 3300048917 Bacteria 2843
403 Ga0496115_0021452 3300048918 Bacteria 4991
404 Ga0496115_0028997 3300048918 Bacteria 4343
405 Ga0496115_0039862 3300048918 Bacteria 3732
406 Ga0496115_0087079 3300048918 Bacteria 2549
407 Ga0496115_0157612 3300048918 Bacteria 1875
408 Ga0501034_0018101 3300049571 Bacteria 7230
409 Ga0501067_0000728 3300049583 Bacteria 17710
410 Ga0501067_0001714 3300049583 Bacteria 12070
411 Ga0501067_0019946 3300049583 Bacteria 3709
412 Ga0501067_0056053 3300049583 Bacteria 2184
413 Ga0501068_0000257 3300049584 Bacteria 26197
414 Ga0501069_0000272 3300049585 Bacteria 23453
415 Ga0501069_0016122 3300049585 Bacteria 4008
416 Ga0501070_0010919 3300049586 Bacteria 7672
417 Ga0501070_0029240 3300049586 Bacteria 4622
418 Ga0501073_0050892 3300049589 Bacteria 2902
419 Ga0501074_0053588 3300049590 Bacteria 2909
420 Ga0501074_0080473 3300049590 Bacteria 2337
421 Ga0501080_0006255 3300049742 Bacteria 10685
422 Ga0501080_0043232 3300049742 Bacteria 4195
423 Ga0501083_0000383 3300049744 Bacteria 28055
424 nmdc:mga05p37_129850_c1 3300050507 Bacteria 3092
425 nmdc:mga05p37_22769_c1 3300050507 Bacteria 7599
426 nmdc:mga06r32_22086_c1 3300050510 Bacteria 5879
427 nmdc:mga08y16_28819_c1 3300050511 Bacteria 5852
428 nmdc:mga0n895_11145_c1 3300050512 Bacteria 8001
429 nmdc:mga0n895_11722_c1 3300050512 Bacteria 7836
430 nmdc:mga0n895_117265_c1 3300050512 Bacteria 2682
431 nmdc:mga0n895_132553_c1 3300050512 Bacteria 2518
432 nmdc:mga0n895_26498_c1 3300050512 Bacteria 5492
433 nmdc:mga0n895_39082_c1 3300050512 Bacteria 4601
434 nmdc:mga0rr50_14005_c1 3300050513 Bacteria 5244
435 nmdc:mga0rr50_5823_c1 3300050513 Bacteria 7406
436 nmdc:mga08x19_16343_c1 3300050514 Bacteria 4525
437 nmdc:mga08x19_19252_c1 3300050514 Bacteria 4187
438 nmdc:mga08x19_21977_c1 3300050514 Bacteria 3946
439 nmdc:mga0a205_13617_c1 3300050515 Bacteria 7578
440 nmdc:mga0a205_19375_c1 3300050515 Bacteria 6413
441 nmdc:mga0a205_45092_c1 3300050515 Bacteria 4252
442 Ga0495601_0001410 3300053077 Bacteria 13234
443 Ga0495619_0080048 3300053085 Bacteria 2198
444 Ga0466962_0031915 3300061719 Bacteria 2522
445 Ga0530510_0004791 3300061734 Bacteria 9369
446 Ga0530510_0034431 3300061734 Bacteria 3649

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048903 Ga0496100_0022607 Ga0496100_0022607_14_1357 399
2 3300025933 Ga0207706_10197956 Ga0207706_101979561 453
3 3300020081 Ga0206354_10587087 Ga0206354_105870871 460
4 3300005937 Ga0081455_10001455 Ga0081455_1000145512 463
5 3300005338 Ga0068868_100031902 Ga0068868_1000319022 465
6 3300005339 Ga0070660_100001589 Ga0070660_1000015897 465
7 3300005458 Ga0070681_10203610 Ga0070681_102036101 465
8 3300005614 Ga0068856_100014165 Ga0068856_1000141655 465
9 3300005616 Ga0068852_100088136 Ga0068852_1000881362 465
10 3300005617 Ga0068859_100024026 Ga0068859_1000240264 465
11 3300006237 Ga0097621_100039775 Ga0097621_1000397751 465
12 3300006931 Ga0097620_100024027 Ga0097620_1000240274 465
13 3300009098 Ga0105245_10060297 Ga0105245_100602973 465
14 3300009101 Ga0105247_10010281 Ga0105247_100102816 465
15 3300009148 Ga0105243_10098984 Ga0105243_100989841 465
16 3300013307 Ga0157372_10032792 Ga0157372_100327926 465
17 3300013308 Ga0157375_10247655 Ga0157375_102476551 465
18 3300014325 Ga0163163_10117747 Ga0163163_101177472 465
19 3300025912 Ga0207707_10217170 Ga0207707_102171701 465
20 3300025919 Ga0207657_10006634 Ga0207657_1000663410 465
21 3300026023 Ga0207677_10039657 Ga0207677_100396571 465
22 3300026078 Ga0207702_10003636 Ga0207702_1000363613 465
23 3300026142 Ga0207698_10057182 Ga0207698_100571822 465
24 3300028381 Ga0268264_10108247 Ga0268264_101082472 465
25 3300048906 Ga0496103_0058647 Ga0496103_0058647_548_2152 465
26 3300048908 Ga0496105_0012182 Ga0496105_0012182_134_1738 465
27 3300048909 Ga0496106_0003960 Ga0496106_0003960_95_1699 465
28 3300048910 Ga0496107_0003972 Ga0496107_0003972_8198_9802 465
29 3300048911 Ga0496108_0014119 Ga0496108_0014119_135_1739 465
30 3300048912 Ga0496109_0005462 Ga0496109_0005462_5089_6693 465
31 3300048913 Ga0496110_0005152 Ga0496110_0005152_5232_6836 465
32 3300048914 Ga0496111_0004148 Ga0496111_0004148_4243_5847 465
33 3300048915 Ga0496112_0001131 Ga0496112_0001131_14653_16257 465
34 3300048916 Ga0496113_0013448 Ga0496113_0013448_2079_3683 465
35 3300048918 Ga0496115_0157612 Ga0496115_0157612_137_1741 465
36 3300025939 Ga0207665_10030217 Ga0207665_100302172 467
37 3300049583 Ga0501067_0056053 Ga0501067_0056053_157_1758 467
38 3300050512 nmdc:mga0n895_11145_c1 nmdc:mga0n895_11145_c1_59_1804 470
39 3300005329 Ga0070683_100007102 Ga0070683_1000071029 471
40 3300005458 Ga0070681_10029974 Ga0070681_100299745 471
41 3300025912 Ga0207707_10027306 Ga0207707_100273062 471
42 3300006871 Ga0075434_100002405 Ga0075434_10000240513 472
43 3300006914 Ga0075436_100000676 Ga0075436_10000067622 472
44 3300007076 Ga0075435_100000660 Ga0075435_10000066011 472
45 3300050512 nmdc:mga0n895_26498_c1 nmdc:mga0n895_26498_c1_175_1782 472
46 3300050513 nmdc:mga0rr50_5823_c1 nmdc:mga0rr50_5823_c1_5504_7111 472
47 3300050514 nmdc:mga08x19_21977_c1 nmdc:mga08x19_21977_c1_173_1780 472
48 3300009098 Ga0105245_10060297 Ga0105245_100602972 473
49 3300005337 Ga0070682_100107158 Ga0070682_1001071582 474
50 3300005535 Ga0070684_100042525 Ga0070684_1000425252 474
51 3300005843 Ga0068860_100273221 Ga0068860_1002732211 474
52 3300045976 Ga0466967_0035056 Ga0466967_0035056_647_2242 474
53 3300048903 Ga0496100_0003357 Ga0496100_0003357_5829_7430 474
54 3300048904 Ga0496101_0004355 Ga0496101_0004355_1237_2838 474
55 3300048905 Ga0496102_0003224 Ga0496102_0003224_7824_9425 474
56 3300048906 Ga0496103_0048938 Ga0496103_0048938_646_2247 474
57 3300048909 Ga0496106_0004686 Ga0496106_0004686_2699_4300 474
58 3300048910 Ga0496107_0002346 Ga0496107_0002346_5835_7436 474
59 3300048911 Ga0496108_0031828 Ga0496108_0031828_1168_2769 474
60 3300048912 Ga0496109_0067085 Ga0496109_0067085_1249_2850 474
61 3300048917 Ga0496114_0012361 Ga0496114_0012361_788_2389 474
62 3300005459 Ga0068867_100036543 Ga0068867_1000365432 475
63 3300006852 Ga0075433_10085179 Ga0075433_100851792 475
64 3300006871 Ga0075434_100001151 Ga0075434_10000115112 475
65 3300025937 Ga0207669_10060404 Ga0207669_100604041 475
66 3300025942 Ga0207689_10046723 Ga0207689_100467232 475
67 3300026089 Ga0207648_10030719 Ga0207648_100307193 475
68 3300046491 Ga0495584_0069132 Ga0495584_0069132_80_1648 476
69 3300048909 Ga0496106_0069156 Ga0496106_0069156_96_1709 476
70 3300009098 Ga0105245_10168134 Ga0105245_101681342 477
71 3300045976 Ga0466967_0022458 Ga0466967_0022458_3119_4720 477
72 3300005329 Ga0070683_100080643 Ga0070683_1000806432 478
73 3300005468 Ga0070707_100208361 Ga0070707_1002083611 478
74 3300005530 Ga0070679_100056818 Ga0070679_1000568182 478
75 3300005563 Ga0068855_100009022 Ga0068855_1000090225 478
76 3300005578 Ga0068854_100024931 Ga0068854_1000249311 478
77 3300005983 Ga0081540_1000314 Ga0081540_100031448 478
78 3300009093 Ga0105240_10012061 Ga0105240_1001206110 478
79 3300009176 Ga0105242_10054335 Ga0105242_100543352 478
80 3300025981 Ga0207640_10119089 Ga0207640_101190891 478
81 3300026078 Ga0207702_10099200 Ga0207702_100992002 478
82 3300028800 Ga0265338_10015899 Ga0265338_100158996 478
83 3300044694 Ga0466963_0000874 Ga0466963_0000874_156_1763 478
84 3300044842 Ga0466957_0034093 Ga0466957_0034093_1060_2667 478
85 3300045836 Ga0466958_0005213 Ga0466958_0005213_5242_6849 478
86 3300045976 Ga0466967_0023670 Ga0466967_0023670_3214_4821 478
87 3300048905 Ga0496102_0121230 Ga0496102_0121230_787_2406 478
88 3300048907 Ga0496104_0094431 Ga0496104_0094431_218_1837 478
89 3300048908 Ga0496105_0066400 Ga0496105_0066400_1259_2872 478
90 3300048911 Ga0496108_0000880 Ga0496108_0000880_12210_13829 478
91 3300048912 Ga0496109_0010607 Ga0496109_0010607_1850_3469 478
92 3300048913 Ga0496110_0004524 Ga0496110_0004524_218_1837 478
93 3300048914 Ga0496111_0127427 Ga0496111_0127427_31_1650 478
94 3300048916 Ga0496113_0005163 Ga0496113_0005163_6358_7977 478
95 3300048917 Ga0496114_0046753 Ga0496114_0046753_1709_3301 478
96 3300005535 Ga0070684_100028512 Ga0070684_1000285123 479
97 3300006028 Ga0070717_10011836 Ga0070717_100118362 479
98 3300009551 Ga0105238_10016714 Ga0105238_100167142 479
99 3300013105 Ga0157369_10021993 Ga0157369_100219936 479
100 3300025929 Ga0207664_10015429 Ga0207664_100154292 479
101 3300044706 Ga0466964_0000245 Ga0466964_0000245_1918_3597 479
102 3300044735 Ga0466968_0011112 Ga0466968_0011112_1903_3456 479
103 3300045976 Ga0466967_0001083 Ga0466967_0001083_1505_3184 479
104 3300005435 Ga0070714_100043938 Ga0070714_1000439382 480
105 3300025931 Ga0207644_10124812 Ga0207644_101248122 480
106 3300032126 Ga0307415_100059184 Ga0307415_1000591841 480
107 3300046455 Ga0495603_0032575 Ga0495603_0032575_658_2301 480
108 3300048911 Ga0496108_0099466 Ga0496108_0099466_824_2464 480
109 3300048913 Ga0496110_0032555 Ga0496110_0032555_1982_3622 480
110 3300048917 Ga0496114_0075301 Ga0496114_0075301_343_2019 480
111 3300048918 Ga0496115_0087079 Ga0496115_0087079_918_2531 480
112 3300005985 Ga0081539_10014597 Ga0081539_100145972 481
113 3300025915 Ga0207693_10036361 Ga0207693_100363612 481
114 3300005547 Ga0070693_100021099 Ga0070693_1000210992 482
115 3300045836 Ga0466958_0091580 Ga0466958_0091580_99_1706 483
116 3300048903 Ga0496100_0035130 Ga0496100_0035130_693_2294 483
117 3300048904 Ga0496101_0079805 Ga0496101_0079805_238_1839 483
118 3300048905 Ga0496102_0143496 Ga0496102_0143496_528_2129 483
119 3300048911 Ga0496108_0023780 Ga0496108_0023780_234_1835 483
120 3300048912 Ga0496109_0128998 Ga0496109_0128998_112_1713 483
121 3300048913 Ga0496110_0111477 Ga0496110_0111477_238_1839 483
122 3300025924 Ga0207694_10092333 Ga0207694_100923332 484
123 3300048911 Ga0496108_0006656 Ga0496108_0006656_3480_4991 484
124 3300005471 Ga0070698_100060616 Ga0070698_1000606162 487
125 3300038996 Ga0242420_001728 Ga0242420_001728_1150_2757 487
126 3300005434 Ga0070709_10038585 Ga0070709_100385851 491
127 3300044694 Ga0466963_0000874 Ga0466963_0000874_1860_3461 491
128 3300045836 Ga0466958_0005213 Ga0466958_0005213_3544_5145 491
129 3300045976 Ga0466967_0023670 Ga0466967_0023670_1516_3117 491
130 3300045976 Ga0466967_0024573 Ga0466967_0024573_1217_2818 491
131 3300047319 Ga0495674_0018169 Ga0495674_0018169_331_1932 491
132 3300049583 Ga0501067_0019946 Ga0501067_0019946_1663_3180 491
133 3300061719 Ga0466962_0031915 Ga0466962_0031915_89_1690 491
134 3300005434 Ga0070709_10034633 Ga0070709_100346333 492
135 3300013307 Ga0157372_10203748 Ga0157372_102037481 492
136 3300025939 Ga0207665_10004184 Ga0207665_100041847 492
137 3300044694 Ga0466963_0011789 Ga0466963_0011789_1772_3322 492
138 3300041496 Ga0451839_0000609 Ga0451839_0000609_659_2338 493
139 3300048904 Ga0496101_0014782 Ga0496101_0014782_1175_2782 493
140 3300048905 Ga0496102_0052623 Ga0496102_0052623_1548_3155 493
141 3300048909 Ga0496106_0002385 Ga0496106_0002385_9865_11472 493
142 3300048910 Ga0496107_0082710 Ga0496107_0082710_680_2287 493
143 3300048918 Ga0496115_0039862 Ga0496115_0039862_1856_3463 493
144 3300005337 Ga0070682_100044022 Ga0070682_1000440222 495
145 3300005338 Ga0068868_100127106 Ga0068868_1001271062 495
146 3300005366 Ga0070659_100011416 Ga0070659_1000114168 495
147 3300005436 Ga0070713_100051010 Ga0070713_1000510102 495
148 3300005439 Ga0070711_100066445 Ga0070711_1000664451 495
149 3300005441 Ga0070700_100003216 Ga0070700_1000032165 495
150 3300005445 Ga0070708_100104955 Ga0070708_1001049552 495
151 3300005530 Ga0070679_100027957 Ga0070679_1000279572 495
152 3300005539 Ga0068853_100020279 Ga0068853_1000202793 495
153 3300005544 Ga0070686_100034604 Ga0070686_1000346043 495
154 3300005549 Ga0070704_100048546 Ga0070704_1000485462 495
155 3300005577 Ga0068857_100007342 Ga0068857_10000734210 495
156 3300005578 Ga0068854_100071643 Ga0068854_1000716432 495
157 3300005617 Ga0068859_100038228 Ga0068859_1000382283 495
158 3300005718 Ga0068866_10009069 Ga0068866_100090692 495
159 3300005834 Ga0068851_10034344 Ga0068851_100343442 495
160 3300005985 Ga0081539_10025465 Ga0081539_100254652 495
161 3300006028 Ga0070717_10136649 Ga0070717_101366492 495
162 3300006178 Ga0075367_10052443 Ga0075367_100524433 495
163 3300006358 Ga0068871_100087849 Ga0068871_1000878492 495
164 3300006852 Ga0075433_10024198 Ga0075433_100241982 495
165 3300006871 Ga0075434_100004005 Ga0075434_10000400510 495
166 3300006881 Ga0068865_100074585 Ga0068865_1000745852 495
167 3300006914 Ga0075436_100007629 Ga0075436_1000076297 495
168 3300006931 Ga0097620_100038228 Ga0097620_1000382283 495
169 3300009098 Ga0105245_10042050 Ga0105245_100420503 495
170 3300009147 Ga0114129_10007775 Ga0114129_1000777512 495
171 3300009147 Ga0114129_10153550 Ga0114129_101535502 495
172 3300009148 Ga0105243_10006016 Ga0105243_1000601611 495
173 3300009174 Ga0105241_10027922 Ga0105241_100279224 495
174 3300013105 Ga0157369_10118032 Ga0157369_101180322 495
175 3300013306 Ga0163162_10070363 Ga0163162_100703632 495
176 3300013307 Ga0157372_10047944 Ga0157372_100479444 495
177 3300013308 Ga0157375_10153491 Ga0157375_101534912 495
178 3300025927 Ga0207687_10043081 Ga0207687_100430812 495
179 3300025936 Ga0207670_10149887 Ga0207670_101498871 495
180 3300026035 Ga0207703_10146483 Ga0207703_101464832 495
181 3300026075 Ga0207708_10001598 Ga0207708_100015984 495
182 3300026089 Ga0207648_10129017 Ga0207648_101290171 495
183 3300026116 Ga0207674_10054030 Ga0207674_100540303 495
184 3300026142 Ga0207698_10041099 Ga0207698_100410992 495
185 3300037312 Ga0395899_0049216 Ga0395899_0049216_423_1991 495
186 3300037418 Ga0395900_0004208 Ga0395900_0004208_8960_10528 495
187 3300037418 Ga0395900_0078518 Ga0395900_0078518_1245_2813 495
188 3300037466 Ga0395898_0015020 Ga0395898_0015020_1163_2731 495
189 3300037466 Ga0395898_0038057 Ga0395898_0038057_456_2024 495
190 3300037471 Ga0395905_0004895 Ga0395905_0004895_2735_4303 495
191 3300037471 Ga0395905_0010536 Ga0395905_0010536_6638_8206 495
192 3300038443 Ga0395901_0000733 Ga0395901_0000733_19350_20918 495
193 3300038443 Ga0395901_0300250 Ga0395901_0300250_75_1643 495
194 3300048903 Ga0496100_0042249 Ga0496100_0042249_19_1611 495
195 3300048912 Ga0496109_0029595 Ga0496109_0029595_927_2519 495
196 3300048916 Ga0496113_0052273 Ga0496113_0052273_286_1878 495
197 3300048916 Ga0496113_0059076 Ga0496113_0059076_130_1722 495
198 3300049583 Ga0501067_0000728 Ga0501067_0000728_12332_13924 495
199 3300049584 Ga0501068_0000257 Ga0501068_0000257_18227_19819 495
200 3300049585 Ga0501069_0000272 Ga0501069_0000272_3982_5574 495
201 3300050507 nmdc:mga05p37_129850_c1 nmdc:mga05p37_129850_c1_522_2090 495
202 3300050507 nmdc:mga05p37_22769_c1 nmdc:mga05p37_22769_c1_2927_4555 495
203 3300050512 nmdc:mga0n895_117265_c1 nmdc:mga0n895_117265_c1_579_2207 495
204 3300050512 nmdc:mga0n895_39082_c1 nmdc:mga0n895_39082_c1_966_2558 495
205 3300050513 nmdc:mga0rr50_14005_c1 nmdc:mga0rr50_14005_c1_3035_4663 495
206 3300050515 nmdc:mga0a205_45092_c1 nmdc:mga0a205_45092_c1_579_2207 495
207 3300061734 Ga0530510_0004791 Ga0530510_0004791_1549_3141 495
208 3300048908 Ga0496105_0010350 Ga0496105_0010350_705_2252 496
209 3300048912 Ga0496109_0006589 Ga0496109_0006589_4822_6369 496
210 3300048913 Ga0496110_0018203 Ga0496110_0018203_1800_3347 496
211 3300048916 Ga0496113_0070893 Ga0496113_0070893_277_1824 496
212 3300048917 Ga0496114_0030233 Ga0496114_0030233_2858_4405 496
213 3300005435 Ga0070714_100068718 Ga0070714_1000687182 497
214 3300005437 Ga0070710_10014613 Ga0070710_100146132 497
215 3300005439 Ga0070711_100002446 Ga0070711_1000024466 497
216 3300006028 Ga0070717_10078487 Ga0070717_100784872 497
217 3300006175 Ga0070712_100022220 Ga0070712_1000222202 497
218 3300025915 Ga0207693_10008102 Ga0207693_100081023 497
219 3300025916 Ga0207663_10001399 Ga0207663_1000139910 497
220 3300025929 Ga0207664_10017207 Ga0207664_100172074 497
221 3300046463 Ga0495653_0045262 Ga0495653_0045262_798_2390 497
222 3300048917 Ga0496114_0040009 Ga0496114_0040009_1764_3356 497
223 3300048918 Ga0496115_0028997 Ga0496115_0028997_554_2146 497
224 3300005434 Ga0070709_10044191 Ga0070709_100441912 498
225 3300005436 Ga0070713_100044227 Ga0070713_1000442273 498
226 3300005437 Ga0070710_10014613 Ga0070710_100146133 498
227 3300005439 Ga0070711_100002446 Ga0070711_1000024467 498
228 3300005471 Ga0070698_100114668 Ga0070698_1001146682 498
229 3300025898 Ga0207692_10027984 Ga0207692_100279842 498
230 3300025912 Ga0207707_10152609 Ga0207707_101526092 498
231 3300025915 Ga0207693_10008102 Ga0207693_100081024 498
232 3300025916 Ga0207663_10001399 Ga0207663_100013999 498
233 3300025928 Ga0207700_10101072 Ga0207700_101010722 498
234 3300025929 Ga0207664_10017207 Ga0207664_100172075 498
235 3300025933 Ga0207706_10108102 Ga0207706_101081022 498
236 3300028800 Ga0265338_10008114 Ga0265338_100081148 498
237 3300031251 Ga0265327_10001182 Ga0265327_100011829 498
238 3300039438 Ga0436360_0126379 Ga0436360_0126379_5174_6763 498
239 3300039438 Ga0436360_0917953 Ga0436360_0917953_754_2355 498
240 3300045976 Ga0466967_0095268 Ga0466967_0095268_188_1753 498
241 3300045976 Ga0466967_0100070 Ga0466967_0100070_873_2390 498
242 3300045976 Ga0466967_0164974 Ga0466967_0164974_31_1587 498
243 3300048917 Ga0496114_0040009 Ga0496114_0040009_36_1640 498
244 3300048918 Ga0496115_0028997 Ga0496115_0028997_2270_3874 498
245 3300005435 Ga0070714_100129681 Ga0070714_1001296811 499
246 3300005468 Ga0070707_100102063 Ga0070707_1001020632 499
247 3300005545 Ga0070695_100066441 Ga0070695_1000664412 499
248 3300005546 Ga0070696_100087139 Ga0070696_1000871392 499
249 3300005563 Ga0068855_100195116 Ga0068855_1001951161 499
250 3300005985 Ga0081539_10003435 Ga0081539_1000343521 499
251 3300013296 Ga0157374_10006008 Ga0157374_1000600810 499
252 3300025901 Ga0207688_10015606 Ga0207688_100156063 499
253 3300025915 Ga0207693_10002338 Ga0207693_1000233812 499
254 3300025922 Ga0207646_10099124 Ga0207646_100991241 499
255 3300025927 Ga0207687_10114285 Ga0207687_101142851 499
256 3300025949 Ga0207667_10114985 Ga0207667_101149851 499
257 3300026118 Ga0207675_100084130 Ga0207675_1000841302 499
258 3300028800 Ga0265338_10010391 Ga0265338_100103916 499
259 3300048909 Ga0496106_0005194 Ga0496106_0005194_1868_3433 499
260 3300048915 Ga0496112_0002527 Ga0496112_0002527_5248_6831 499
261 3300048915 Ga0496112_0081909 Ga0496112_0081909_1436_3010 499
262 3300005327 Ga0070658_10038592 Ga0070658_100385923 500
263 3300005328 Ga0070676_10039911 Ga0070676_100399112 500
264 3300005329 Ga0070683_100064325 Ga0070683_1000643252 500
265 3300005334 Ga0068869_100007121 Ga0068869_1000071219 500
266 3300005336 Ga0070680_100108955 Ga0070680_1001089552 500
267 3300005339 Ga0070660_100001589 Ga0070660_1000015898 500
268 3300005354 Ga0070675_100043848 Ga0070675_1000438484 500
269 3300005355 Ga0070671_100111513 Ga0070671_1001115132 500
270 3300005435 Ga0070714_100111454 Ga0070714_1001114542 500
271 3300005437 Ga0070710_10033160 Ga0070710_100331602 500
272 3300005439 Ga0070711_100011945 Ga0070711_1000119452 500
273 3300005439 Ga0070711_100028307 Ga0070711_1000283072 500
274 3300005444 Ga0070694_100015984 Ga0070694_1000159844 500
275 3300005458 Ga0070681_10026888 Ga0070681_100268882 500
276 3300005458 Ga0070681_10114825 Ga0070681_101148252 500
277 3300005458 Ga0070681_10134911 Ga0070681_101349111 500
278 3300005468 Ga0070707_100128928 Ga0070707_1001289281 500
279 3300005468 Ga0070707_100156970 Ga0070707_1001569702 500
280 3300005471 Ga0070698_100207369 Ga0070698_1002073691 500
281 3300005518 Ga0070699_100037830 Ga0070699_1000378302 500
282 3300005518 Ga0070699_100056571 Ga0070699_1000565713 500
283 3300005535 Ga0070684_100013631 Ga0070684_1000136312 500
284 3300005535 Ga0070684_100103893 Ga0070684_1001038932 500
285 3300005536 Ga0070697_100055667 Ga0070697_1000556672 500
286 3300005549 Ga0070704_100007955 Ga0070704_1000079551 500
287 3300005563 Ga0068855_100009022 Ga0068855_1000090224 500
288 3300005563 Ga0068855_100075743 Ga0068855_1000757435 500
289 3300005577 Ga0068857_100084183 Ga0068857_1000841832 500
290 3300005578 Ga0068854_100024931 Ga0068854_1000249312 500
291 3300005614 Ga0068856_100014165 Ga0068856_1000141656 500
292 3300005614 Ga0068856_100153974 Ga0068856_1001539742 500
293 3300005615 Ga0070702_100035775 Ga0070702_1000357752 500
294 3300005617 Ga0068859_100024026 Ga0068859_1000240263 500
295 3300005719 Ga0068861_100042803 Ga0068861_1000428032 500
296 3300005842 Ga0068858_100055003 Ga0068858_1000550033 500
297 3300006028 Ga0070717_10014587 Ga0070717_100145878 500
298 3300006175 Ga0070712_100001811 Ga0070712_1000018117 500
299 3300006237 Ga0097621_100039775 Ga0097621_1000397752 500
300 3300006358 Ga0068871_100049539 Ga0068871_1000495392 500
301 3300006871 Ga0075434_100001151 Ga0075434_10000115111 500
302 3300006871 Ga0075434_100002405 Ga0075434_10000240512 500
303 3300006871 Ga0075434_100033254 Ga0075434_1000332542 500
304 3300006914 Ga0075436_100000676 Ga0075436_10000067621 500
305 3300006914 Ga0075436_100005473 Ga0075436_1000054738 500
306 3300006931 Ga0097620_100024027 Ga0097620_1000240273 500
307 3300007076 Ga0075435_100000660 Ga0075435_10000066012 500
308 3300007076 Ga0075435_100027352 Ga0075435_1000273524 500
309 3300009093 Ga0105240_10012061 Ga0105240_100120619 500
310 3300009098 Ga0105245_10059049 Ga0105245_100590492 500
311 3300009101 Ga0105247_10010281 Ga0105247_100102815 500
312 3300009147 Ga0114129_10035346 Ga0114129_100353463 500
313 3300009551 Ga0105238_10019112 Ga0105238_100191122 500
314 3300009553 Ga0105249_10053486 Ga0105249_100534863 500
315 3300013105 Ga0157369_10021993 Ga0157369_100219935 500
316 3300013105 Ga0157369_10026927 Ga0157369_100269277 500
317 3300013105 Ga0157369_10066984 Ga0157369_100669842 500
318 3300013296 Ga0157374_10049600 Ga0157374_100496003 500
319 3300014968 Ga0157379_10091241 Ga0157379_100912412 500
320 3300014969 Ga0157376_10039470 Ga0157376_100394704 500
321 3300020082 Ga0206353_10676799 Ga0206353_106767991 500
322 3300025901 Ga0207688_10090959 Ga0207688_100909592 500
323 3300025913 Ga0207695_10036100 Ga0207695_100361002 500
324 3300025913 Ga0207695_10074871 Ga0207695_100748712 500
325 3300025915 Ga0207693_10005822 Ga0207693_100058229 500
326 3300025915 Ga0207693_10033511 Ga0207693_100335111 500
327 3300025916 Ga0207663_10011307 Ga0207663_100113072 500
328 3300025919 Ga0207657_10002639 Ga0207657_100026393 500
329 3300025919 Ga0207657_10006634 Ga0207657_1000663411 500
330 3300025922 Ga0207646_10084537 Ga0207646_100845371 500
331 3300025927 Ga0207687_10003126 Ga0207687_100031262 500
332 3300025927 Ga0207687_10013143 Ga0207687_100131432 500
333 3300025939 Ga0207665_10015956 Ga0207665_100159563 500
334 3300025949 Ga0207667_10031497 Ga0207667_100314976 500
335 3300025981 Ga0207640_10062278 Ga0207640_100622782 500
336 3300026035 Ga0207703_10031423 Ga0207703_100314235 500
337 3300026078 Ga0207702_10003636 Ga0207702_1000363612 500
338 3300026078 Ga0207702_10035811 Ga0207702_100358112 500
339 3300026116 Ga0207674_10070902 Ga0207674_100709023 500
340 3300026118 Ga0207675_100042992 Ga0207675_1000429922 500
341 3300026121 Ga0207683_10001825 Ga0207683_100018258 500
342 3300026121 Ga0207683_10049189 Ga0207683_100491892 500
343 3300028556 Ga0265337_1009408 Ga0265337_10094082 500
344 3300028563 Ga0265319_1002649 Ga0265319_10026494 500
345 3300028563 Ga0265319_1006935 Ga0265319_10069353 500
346 3300028577 Ga0265318_10000065 Ga0265318_1000006539 500
347 3300031238 Ga0265332_10006048 Ga0265332_100060485 500
348 3300031239 Ga0265328_10006266 Ga0265328_100062662 500
349 3300031240 Ga0265320_10024573 Ga0265320_100245731 500
350 3300031241 Ga0265325_10001733 Ga0265325_100017334 500
351 3300031242 Ga0265329_10007386 Ga0265329_100073863 500
352 3300031247 Ga0265340_10003106 Ga0265340_100031063 500
353 3300031251 Ga0265327_10036338 Ga0265327_100363382 500
354 3300031344 Ga0265316_10007012 Ga0265316_100070128 500
355 3300031344 Ga0265316_10013879 Ga0265316_100138792 500
356 3300031595 Ga0265313_10005955 Ga0265313_100059553 500
357 3300031711 Ga0265314_10012798 Ga0265314_100127983 500
358 3300031712 Ga0265342_10005194 Ga0265342_100051943 500
359 3300034816 Ga0373930_0003418 Ga0373930_0003418_213_1919 500
360 3300034820 Ga0373959_0003187 Ga0373959_0003187_38_1657 500
361 3300035083 Ga0373926_0026748 Ga0373926_0026748_68_1669 500
362 3300035088 Ga0373940_0000244 Ga0373940_0000244_3953_5659 500
363 3300035091 Ga0373951_0002498 Ga0373951_0002498_216_1922 500
364 3300035112 Ga0373932_0001551 Ga0373932_0001551_4182_5888 500
365 3300035114 Ga0373939_0005788 Ga0373939_0005788_494_2200 500
366 3300035170 Ga0373943_0022998 Ga0373943_0022998_822_2423 500
367 3300035172 Ga0373955_0033245 Ga0373955_0033245_333_1931 500
368 3300035241 Ga0373961_0002090 Ga0373961_0002090_3236_4942 500
369 3300035691 Ga0373931_0000692 Ga0373931_0000692_7308_9014 500
370 3300035692 Ga0373935_0071147 Ga0373935_0071147_499_2121 500
371 3300035692 Ga0373935_0098172 Ga0373935_0098172_260_1861 500
372 3300035725 Ga0373947_0094799 Ga0373947_0094799_142_1764 500
373 3300036401 Ga0373937_0064209 Ga0373937_0064209_1626_3227 500
374 3300037068 Ga0373925_0004875 Ga0373925_0004875_5339_6940 500
375 3300037418 Ga0395900_0069122 Ga0395900_0069122_1590_3236 500
376 3300037466 Ga0395898_0010456 Ga0395898_0010456_7569_9215 500
377 3300037471 Ga0395905_0194487 Ga0395905_0194487_143_1747 500
378 3300038443 Ga0395901_0040707 Ga0395901_0040707_2302_3948 500
379 3300044694 Ga0466963_0011789 Ga0466963_0011789_3419_5026 500
380 3300044842 Ga0466957_0008193 Ga0466957_0008193_2493_4094 500
381 3300044842 Ga0466957_0008193 Ga0466957_0008193_4191_5798 500
382 3300044901 Ga0466960_0006573 Ga0466960_0006573_2688_4289 500
383 3300045976 Ga0466967_0024573 Ga0466967_0024573_2915_4522 500
384 3300046462 Ga0495651_0072763 Ga0495651_0072763_119_1717 500
385 3300046473 Ga0495582_0003879 Ga0495582_0003879_1737_3338 500
386 3300046475 Ga0495639_0001038 Ga0495639_0001038_4984_6585 500
387 3300046476 Ga0495662_0002913 Ga0495662_0002913_6851_8452 500
388 3300046477 Ga0495664_0026252 Ga0495664_0026252_787_2388 500
389 3300046511 Ga0495608_0004234 Ga0495608_0004234_2656_4257 500
390 3300046531 Ga0495665_0002442 Ga0495665_0002442_5202_6803 500
391 3300046533 Ga0495640_0014783 Ga0495640_0014783_1570_3171 500
392 3300046559 Ga0495667_0018535 Ga0495667_0018535_1993_3591 500
393 3300046615 Ga0495656_0008540 Ga0495656_0008540_1895_3517 500
394 3300046642 Ga0495634_0009793 Ga0495634_0009793_1570_3171 500
395 3300046663 Ga0495635_0018127 Ga0495635_0018127_1737_3338 500
396 3300046674 Ga0495588_0005968 Ga0495588_0005968_2313_3914 500
397 3300046675 Ga0495657_0005435 Ga0495657_0005435_7372_8973 500
398 3300046675 Ga0495657_0033048 Ga0495657_0033048_1866_3464 500
399 3300046681 Ga0495647_0002246 Ga0495647_0002246_2482_4083 500
400 3300046683 Ga0495658_0002914 Ga0495658_0002914_5517_7118 500
401 3300046689 Ga0495613_0005198 Ga0495613_0005198_4146_5747 500
402 3300046690 Ga0495624_0016169 Ga0495624_0016169_1861_3462 500
403 3300046809 Ga0495600_0011687 Ga0495600_0011687_283_1884 500
404 3300047317 Ga0495604_0042811 Ga0495604_0042811_1248_2849 500
405 3300047319 Ga0495674_0027619 Ga0495674_0027619_1582_3183 500
406 3300047321 Ga0495676_0029108 Ga0495676_0029108_1496_3097 500
407 3300047321 Ga0495676_0038917 Ga0495676_0038917_1557_3158 500
408 3300047322 Ga0495680_0019548 Ga0495680_0019548_456_2057 500
409 3300047322 Ga0495680_0020200 Ga0495680_0020200_1564_3162 500
410 3300047322 Ga0495680_0097278 Ga0495680_0097278_464_2065 500
411 3300048903 Ga0496100_0042643 Ga0496100_0042643_620_2242 500
412 3300048904 Ga0496101_0026413 Ga0496101_0026413_163_1764 500
413 3300048905 Ga0496102_0062219 Ga0496102_0062219_1568_3190 500
414 3300048907 Ga0496104_0001632 Ga0496104_0001632_6747_8453 500
415 3300048907 Ga0496104_0010570 Ga0496104_0010570_223_1824 500
416 3300048908 Ga0496105_0009655 Ga0496105_0009655_1601_3307 500
417 3300048908 Ga0496105_0012182 Ga0496105_0012182_1835_3436 500
418 3300048908 Ga0496105_0031394 Ga0496105_0031394_2284_3906 500
419 3300048909 Ga0496106_0001671 Ga0496106_0001671_1153_2670 500
420 3300048909 Ga0496106_0002385 Ga0496106_0002385_11569_13170 500
421 3300048909 Ga0496106_0003960 Ga0496106_0003960_1796_3397 500
422 3300048909 Ga0496106_0047503 Ga0496106_0047503_1158_2864 500
423 3300048910 Ga0496107_0003972 Ga0496107_0003972_6500_8101 500
424 3300048911 Ga0496108_0009135 Ga0496108_0009135_495_2201 500
425 3300048911 Ga0496108_0014119 Ga0496108_0014119_1836_3437 500
426 3300048911 Ga0496108_0078603 Ga0496108_0078603_240_1847 500
427 3300048911 Ga0496108_0133450 Ga0496108_0133450_28_1650 500
428 3300048912 Ga0496109_0005462 Ga0496109_0005462_6790_8391 500
429 3300048912 Ga0496109_0017018 Ga0496109_0017018_605_2227 500
430 3300048912 Ga0496109_0018491 Ga0496109_0018491_1000_2517 500
431 3300048912 Ga0496109_0037510 Ga0496109_0037510_2324_3931 500
432 3300048912 Ga0496109_0037510 Ga0496109_0037510_625_2226 500
433 3300048912 Ga0496109_0085755 Ga0496109_0085755_1158_2864 500
434 3300048913 Ga0496110_0005152 Ga0496110_0005152_6933_8534 500
435 3300048913 Ga0496110_0011083 Ga0496110_0011083_711_2417 500
436 3300048913 Ga0496110_0040528 Ga0496110_0040528_1149_2771 500
437 3300048914 Ga0496111_0004148 Ga0496111_0004148_2545_4146 500
438 3300048914 Ga0496111_0042181 Ga0496111_0042181_987_2609 500
439 3300048914 Ga0496111_0131031 Ga0496111_0131031_129_1730 500
440 3300048915 Ga0496112_0001131 Ga0496112_0001131_12955_14556 500
441 3300048915 Ga0496112_0060795 Ga0496112_0060795_1935_3452 500
442 3300048915 Ga0496112_0063065 Ga0496112_0063065_1526_3127 500
443 3300048915 Ga0496112_0075679 Ga0496112_0075679_1522_3063 500
444 3300048915 Ga0496112_0238122 Ga0496112_0238122_41_1558 500
445 3300048916 Ga0496113_0013448 Ga0496113_0013448_381_1982 500
446 3300048916 Ga0496113_0058857 Ga0496113_0058857_448_2055 500
447 3300048917 Ga0496114_0007338 Ga0496114_0007338_5747_7453 500
448 3300048917 Ga0496114_0063062 Ga0496114_0063062_1504_3054 500
449 3300048918 Ga0496115_0021452 Ga0496115_0021452_385_2091 500
450 3300048918 Ga0496115_0039862 Ga0496115_0039862_158_1759 500
451 3300049583 Ga0501067_0001714 Ga0501067_0001714_8824_10425 500
452 3300049585 Ga0501069_0016122 Ga0501069_0016122_1649_3250 500
453 3300050512 nmdc:mga0n895_11145_c1 nmdc:mga0n895_11145_c1_1901_3502 500
454 3300050512 nmdc:mga0n895_132553_c1 nmdc:mga0n895_132553_c1_707_2422 500
455 3300050513 nmdc:mga0rr50_5823_c1 nmdc:mga0rr50_5823_c1_3805_5406 500
456 3300050514 nmdc:mga08x19_16343_c1 nmdc:mga08x19_16343_c1_1572_3173 500
457 3300050514 nmdc:mga08x19_19252_c1 nmdc:mga08x19_19252_c1_945_2660 500
458 3300050514 nmdc:mga08x19_21977_c1 nmdc:mga08x19_21977_c1_1878_3479 500
459 3300050515 nmdc:mga0a205_19375_c1 nmdc:mga0a205_19375_c1_731_2446 500
460 3300053077 Ga0495601_0001410 Ga0495601_0001410_133_1734 500
461 3300053085 Ga0495619_0080048 Ga0495619_0080048_50_1651 500
462 3300061734 Ga0530510_0034431 Ga0530510_0034431_717_2318 500
463 3300006028 Ga0070717_10084505 Ga0070717_100845053 501
464 3300006058 Ga0075432_10001933 Ga0075432_100019336 501
465 3300006844 Ga0075428_100047206 Ga0075428_1000472066 501
466 3300006847 Ga0075431_100006298 Ga0075431_1000062986 501
467 3300006914 Ga0075436_100046651 Ga0075436_1000466512 501
468 3300007076 Ga0075435_100016527 Ga0075435_1000165272 501
469 3300009094 Ga0111539_10029793 Ga0111539_100297932 501
470 3300025915 Ga0207693_10003020 Ga0207693_100030203 501
471 3300027907 Ga0207428_10007122 Ga0207428_100071225 501
472 3300037312 Ga0395899_0039514 Ga0395899_0039514_332_1915 501
473 3300041507 Ga0451851_1018579 Ga0451851_1018579_71_1750 501
474 3300048915 Ga0496112_0080680 Ga0496112_0080680_1085_2689 501
475 3300050510 nmdc:mga06r32_22086_c1 nmdc:mga06r32_22086_c1_1584_3191 501
476 3300050511 nmdc:mga08y16_28819_c1 nmdc:mga08y16_28819_c1_1553_3160 501
477 3300050512 nmdc:mga0n895_11722_c1 nmdc:mga0n895_11722_c1_1524_3131 501
478 3300050515 nmdc:mga0a205_13617_c1 nmdc:mga0a205_13617_c1_1691_3298 501
479 3300005327 Ga0070658_10028173 Ga0070658_100281732 503
480 3300005530 Ga0070679_100099556 Ga0070679_1000995562 503
481 3300025921 Ga0207652_10079985 Ga0207652_100799852 503
482 3300045976 Ga0466967_0174735 Ga0466967_0174735_337_1929 503
483 3300049571 Ga0501034_0018101 Ga0501034_0018101_2568_4142 503
484 3300049586 Ga0501070_0010919 Ga0501070_0010919_497_2071 503
485 3300049586 Ga0501070_0029240 Ga0501070_0029240_2551_4125 503
486 3300049589 Ga0501073_0050892 Ga0501073_0050892_310_1884 503
487 3300049590 Ga0501074_0053588 Ga0501074_0053588_264_1838 503
488 3300049590 Ga0501074_0080473 Ga0501074_0080473_115_1689 503
489 3300049742 Ga0501080_0006255 Ga0501080_0006255_404_1978 503
490 3300049742 Ga0501080_0043232 Ga0501080_0043232_1947_3521 503
491 3300049744 Ga0501083_0000383 Ga0501083_0000383_24536_26110 503

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00990

GGDEF

Diguanylate cyclase, GGDEF domain

428

573

0.95

PF01590

GAF

GAF domain

264

415

0.75

PF01590

GAF

GAF domain

81

233

0.72

PF13185

GAF_2

GAF domain

263

416

0.67

Structural Annotation

Top 5 Hits

ID Description Score Start End
7a7e-assembly1.cif.gz_A structure of a delta-n mutant - e232start - of pa1120 (tpbb or yfin) from pseudomonas aeruginosa (pao1) comprising only the ggdef domain 0.9469 354 502
4iob-assembly1.cif.gz_A crystal structure of the ggdef domain of pa1120 (yfin or tpbb) from pseudomonas aeruginosa at 2.7 ang. 0.9455 358 503
5euh-assembly2.cif.gz_B crystal structure of the c-di-gmp-bound ggdef domain of p. fluorescens gcbc 0.937 354 502
4urs-assembly1.cif.gz_A crystal structure of ggdef domain from t.maritima 0.9369 354 502
6tts-assembly1.cif.gz_A crystal structure of the ggdef domain of dgcb from caulobacter crescentus in complex with c-di-gmp 0.9358 352 501
ID Description Score Start End Superfamily
af_P38097_675_846_3.30.70.270 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Reverse transcriptase/Diguanylate cyclase domain 0.9455 346 502 3.30.70.270
4iobA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Reverse transcriptase/Diguanylate cyclase domain 0.9455 358 503 3.30.70.270
3i5cB02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Reverse transcriptase/Diguanylate cyclase domain 0.9406 354 503 3.30.70.270
5euhB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Reverse transcriptase/Diguanylate cyclase domain 0.937 354 502 3.30.70.270
4ursA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Reverse transcriptase/Diguanylate cyclase domain 0.9369 354 502 3.30.70.270
ID Description Score Start End GO Terms
AF-A8DW58-F1-model_v4 GGDEF domain-containing protein 0.9538 355 495 GO:0016829
AF-A0A4Q6D9T6-F1-model_v4 deleted 0.9476 343 500
AF-A0A1E4QME9-F1-model_v4 deleted 0.9403 362 460
AF-A0A2I2A6W6-F1-model_v4 Diguanylate cyclase 0.9349 345 502
AF-A0A7W1MGI2-F1-model_v4 deleted 0.9344 360 502

Feature Viewer

pLDDT pTM Quality
90.74 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map