F454122
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 491 | 223 | 446 | 528 |
Family's Representative Sequence
| Representative Sequence | 3300028563|Ga0265319_1002649|Ga0265319_10026494 |
| Length | 578 |
| Sequence | VTAISRLRERAAGWPPSLVSGARRAAQEWTFVRGMCDRARFRKRPELPIPKPNTVAPPSXXXVSPLQGLLEVTRLVRAEENLPDLLGAIARTIADSLGYETVVVNLYRPAWDDFTVTTVLGSDAAQAALMGQIRSVDEWDTLICDRYARRGAYVVPAGSYDWDTASYSYVPTAEPGDAADGWRPEDALFLPMRHSDGHLLGVLSVDEPVSRKRATDEELDVLVAVADHAALAIQAAQEAADAVRHRVSLEQLLEVSSRLTAEPAADEILRDVCRGVRDALGFQNVAAQLIHPASGRLEARAAVGWDLDGEALSSEFEFGDVEPLLDSAFEVSGCFLLPNDEAERRLSHDSLPYVSHRNGRGPHAWDRHWLLVPLHNNAGAVIGLIWADEPEDRLLPSEEKLQALRIFANQAAAAIVSAAHQRELRFLADHDPLTRLLNRRAFVERLDAEVALAIRYRRTFGLVICDLDGFKLLNDQFGHAAGDEALQVFARILHAAVRKGDEAFRIGGDEFALVLAEAGEAEAREVIKRIADDVAGPRASFGIASCPDNARDPQALFRLADQALYEAKRTGSGLEFVA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 22 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 29 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 35 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 36 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 37 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 38 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 40 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 41 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 42 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 43 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 44 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 45 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 46 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 47 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 48 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 49 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 51 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 53 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 55 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 56 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 57 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 58 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 59 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 60 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 61 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 63 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 82 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 83 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 114 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 116 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 117 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 118 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 119 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 120 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 121 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 122 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 123 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 124 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 125 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 126 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 127 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 128 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 129 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 130 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 131 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 132 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 133 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 134 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 135 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 136 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 137 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 138 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 139 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 140 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 141 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 142 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 143 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 144 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 145 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 146 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 147 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 148 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 149 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 150 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 151 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 152 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 153 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 154 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 155 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 156 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 157 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 158 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 159 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 160 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 161 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 162 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 189 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 190 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 191 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 192 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 193 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 194 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 195 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 196 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 197 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 198 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 199 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 200 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 201 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 202 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 203 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 204 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 205 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 206 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 207 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 208 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 209 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 210 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 211 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 212 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 213 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 214 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 215 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 216 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 217 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 218 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 219 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 220 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 223 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.59 |
| Metatranscriptomes | 0.41 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.2 |
| Nodule | 0 |
| Rhizoplane | 21.18 |
| Rhizosphere | 78.21 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.41 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10028173 | 3300005327 | Bacteria | 4508 |
| 2 | Ga0070658_10038592 | 3300005327 | Bacteria | 3851 |
| 3 | Ga0070676_10039911 | 3300005328 | Bacteria | 2716 |
| 4 | Ga0070683_100007102 | 3300005329 | Bacteria | 9437 |
| 5 | Ga0070683_100064325 | 3300005329 | Bacteria | 3414 |
| 6 | Ga0070683_100080643 | 3300005329 | Bacteria | 3046 |
| 7 | Ga0068869_100007121 | 3300005334 | Bacteria | 7125 |
| 8 | Ga0070680_100108955 | 3300005336 | Bacteria | 2304 |
| 9 | Ga0070682_100044022 | 3300005337 | Bacteria | 2762 |
| 10 | Ga0070682_100107158 | 3300005337 | Bacteria | 1856 |
| 11 | Ga0068868_100031902 | 3300005338 | Bacteria | 4050 |
| 12 | Ga0068868_100127106 | 3300005338 | Bacteria | 2083 |
| 13 | Ga0070660_100001589 | 3300005339 | Bacteria | 15629 |
| 14 | Ga0070675_100043848 | 3300005354 | Bacteria | 3658 |
| 15 | Ga0070671_100111513 | 3300005355 | Bacteria | 2298 |
| 16 | Ga0070659_100011416 | 3300005366 | Bacteria | 6570 |
| 17 | Ga0070709_10034633 | 3300005434 | Bacteria | 3062 |
| 18 | Ga0070709_10038585 | 3300005434 | Bacteria | 2926 |
| 19 | Ga0070709_10044191 | 3300005434 | Bacteria | 2758 |
| 20 | Ga0070714_100043938 | 3300005435 | Bacteria | 3781 |
| 21 | Ga0070714_100068718 | 3300005435 | Bacteria | 3057 |
| 22 | Ga0070714_100111454 | 3300005435 | Bacteria | 2423 |
| 23 | Ga0070714_100129681 | 3300005435 | Bacteria | 2252 |
| 24 | Ga0070713_100044227 | 3300005436 | Bacteria | 3644 |
| 25 | Ga0070713_100051010 | 3300005436 | Bacteria | 3421 |
| 26 | Ga0070710_10014613 | 3300005437 | Bacteria | 3955 |
| 27 | Ga0070710_10033160 | 3300005437 | Bacteria | 2803 |
| 28 | Ga0070711_100002446 | 3300005439 | Bacteria | 10597 |
| 29 | Ga0070711_100011945 | 3300005439 | Bacteria | 5407 |
| 30 | Ga0070711_100028307 | 3300005439 | Bacteria | 3686 |
| 31 | Ga0070711_100066445 | 3300005439 | Bacteria | 2526 |
| 32 | Ga0070700_100003216 | 3300005441 | Bacteria | 8392 |
| 33 | Ga0070694_100015984 | 3300005444 | Bacteria | 4722 |
| 34 | Ga0070708_100104955 | 3300005445 | Bacteria | 2592 |
| 35 | Ga0070681_10026888 | 3300005458 | Bacteria | 5785 |
| 36 | Ga0070681_10029974 | 3300005458 | Bacteria | 5460 |
| 37 | Ga0070681_10114825 | 3300005458 | Bacteria | 2631 |
| 38 | Ga0070681_10134911 | 3300005458 | Bacteria | 2399 |
| 39 | Ga0070681_10203610 | 3300005458 | Bacteria | 1897 |
| 40 | Ga0068867_100036543 | 3300005459 | Bacteria | 3566 |
| 41 | Ga0070707_100102063 | 3300005468 | Bacteria | 2779 |
| 42 | Ga0070707_100128928 | 3300005468 | Bacteria | 2458 |
| 43 | Ga0070707_100156970 | 3300005468 | Bacteria | 2217 |
| 44 | Ga0070707_100208361 | 3300005468 | Bacteria | 1906 |
| 45 | Ga0070698_100060616 | 3300005471 | Bacteria | 3818 |
| 46 | Ga0070698_100114668 | 3300005471 | Bacteria | 2659 |
| 47 | Ga0070698_100207369 | 3300005471 | Bacteria | 1895 |
| 48 | Ga0070699_100037830 | 3300005518 | Bacteria | 4176 |
| 49 | Ga0070699_100056571 | 3300005518 | Bacteria | 3397 |
| 50 | Ga0070679_100027957 | 3300005530 | Bacteria | 5557 |
| 51 | Ga0070679_100056818 | 3300005530 | Bacteria | 3900 |
| 52 | Ga0070679_100099556 | 3300005530 | Bacteria | 2894 |
| 53 | Ga0070684_100013631 | 3300005535 | Bacteria | 6560 |
| 54 | Ga0070684_100028512 | 3300005535 | Bacteria | 4724 |
| 55 | Ga0070684_100042525 | 3300005535 | Bacteria | 3923 |
| 56 | Ga0070684_100103893 | 3300005535 | Bacteria | 2542 |
| 57 | Ga0070697_100055667 | 3300005536 | Bacteria | 3216 |
| 58 | Ga0068853_100020279 | 3300005539 | Bacteria | 5527 |
| 59 | Ga0070686_100034604 | 3300005544 | Bacteria | 3114 |
| 60 | Ga0070695_100066441 | 3300005545 | Bacteria | 2350 |
| 61 | Ga0070696_100087139 | 3300005546 | Unclassified | 2217 |
| 62 | Ga0070693_100021099 | 3300005547 | Bacteria | 3446 |
| 63 | Ga0070704_100007955 | 3300005549 | Bacteria | 6328 |
| 64 | Ga0070704_100048546 | 3300005549 | Bacteria | 2972 |
| 65 | Ga0068855_100009022 | 3300005563 | Bacteria | 12051 |
| 66 | Ga0068855_100075743 | 3300005563 | Bacteria | 3906 |
| 67 | Ga0068855_100195116 | 3300005563 | Unclassified | 2281 |
| 68 | Ga0068857_100007342 | 3300005577 | Bacteria | 9491 |
| 69 | Ga0068857_100084183 | 3300005577 | Bacteria | 2842 |
| 70 | Ga0068854_100024931 | 3300005578 | Bacteria | 4101 |
| 71 | Ga0068854_100071643 | 3300005578 | Bacteria | 2536 |
| 72 | Ga0068856_100014165 | 3300005614 | Bacteria | 7710 |
| 73 | Ga0068856_100153974 | 3300005614 | Bacteria | 2309 |
| 74 | Ga0070702_100035775 | 3300005615 | Bacteria | 2745 |
| 75 | Ga0068852_100088136 | 3300005616 | Bacteria | 2771 |
| 76 | Ga0068859_100024026 | 3300005617 | Bacteria | 6116 |
| 77 | Ga0068859_100038228 | 3300005617 | Bacteria | 4815 |
| 78 | Ga0068866_10009069 | 3300005718 | Bacteria | 4216 |
| 79 | Ga0068861_100042803 | 3300005719 | Bacteria | 3396 |
| 80 | Ga0068851_10034344 | 3300005834 | Bacteria | 2531 |
| 81 | Ga0068858_100055003 | 3300005842 | Bacteria | 3679 |
| 82 | Ga0068860_100273221 | 3300005843 | Bacteria | 1650 |
| 83 | Ga0081455_10001455 | 3300005937 | Bacteria | 29310 |
| 84 | Ga0081540_1000314 | 3300005983 | Bacteria | 50231 |
| 85 | Ga0081539_10003435 | 3300005985 | Bacteria | 19473 |
| 86 | Ga0081539_10014597 | 3300005985 | Bacteria | 5794 |
| 87 | Ga0081539_10025465 | 3300005985 | Bacteria | 3809 |
| 88 | Ga0070717_10011836 | 3300006028 | Bacteria | 6637 |
| 89 | Ga0070717_10014587 | 3300006028 | Bacteria | 6049 |
| 90 | Ga0070717_10078487 | 3300006028 | Bacteria | 2766 |
| 91 | Ga0070717_10084505 | 3300006028 | Bacteria | 2670 |
| 92 | Ga0070717_10136649 | 3300006028 | Bacteria | 2112 |
| 93 | Ga0075432_10001933 | 3300006058 | Bacteria | 6877 |
| 94 | Ga0070712_100001811 | 3300006175 | Bacteria | 13024 |
| 95 | Ga0070712_100022220 | 3300006175 | Bacteria | 4175 |
| 96 | Ga0075367_10052443 | 3300006178 | Bacteria | 2414 |
| 97 | Ga0097621_100039775 | 3300006237 | Bacteria | 3779 |
| 98 | Ga0068871_100049539 | 3300006358 | Bacteria | 3395 |
| 99 | Ga0068871_100087849 | 3300006358 | Bacteria | 2585 |
| 100 | Ga0075428_100047206 | 3300006844 | Bacteria | 4731 |
| 101 | Ga0075431_100006298 | 3300006847 | Bacteria | 11790 |
| 102 | Ga0075433_10024198 | 3300006852 | Bacteria | 5122 |
| 103 | Ga0075433_10085179 | 3300006852 | Bacteria | 2790 |
| 104 | Ga0075434_100001151 | 3300006871 | Bacteria | 21864 |
| 105 | Ga0075434_100002405 | 3300006871 | Bacteria | 16436 |
| 106 | Ga0075434_100004005 | 3300006871 | Bacteria | 13192 |
| 107 | Ga0075434_100033254 | 3300006871 | Bacteria | 5088 |
| 108 | Ga0068865_100074585 | 3300006881 | Bacteria | 2416 |
| 109 | Ga0075436_100000676 | 3300006914 | Bacteria | 22467 |
| 110 | Ga0075436_100005473 | 3300006914 | Bacteria | 8732 |
| 111 | Ga0075436_100007629 | 3300006914 | Bacteria | 7393 |
| 112 | Ga0075436_100046651 | 3300006914 | Bacteria | 2988 |
| 113 | Ga0097620_100024027 | 3300006931 | Bacteria | 6116 |
| 114 | Ga0097620_100038228 | 3300006931 | Bacteria | 4815 |
| 115 | Ga0075435_100000660 | 3300007076 | Bacteria | 21225 |
| 116 | Ga0075435_100016527 | 3300007076 | Bacteria | 5564 |
| 117 | Ga0075435_100027352 | 3300007076 | Bacteria | 4460 |
| 118 | Ga0105240_10012061 | 3300009093 | Bacteria | 11975 |
| 119 | Ga0111539_10029793 | 3300009094 | Bacteria | 6643 |
| 120 | Ga0105245_10042050 | 3300009098 | Bacteria | 4076 |
| 121 | Ga0105245_10059049 | 3300009098 | Bacteria | 3453 |
| 122 | Ga0105245_10060297 | 3300009098 | Bacteria | 3417 |
| 123 | Ga0105245_10168134 | 3300009098 | Bacteria | 2086 |
| 124 | Ga0105247_10010281 | 3300009101 | Bacteria | 5663 |
| 125 | Ga0114129_10007775 | 3300009147 | Bacteria | 15253 |
| 126 | Ga0114129_10035346 | 3300009147 | Bacteria | 7058 |
| 127 | Ga0114129_10153550 | 3300009147 | Bacteria | 3150 |
| 128 | Ga0105243_10006016 | 3300009148 | Bacteria | 9395 |
| 129 | Ga0105243_10098984 | 3300009148 | Bacteria | 2417 |
| 130 | Ga0105241_10027922 | 3300009174 | Bacteria | 4202 |
| 131 | Ga0105242_10054335 | 3300009176 | Bacteria | 3273 |
| 132 | Ga0105238_10016714 | 3300009551 | Bacteria | 7435 |
| 133 | Ga0105238_10019112 | 3300009551 | Bacteria | 6980 |
| 134 | Ga0105249_10053486 | 3300009553 | Bacteria | 3690 |
| 135 | Ga0157369_10021993 | 3300013105 | Bacteria | 7127 |
| 136 | Ga0157369_10026927 | 3300013105 | Bacteria | 6377 |
| 137 | Ga0157369_10066984 | 3300013105 | Bacteria | 3862 |
| 138 | Ga0157369_10118032 | 3300013105 | Bacteria | 2816 |
| 139 | Ga0157374_10006008 | 3300013296 | Bacteria | 10274 |
| 140 | Ga0157374_10049600 | 3300013296 | Bacteria | 3900 |
| 141 | Ga0163162_10070363 | 3300013306 | Bacteria | 3550 |
| 142 | Ga0157372_10032792 | 3300013307 | Bacteria | 5698 |
| 143 | Ga0157372_10047944 | 3300013307 | Bacteria | 4748 |
| 144 | Ga0157372_10203748 | 3300013307 | Bacteria | 2292 |
| 145 | Ga0157375_10153491 | 3300013308 | Bacteria | 2440 |
| 146 | Ga0157375_10247655 | 3300013308 | Bacteria | 1942 |
| 147 | Ga0163163_10117747 | 3300014325 | Bacteria | 2689 |
| 148 | Ga0157379_10091241 | 3300014968 | Bacteria | 2733 |
| 149 | Ga0157376_10039470 | 3300014969 | Bacteria | 3851 |
| 150 | Ga0206354_10587087 | 3300020081 | Bacteria | 2137 |
| 151 | Ga0206353_10676799 | 3300020082 | Bacteria | 1974 |
| 152 | Ga0207692_10027984 | 3300025898 | Bacteria | 2661 |
| 153 | Ga0207688_10015606 | 3300025901 | Unclassified | 4119 |
| 154 | Ga0207688_10090959 | 3300025901 | Bacteria | 1752 |
| 155 | Ga0207707_10027306 | 3300025912 | Bacteria | 4992 |
| 156 | Ga0207707_10152609 | 3300025912 | Bacteria | 2019 |
| 157 | Ga0207707_10217170 | 3300025912 | Bacteria | 1665 |
| 158 | Ga0207695_10036100 | 3300025913 | Bacteria | 5347 |
| 159 | Ga0207695_10074871 | 3300025913 | Bacteria | 3446 |
| 160 | Ga0207693_10002338 | 3300025915 | Bacteria | 16478 |
| 161 | Ga0207693_10003020 | 3300025915 | Bacteria | 14542 |
| 162 | Ga0207693_10005822 | 3300025915 | Bacteria | 10230 |
| 163 | Ga0207693_10008102 | 3300025915 | Bacteria | 8618 |
| 164 | Ga0207693_10033511 | 3300025915 | Bacteria | 4053 |
| 165 | Ga0207693_10036361 | 3300025915 | Bacteria | 3882 |
| 166 | Ga0207663_10001399 | 3300025916 | Bacteria | 11185 |
| 167 | Ga0207663_10011307 | 3300025916 | Bacteria | 4790 |
| 168 | Ga0207657_10002639 | 3300025919 | Bacteria | 19358 |
| 169 | Ga0207657_10006634 | 3300025919 | Bacteria | 11979 |
| 170 | Ga0207652_10079985 | 3300025921 | Bacteria | 2856 |
| 171 | Ga0207646_10084537 | 3300025922 | Bacteria | 2839 |
| 172 | Ga0207646_10099124 | 3300025922 | Bacteria | 2612 |
| 173 | Ga0207694_10092333 | 3300025924 | Bacteria | 2389 |
| 174 | Ga0207687_10003126 | 3300025927 | Bacteria | 11226 |
| 175 | Ga0207687_10013143 | 3300025927 | Bacteria | 5409 |
| 176 | Ga0207687_10043081 | 3300025927 | Bacteria | 3109 |
| 177 | Ga0207687_10114285 | 3300025927 | Unclassified | 2009 |
| 178 | Ga0207700_10101072 | 3300025928 | Bacteria | 2300 |
| 179 | Ga0207664_10015429 | 3300025929 | Bacteria | 5545 |
| 180 | Ga0207664_10017207 | 3300025929 | Bacteria | 5294 |
| 181 | Ga0207644_10124812 | 3300025931 | Bacteria | 1964 |
| 182 | Ga0207706_10108102 | 3300025933 | Bacteria | 2447 |
| 183 | Ga0207706_10197956 | 3300025933 | Bacteria | 1762 |
| 184 | Ga0207670_10149887 | 3300025936 | Bacteria | 1729 |
| 185 | Ga0207669_10060404 | 3300025937 | Bacteria | 2324 |
| 186 | Ga0207665_10004184 | 3300025939 | Bacteria | 9605 |
| 187 | Ga0207665_10015956 | 3300025939 | Bacteria | 4931 |
| 188 | Ga0207665_10030217 | 3300025939 | Bacteria | 3581 |
| 189 | Ga0207689_10046723 | 3300025942 | Bacteria | 3577 |
| 190 | Ga0207667_10031497 | 3300025949 | Bacteria | 5725 |
| 191 | Ga0207667_10114985 | 3300025949 | Unclassified | 2773 |
| 192 | Ga0207640_10062278 | 3300025981 | Bacteria | 2474 |
| 193 | Ga0207640_10119089 | 3300025981 | Bacteria | 1887 |
| 194 | Ga0207677_10039657 | 3300026023 | Bacteria | 3098 |
| 195 | Ga0207703_10031423 | 3300026035 | Bacteria | 4198 |
| 196 | Ga0207703_10146483 | 3300026035 | Bacteria | 2054 |
| 197 | Ga0207708_10001598 | 3300026075 | Bacteria | 16874 |
| 198 | Ga0207702_10003636 | 3300026078 | Bacteria | 13983 |
| 199 | Ga0207702_10035811 | 3300026078 | Bacteria | 4150 |
| 200 | Ga0207702_10099200 | 3300026078 | Bacteria | 2567 |
| 201 | Ga0207648_10030719 | 3300026089 | Bacteria | 4755 |
| 202 | Ga0207648_10129017 | 3300026089 | Bacteria | 2225 |
| 203 | Ga0207674_10054030 | 3300026116 | Bacteria | 4091 |
| 204 | Ga0207674_10070902 | 3300026116 | Bacteria | 3503 |
| 205 | Ga0207675_100042992 | 3300026118 | Bacteria | 4219 |
| 206 | Ga0207675_100084130 | 3300026118 | Bacteria | 2985 |
| 207 | Ga0207683_10001825 | 3300026121 | Bacteria | 18827 |
| 208 | Ga0207683_10049189 | 3300026121 | Bacteria | 3690 |
| 209 | Ga0207698_10041099 | 3300026142 | Bacteria | 3442 |
| 210 | Ga0207698_10057182 | 3300026142 | Bacteria | 3016 |
| 211 | Ga0207428_10007122 | 3300027907 | Bacteria | 10229 |
| 212 | Ga0268264_10108247 | 3300028381 | Bacteria | 2429 |
| 213 | Ga0265337_1009408 | 3300028556 | Bacteria | 3490 |
| 214 | Ga0265319_1002649 | 3300028563 | Bacteria | 9620 |
| 215 | Ga0265319_1006935 | 3300028563 | Bacteria | 5165 |
| 216 | Ga0265318_10000065 | 3300028577 | Bacteria | 102014 |
| 217 | Ga0265338_10008114 | 3300028800 | Bacteria | 12824 |
| 218 | Ga0265338_10010391 | 3300028800 | Bacteria | 10923 |
| 219 | Ga0265338_10015899 | 3300028800 | Bacteria | 8232 |
| 220 | Ga0265332_10006048 | 3300031238 | Bacteria | 5527 |
| 221 | Ga0265328_10006266 | 3300031239 | Bacteria | 5051 |
| 222 | Ga0265320_10024573 | 3300031240 | Bacteria | 3185 |
| 223 | Ga0265325_10001733 | 3300031241 | Bacteria | 15141 |
| 224 | Ga0265329_10007386 | 3300031242 | Bacteria | 4260 |
| 225 | Ga0265340_10003106 | 3300031247 | Bacteria | 9418 |
| 226 | Ga0265327_10001182 | 3300031251 | Bacteria | 35346 |
| 227 | Ga0265327_10036338 | 3300031251 | Bacteria | 2708 |
| 228 | Ga0265316_10007012 | 3300031344 | Bacteria | 10676 |
| 229 | Ga0265316_10013879 | 3300031344 | Bacteria | 7127 |
| 230 | Ga0265313_10005955 | 3300031595 | Bacteria | 8811 |
| 231 | Ga0265314_10012798 | 3300031711 | Bacteria | 6817 |
| 232 | Ga0265342_10005194 | 3300031712 | Bacteria | 10004 |
| 233 | Ga0307415_100059184 | 3300032126 | Bacteria | 2641 |
| 234 | Ga0373930_0003418 | 3300034816 | Bacteria | 2515 |
| 235 | Ga0373959_0003187 | 3300034820 | Bacteria | 2614 |
| 236 | Ga0373926_0026748 | 3300035083 | Bacteria | 2020 |
| 237 | Ga0373940_0000244 | 3300035088 | Bacteria | 7801 |
| 238 | Ga0373951_0002498 | 3300035091 | Bacteria | 4630 |
| 239 | Ga0373932_0001551 | 3300035112 | Bacteria | 6348 |
| 240 | Ga0373939_0005788 | 3300035114 | Bacteria | 2952 |
| 241 | Ga0373943_0022998 | 3300035170 | Bacteria | 2894 |
| 242 | Ga0373955_0033245 | 3300035172 | Bacteria | 2715 |
| 243 | Ga0373961_0002090 | 3300035241 | Bacteria | 5316 |
| 244 | Ga0373931_0000692 | 3300035691 | Bacteria | 13933 |
| 245 | Ga0373935_0071147 | 3300035692 | Bacteria | 2244 |
| 246 | Ga0373935_0098172 | 3300035692 | Bacteria | 1927 |
| 247 | Ga0373947_0094799 | 3300035725 | Bacteria | 1867 |
| 248 | Ga0373937_0064209 | 3300036401 | Bacteria | 3377 |
| 249 | Ga0373925_0004875 | 3300037068 | Bacteria | 10098 |
| 250 | Ga0395899_0039514 | 3300037312 | Bacteria | 3531 |
| 251 | Ga0395899_0049216 | 3300037312 | Bacteria | 3134 |
| 252 | Ga0395900_0004208 | 3300037418 | Bacteria | 15271 |
| 253 | Ga0395900_0069122 | 3300037418 | Bacteria | 3630 |
| 254 | Ga0395900_0078518 | 3300037418 | Bacteria | 3391 |
| 255 | Ga0395898_0010456 | 3300037466 | Bacteria | 9702 |
| 256 | Ga0395898_0015020 | 3300037466 | Bacteria | 7948 |
| 257 | Ga0395898_0038057 | 3300037466 | Bacteria | 4770 |
| 258 | Ga0395905_0004895 | 3300037471 | Bacteria | 13800 |
| 259 | Ga0395905_0010536 | 3300037471 | Bacteria | 8979 |
| 260 | Ga0395905_0194487 | 3300037471 | Bacteria | 1902 |
| 261 | Ga0395901_0000733 | 3300038443 | Bacteria | 37083 |
| 262 | Ga0395901_0040707 | 3300038443 | Bacteria | 4813 |
| 263 | Ga0395901_0300250 | 3300038443 | Bacteria | 1665 |
| 264 | Ga0242420_001728 | 3300038996 | Bacteria | 2988 |
| 265 | Ga0436360_0126379 | 3300039438 | Bacteria | 11685 |
| 266 | Ga0436360_0917953 | 3300039438 | Bacteria | 2482 |
| 267 | Ga0451839_0000609 | 3300041496 | Bacteria | 2632 |
| 268 | Ga0451851_1018579 | 3300041507 | Bacteria | 2259 |
| 269 | Ga0466963_0000874 | 3300044694 | Bacteria | 15271 |
| 270 | Ga0466963_0011789 | 3300044694 | Bacteria | 5331 |
| 271 | Ga0466964_0000245 | 3300044706 | Bacteria | 15666 |
| 272 | Ga0466968_0011112 | 3300044735 | Bacteria | 3505 |
| 273 | Ga0466957_0008193 | 3300044842 | Bacteria | 5934 |
| 274 | Ga0466957_0034093 | 3300044842 | Bacteria | 3054 |
| 275 | Ga0466960_0006573 | 3300044901 | Bacteria | 4670 |
| 276 | Ga0466958_0005213 | 3300045836 | Bacteria | 6963 |
| 277 | Ga0466958_0091580 | 3300045836 | Bacteria | 1882 |
| 278 | Ga0466967_0001083 | 3300045976 | Bacteria | 15065 |
| 279 | Ga0466967_0022458 | 3300045976 | Bacteria | 5149 |
| 280 | Ga0466967_0023670 | 3300045976 | Bacteria | 5037 |
| 281 | Ga0466967_0024573 | 3300045976 | Bacteria | 4956 |
| 282 | Ga0466967_0035056 | 3300045976 | Bacteria | 4267 |
| 283 | Ga0466967_0095268 | 3300045976 | Bacteria | 2712 |
| 284 | Ga0466967_0100070 | 3300045976 | Bacteria | 2648 |
| 285 | Ga0466967_0164974 | 3300045976 | Bacteria | 2081 |
| 286 | Ga0466967_0174735 | 3300045976 | Bacteria | 2023 |
| 287 | Ga0495603_0032575 | 3300046455 | Bacteria | 3136 |
| 288 | Ga0495651_0072763 | 3300046462 | Bacteria | 2610 |
| 289 | Ga0495653_0045262 | 3300046463 | Bacteria | 3412 |
| 290 | Ga0495582_0003879 | 3300046473 | Bacteria | 8419 |
| 291 | Ga0495639_0001038 | 3300046475 | Bacteria | 12525 |
| 292 | Ga0495662_0002913 | 3300046476 | Bacteria | 8645 |
| 293 | Ga0495664_0026252 | 3300046477 | Bacteria | 3393 |
| 294 | Ga0495584_0069132 | 3300046491 | Bacteria | 1774 |
| 295 | Ga0495608_0004234 | 3300046511 | Bacteria | 10284 |
| 296 | Ga0495665_0002442 | 3300046531 | Bacteria | 10035 |
| 297 | Ga0495640_0014783 | 3300046533 | Bacteria | 5895 |
| 298 | Ga0495667_0018535 | 3300046559 | Bacteria | 4702 |
| 299 | Ga0495656_0008540 | 3300046615 | Bacteria | 3659 |
| 300 | Ga0495634_0009793 | 3300046642 | Bacteria | 7053 |
| 301 | Ga0495635_0018127 | 3300046663 | Bacteria | 4915 |
| 302 | Ga0495588_0005968 | 3300046674 | Bacteria | 5461 |
| 303 | Ga0495657_0005435 | 3300046675 | Bacteria | 10088 |
| 304 | Ga0495657_0033048 | 3300046675 | Bacteria | 3606 |
| 305 | Ga0495647_0002246 | 3300046681 | Bacteria | 6056 |
| 306 | Ga0495658_0002914 | 3300046683 | Bacteria | 8588 |
| 307 | Ga0495613_0005198 | 3300046689 | Bacteria | 9772 |
| 308 | Ga0495624_0016169 | 3300046690 | Bacteria | 5025 |
| 309 | Ga0495600_0011687 | 3300046809 | Bacteria | 5476 |
| 310 | Ga0495604_0042811 | 3300047317 | Bacteria | 3547 |
| 311 | Ga0495674_0018169 | 3300047319 | Bacteria | 6546 |
| 312 | Ga0495674_0027619 | 3300047319 | Bacteria | 5184 |
| 313 | Ga0495676_0029108 | 3300047321 | Bacteria | 4705 |
| 314 | Ga0495676_0038917 | 3300047321 | Bacteria | 3945 |
| 315 | Ga0495680_0019548 | 3300047322 | Bacteria | 5715 |
| 316 | Ga0495680_0020200 | 3300047322 | Bacteria | 5610 |
| 317 | Ga0495680_0097278 | 3300047322 | Bacteria | 2197 |
| 318 | Ga0496100_0003357 | 3300048903 | Bacteria | 8336 |
| 319 | Ga0496100_0022607 | 3300048903 | Bacteria | 3806 |
| 320 | Ga0496100_0035130 | 3300048903 | Bacteria | 3151 |
| 321 | Ga0496100_0042249 | 3300048903 | Bacteria | 2911 |
| 322 | Ga0496100_0042643 | 3300048903 | Bacteria | 2899 |
| 323 | Ga0496101_0004355 | 3300048904 | Bacteria | 8889 |
| 324 | Ga0496101_0014782 | 3300048904 | Bacteria | 5251 |
| 325 | Ga0496101_0026413 | 3300048904 | Bacteria | 4037 |
| 326 | Ga0496101_0079805 | 3300048904 | Bacteria | 2416 |
| 327 | Ga0496102_0003224 | 3300048905 | Bacteria | 13844 |
| 328 | Ga0496102_0052623 | 3300048905 | Bacteria | 3710 |
| 329 | Ga0496102_0062219 | 3300048905 | Bacteria | 3418 |
| 330 | Ga0496102_0121230 | 3300048905 | Bacteria | 2442 |
| 331 | Ga0496102_0143496 | 3300048905 | Bacteria | 2240 |
| 332 | Ga0496103_0048938 | 3300048906 | Bacteria | 2613 |
| 333 | Ga0496103_0058647 | 3300048906 | Bacteria | 2391 |
| 334 | Ga0496104_0001632 | 3300048907 | Bacteria | 19365 |
| 335 | Ga0496104_0010570 | 3300048907 | Bacteria | 8243 |
| 336 | Ga0496104_0094431 | 3300048907 | Bacteria | 2861 |
| 337 | Ga0496105_0009655 | 3300048908 | Bacteria | 7554 |
| 338 | Ga0496105_0010350 | 3300048908 | Bacteria | 7333 |
| 339 | Ga0496105_0012182 | 3300048908 | Bacteria | 6807 |
| 340 | Ga0496105_0031394 | 3300048908 | Bacteria | 4355 |
| 341 | Ga0496105_0066400 | 3300048908 | Bacteria | 2978 |
| 342 | Ga0496106_0001671 | 3300048909 | Bacteria | 16633 |
| 343 | Ga0496106_0002385 | 3300048909 | Bacteria | 13997 |
| 344 | Ga0496106_0003960 | 3300048909 | Bacteria | 11066 |
| 345 | Ga0496106_0004686 | 3300048909 | Bacteria | 10133 |
| 346 | Ga0496106_0005194 | 3300048909 | Bacteria | 9641 |
| 347 | Ga0496106_0047503 | 3300048909 | Bacteria | 3230 |
| 348 | Ga0496106_0069156 | 3300048909 | Bacteria | 2694 |
| 349 | Ga0496107_0002346 | 3300048910 | Bacteria | 12226 |
| 350 | Ga0496107_0003972 | 3300048910 | Bacteria | 9954 |
| 351 | Ga0496107_0082710 | 3300048910 | Bacteria | 2341 |
| 352 | Ga0496108_0000880 | 3300048911 | Bacteria | 23404 |
| 353 | Ga0496108_0006656 | 3300048911 | Bacteria | 9358 |
| 354 | Ga0496108_0009135 | 3300048911 | Bacteria | 8023 |
| 355 | Ga0496108_0014119 | 3300048911 | Bacteria | 6515 |
| 356 | Ga0496108_0023780 | 3300048911 | Bacteria | 5042 |
| 357 | Ga0496108_0031828 | 3300048911 | Bacteria | 4379 |
| 358 | Ga0496108_0078603 | 3300048911 | Bacteria | 2792 |
| 359 | Ga0496108_0099466 | 3300048911 | Bacteria | 2479 |
| 360 | Ga0496108_0133450 | 3300048911 | Bacteria | 2134 |
| 361 | Ga0496109_0005462 | 3300048912 | Bacteria | 10630 |
| 362 | Ga0496109_0006589 | 3300048912 | Bacteria | 9777 |
| 363 | Ga0496109_0010607 | 3300048912 | Bacteria | 7880 |
| 364 | Ga0496109_0017018 | 3300048912 | Bacteria | 6362 |
| 365 | Ga0496109_0018491 | 3300048912 | Bacteria | 6122 |
| 366 | Ga0496109_0029595 | 3300048912 | Bacteria | 4906 |
| 367 | Ga0496109_0037510 | 3300048912 | Bacteria | 4378 |
| 368 | Ga0496109_0067085 | 3300048912 | Bacteria | 3286 |
| 369 | Ga0496109_0085755 | 3300048912 | Bacteria | 2907 |
| 370 | Ga0496109_0128998 | 3300048912 | Bacteria | 2359 |
| 371 | Ga0496110_0004524 | 3300048913 | Bacteria | 10788 |
| 372 | Ga0496110_0005152 | 3300048913 | Bacteria | 10215 |
| 373 | Ga0496110_0011083 | 3300048913 | Bacteria | 7363 |
| 374 | Ga0496110_0018203 | 3300048913 | Bacteria | 5887 |
| 375 | Ga0496110_0032555 | 3300048913 | Bacteria | 4503 |
| 376 | Ga0496110_0040528 | 3300048913 | Bacteria | 4058 |
| 377 | Ga0496110_0111477 | 3300048913 | Bacteria | 2459 |
| 378 | Ga0496111_0004148 | 3300048914 | Bacteria | 9109 |
| 379 | Ga0496111_0042181 | 3300048914 | Bacteria | 3275 |
| 380 | Ga0496111_0127427 | 3300048914 | Bacteria | 1882 |
| 381 | Ga0496111_0131031 | 3300048914 | Bacteria | 1855 |
| 382 | Ga0496112_0001131 | 3300048915 | Bacteria | 19837 |
| 383 | Ga0496112_0002527 | 3300048915 | Bacteria | 14773 |
| 384 | Ga0496112_0060795 | 3300048915 | Bacteria | 3723 |
| 385 | Ga0496112_0063065 | 3300048915 | Bacteria | 3656 |
| 386 | Ga0496112_0075679 | 3300048915 | Bacteria | 3329 |
| 387 | Ga0496112_0080680 | 3300048915 | Bacteria | 3217 |
| 388 | Ga0496112_0081909 | 3300048915 | Bacteria | 3192 |
| 389 | Ga0496112_0238122 | 3300048915 | Bacteria | 1773 |
| 390 | Ga0496113_0005163 | 3300048916 | Bacteria | 8121 |
| 391 | Ga0496113_0013448 | 3300048916 | Bacteria | 5547 |
| 392 | Ga0496113_0052273 | 3300048916 | Bacteria | 3051 |
| 393 | Ga0496113_0058857 | 3300048916 | Bacteria | 2893 |
| 394 | Ga0496113_0059076 | 3300048916 | Bacteria | 2888 |
| 395 | Ga0496113_0070893 | 3300048916 | Bacteria | 2650 |
| 396 | Ga0496114_0007338 | 3300048917 | Bacteria | 8704 |
| 397 | Ga0496114_0012361 | 3300048917 | Bacteria | 6831 |
| 398 | Ga0496114_0030233 | 3300048917 | Bacteria | 4456 |
| 399 | Ga0496114_0040009 | 3300048917 | Bacteria | 3880 |
| 400 | Ga0496114_0046753 | 3300048917 | Bacteria | 3597 |
| 401 | Ga0496114_0063062 | 3300048917 | Bacteria | 3103 |
| 402 | Ga0496114_0075301 | 3300048917 | Bacteria | 2843 |
| 403 | Ga0496115_0021452 | 3300048918 | Bacteria | 4991 |
| 404 | Ga0496115_0028997 | 3300048918 | Bacteria | 4343 |
| 405 | Ga0496115_0039862 | 3300048918 | Bacteria | 3732 |
| 406 | Ga0496115_0087079 | 3300048918 | Bacteria | 2549 |
| 407 | Ga0496115_0157612 | 3300048918 | Bacteria | 1875 |
| 408 | Ga0501034_0018101 | 3300049571 | Bacteria | 7230 |
| 409 | Ga0501067_0000728 | 3300049583 | Bacteria | 17710 |
| 410 | Ga0501067_0001714 | 3300049583 | Bacteria | 12070 |
| 411 | Ga0501067_0019946 | 3300049583 | Bacteria | 3709 |
| 412 | Ga0501067_0056053 | 3300049583 | Bacteria | 2184 |
| 413 | Ga0501068_0000257 | 3300049584 | Bacteria | 26197 |
| 414 | Ga0501069_0000272 | 3300049585 | Bacteria | 23453 |
| 415 | Ga0501069_0016122 | 3300049585 | Bacteria | 4008 |
| 416 | Ga0501070_0010919 | 3300049586 | Bacteria | 7672 |
| 417 | Ga0501070_0029240 | 3300049586 | Bacteria | 4622 |
| 418 | Ga0501073_0050892 | 3300049589 | Bacteria | 2902 |
| 419 | Ga0501074_0053588 | 3300049590 | Bacteria | 2909 |
| 420 | Ga0501074_0080473 | 3300049590 | Bacteria | 2337 |
| 421 | Ga0501080_0006255 | 3300049742 | Bacteria | 10685 |
| 422 | Ga0501080_0043232 | 3300049742 | Bacteria | 4195 |
| 423 | Ga0501083_0000383 | 3300049744 | Bacteria | 28055 |
| 424 | nmdc:mga05p37_129850_c1 | 3300050507 | Bacteria | 3092 |
| 425 | nmdc:mga05p37_22769_c1 | 3300050507 | Bacteria | 7599 |
| 426 | nmdc:mga06r32_22086_c1 | 3300050510 | Bacteria | 5879 |
| 427 | nmdc:mga08y16_28819_c1 | 3300050511 | Bacteria | 5852 |
| 428 | nmdc:mga0n895_11145_c1 | 3300050512 | Bacteria | 8001 |
| 429 | nmdc:mga0n895_11722_c1 | 3300050512 | Bacteria | 7836 |
| 430 | nmdc:mga0n895_117265_c1 | 3300050512 | Bacteria | 2682 |
| 431 | nmdc:mga0n895_132553_c1 | 3300050512 | Bacteria | 2518 |
| 432 | nmdc:mga0n895_26498_c1 | 3300050512 | Bacteria | 5492 |
| 433 | nmdc:mga0n895_39082_c1 | 3300050512 | Bacteria | 4601 |
| 434 | nmdc:mga0rr50_14005_c1 | 3300050513 | Bacteria | 5244 |
| 435 | nmdc:mga0rr50_5823_c1 | 3300050513 | Bacteria | 7406 |
| 436 | nmdc:mga08x19_16343_c1 | 3300050514 | Bacteria | 4525 |
| 437 | nmdc:mga08x19_19252_c1 | 3300050514 | Bacteria | 4187 |
| 438 | nmdc:mga08x19_21977_c1 | 3300050514 | Bacteria | 3946 |
| 439 | nmdc:mga0a205_13617_c1 | 3300050515 | Bacteria | 7578 |
| 440 | nmdc:mga0a205_19375_c1 | 3300050515 | Bacteria | 6413 |
| 441 | nmdc:mga0a205_45092_c1 | 3300050515 | Bacteria | 4252 |
| 442 | Ga0495601_0001410 | 3300053077 | Bacteria | 13234 |
| 443 | Ga0495619_0080048 | 3300053085 | Bacteria | 2198 |
| 444 | Ga0466962_0031915 | 3300061719 | Bacteria | 2522 |
| 445 | Ga0530510_0004791 | 3300061734 | Bacteria | 9369 |
| 446 | Ga0530510_0034431 | 3300061734 | Bacteria | 3649 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048903 | Ga0496100_0022607 | Ga0496100_0022607_14_1357 | 399 |
| 2 | 3300025933 | Ga0207706_10197956 | Ga0207706_101979561 | 453 |
| 3 | 3300020081 | Ga0206354_10587087 | Ga0206354_105870871 | 460 |
| 4 | 3300005937 | Ga0081455_10001455 | Ga0081455_1000145512 | 463 |
| 5 | 3300005338 | Ga0068868_100031902 | Ga0068868_1000319022 | 465 |
| 6 | 3300005339 | Ga0070660_100001589 | Ga0070660_1000015897 | 465 |
| 7 | 3300005458 | Ga0070681_10203610 | Ga0070681_102036101 | 465 |
| 8 | 3300005614 | Ga0068856_100014165 | Ga0068856_1000141655 | 465 |
| 9 | 3300005616 | Ga0068852_100088136 | Ga0068852_1000881362 | 465 |
| 10 | 3300005617 | Ga0068859_100024026 | Ga0068859_1000240264 | 465 |
| 11 | 3300006237 | Ga0097621_100039775 | Ga0097621_1000397751 | 465 |
| 12 | 3300006931 | Ga0097620_100024027 | Ga0097620_1000240274 | 465 |
| 13 | 3300009098 | Ga0105245_10060297 | Ga0105245_100602973 | 465 |
| 14 | 3300009101 | Ga0105247_10010281 | Ga0105247_100102816 | 465 |
| 15 | 3300009148 | Ga0105243_10098984 | Ga0105243_100989841 | 465 |
| 16 | 3300013307 | Ga0157372_10032792 | Ga0157372_100327926 | 465 |
| 17 | 3300013308 | Ga0157375_10247655 | Ga0157375_102476551 | 465 |
| 18 | 3300014325 | Ga0163163_10117747 | Ga0163163_101177472 | 465 |
| 19 | 3300025912 | Ga0207707_10217170 | Ga0207707_102171701 | 465 |
| 20 | 3300025919 | Ga0207657_10006634 | Ga0207657_1000663410 | 465 |
| 21 | 3300026023 | Ga0207677_10039657 | Ga0207677_100396571 | 465 |
| 22 | 3300026078 | Ga0207702_10003636 | Ga0207702_1000363613 | 465 |
| 23 | 3300026142 | Ga0207698_10057182 | Ga0207698_100571822 | 465 |
| 24 | 3300028381 | Ga0268264_10108247 | Ga0268264_101082472 | 465 |
| 25 | 3300048906 | Ga0496103_0058647 | Ga0496103_0058647_548_2152 | 465 |
| 26 | 3300048908 | Ga0496105_0012182 | Ga0496105_0012182_134_1738 | 465 |
| 27 | 3300048909 | Ga0496106_0003960 | Ga0496106_0003960_95_1699 | 465 |
| 28 | 3300048910 | Ga0496107_0003972 | Ga0496107_0003972_8198_9802 | 465 |
| 29 | 3300048911 | Ga0496108_0014119 | Ga0496108_0014119_135_1739 | 465 |
| 30 | 3300048912 | Ga0496109_0005462 | Ga0496109_0005462_5089_6693 | 465 |
| 31 | 3300048913 | Ga0496110_0005152 | Ga0496110_0005152_5232_6836 | 465 |
| 32 | 3300048914 | Ga0496111_0004148 | Ga0496111_0004148_4243_5847 | 465 |
| 33 | 3300048915 | Ga0496112_0001131 | Ga0496112_0001131_14653_16257 | 465 |
| 34 | 3300048916 | Ga0496113_0013448 | Ga0496113_0013448_2079_3683 | 465 |
| 35 | 3300048918 | Ga0496115_0157612 | Ga0496115_0157612_137_1741 | 465 |
| 36 | 3300025939 | Ga0207665_10030217 | Ga0207665_100302172 | 467 |
| 37 | 3300049583 | Ga0501067_0056053 | Ga0501067_0056053_157_1758 | 467 |
| 38 | 3300050512 | nmdc:mga0n895_11145_c1 | nmdc:mga0n895_11145_c1_59_1804 | 470 |
| 39 | 3300005329 | Ga0070683_100007102 | Ga0070683_1000071029 | 471 |
| 40 | 3300005458 | Ga0070681_10029974 | Ga0070681_100299745 | 471 |
| 41 | 3300025912 | Ga0207707_10027306 | Ga0207707_100273062 | 471 |
| 42 | 3300006871 | Ga0075434_100002405 | Ga0075434_10000240513 | 472 |
| 43 | 3300006914 | Ga0075436_100000676 | Ga0075436_10000067622 | 472 |
| 44 | 3300007076 | Ga0075435_100000660 | Ga0075435_10000066011 | 472 |
| 45 | 3300050512 | nmdc:mga0n895_26498_c1 | nmdc:mga0n895_26498_c1_175_1782 | 472 |
| 46 | 3300050513 | nmdc:mga0rr50_5823_c1 | nmdc:mga0rr50_5823_c1_5504_7111 | 472 |
| 47 | 3300050514 | nmdc:mga08x19_21977_c1 | nmdc:mga08x19_21977_c1_173_1780 | 472 |
| 48 | 3300009098 | Ga0105245_10060297 | Ga0105245_100602972 | 473 |
| 49 | 3300005337 | Ga0070682_100107158 | Ga0070682_1001071582 | 474 |
| 50 | 3300005535 | Ga0070684_100042525 | Ga0070684_1000425252 | 474 |
| 51 | 3300005843 | Ga0068860_100273221 | Ga0068860_1002732211 | 474 |
| 52 | 3300045976 | Ga0466967_0035056 | Ga0466967_0035056_647_2242 | 474 |
| 53 | 3300048903 | Ga0496100_0003357 | Ga0496100_0003357_5829_7430 | 474 |
| 54 | 3300048904 | Ga0496101_0004355 | Ga0496101_0004355_1237_2838 | 474 |
| 55 | 3300048905 | Ga0496102_0003224 | Ga0496102_0003224_7824_9425 | 474 |
| 56 | 3300048906 | Ga0496103_0048938 | Ga0496103_0048938_646_2247 | 474 |
| 57 | 3300048909 | Ga0496106_0004686 | Ga0496106_0004686_2699_4300 | 474 |
| 58 | 3300048910 | Ga0496107_0002346 | Ga0496107_0002346_5835_7436 | 474 |
| 59 | 3300048911 | Ga0496108_0031828 | Ga0496108_0031828_1168_2769 | 474 |
| 60 | 3300048912 | Ga0496109_0067085 | Ga0496109_0067085_1249_2850 | 474 |
| 61 | 3300048917 | Ga0496114_0012361 | Ga0496114_0012361_788_2389 | 474 |
| 62 | 3300005459 | Ga0068867_100036543 | Ga0068867_1000365432 | 475 |
| 63 | 3300006852 | Ga0075433_10085179 | Ga0075433_100851792 | 475 |
| 64 | 3300006871 | Ga0075434_100001151 | Ga0075434_10000115112 | 475 |
| 65 | 3300025937 | Ga0207669_10060404 | Ga0207669_100604041 | 475 |
| 66 | 3300025942 | Ga0207689_10046723 | Ga0207689_100467232 | 475 |
| 67 | 3300026089 | Ga0207648_10030719 | Ga0207648_100307193 | 475 |
| 68 | 3300046491 | Ga0495584_0069132 | Ga0495584_0069132_80_1648 | 476 |
| 69 | 3300048909 | Ga0496106_0069156 | Ga0496106_0069156_96_1709 | 476 |
| 70 | 3300009098 | Ga0105245_10168134 | Ga0105245_101681342 | 477 |
| 71 | 3300045976 | Ga0466967_0022458 | Ga0466967_0022458_3119_4720 | 477 |
| 72 | 3300005329 | Ga0070683_100080643 | Ga0070683_1000806432 | 478 |
| 73 | 3300005468 | Ga0070707_100208361 | Ga0070707_1002083611 | 478 |
| 74 | 3300005530 | Ga0070679_100056818 | Ga0070679_1000568182 | 478 |
| 75 | 3300005563 | Ga0068855_100009022 | Ga0068855_1000090225 | 478 |
| 76 | 3300005578 | Ga0068854_100024931 | Ga0068854_1000249311 | 478 |
| 77 | 3300005983 | Ga0081540_1000314 | Ga0081540_100031448 | 478 |
| 78 | 3300009093 | Ga0105240_10012061 | Ga0105240_1001206110 | 478 |
| 79 | 3300009176 | Ga0105242_10054335 | Ga0105242_100543352 | 478 |
| 80 | 3300025981 | Ga0207640_10119089 | Ga0207640_101190891 | 478 |
| 81 | 3300026078 | Ga0207702_10099200 | Ga0207702_100992002 | 478 |
| 82 | 3300028800 | Ga0265338_10015899 | Ga0265338_100158996 | 478 |
| 83 | 3300044694 | Ga0466963_0000874 | Ga0466963_0000874_156_1763 | 478 |
| 84 | 3300044842 | Ga0466957_0034093 | Ga0466957_0034093_1060_2667 | 478 |
| 85 | 3300045836 | Ga0466958_0005213 | Ga0466958_0005213_5242_6849 | 478 |
| 86 | 3300045976 | Ga0466967_0023670 | Ga0466967_0023670_3214_4821 | 478 |
| 87 | 3300048905 | Ga0496102_0121230 | Ga0496102_0121230_787_2406 | 478 |
| 88 | 3300048907 | Ga0496104_0094431 | Ga0496104_0094431_218_1837 | 478 |
| 89 | 3300048908 | Ga0496105_0066400 | Ga0496105_0066400_1259_2872 | 478 |
| 90 | 3300048911 | Ga0496108_0000880 | Ga0496108_0000880_12210_13829 | 478 |
| 91 | 3300048912 | Ga0496109_0010607 | Ga0496109_0010607_1850_3469 | 478 |
| 92 | 3300048913 | Ga0496110_0004524 | Ga0496110_0004524_218_1837 | 478 |
| 93 | 3300048914 | Ga0496111_0127427 | Ga0496111_0127427_31_1650 | 478 |
| 94 | 3300048916 | Ga0496113_0005163 | Ga0496113_0005163_6358_7977 | 478 |
| 95 | 3300048917 | Ga0496114_0046753 | Ga0496114_0046753_1709_3301 | 478 |
| 96 | 3300005535 | Ga0070684_100028512 | Ga0070684_1000285123 | 479 |
| 97 | 3300006028 | Ga0070717_10011836 | Ga0070717_100118362 | 479 |
| 98 | 3300009551 | Ga0105238_10016714 | Ga0105238_100167142 | 479 |
| 99 | 3300013105 | Ga0157369_10021993 | Ga0157369_100219936 | 479 |
| 100 | 3300025929 | Ga0207664_10015429 | Ga0207664_100154292 | 479 |
| 101 | 3300044706 | Ga0466964_0000245 | Ga0466964_0000245_1918_3597 | 479 |
| 102 | 3300044735 | Ga0466968_0011112 | Ga0466968_0011112_1903_3456 | 479 |
| 103 | 3300045976 | Ga0466967_0001083 | Ga0466967_0001083_1505_3184 | 479 |
| 104 | 3300005435 | Ga0070714_100043938 | Ga0070714_1000439382 | 480 |
| 105 | 3300025931 | Ga0207644_10124812 | Ga0207644_101248122 | 480 |
| 106 | 3300032126 | Ga0307415_100059184 | Ga0307415_1000591841 | 480 |
| 107 | 3300046455 | Ga0495603_0032575 | Ga0495603_0032575_658_2301 | 480 |
| 108 | 3300048911 | Ga0496108_0099466 | Ga0496108_0099466_824_2464 | 480 |
| 109 | 3300048913 | Ga0496110_0032555 | Ga0496110_0032555_1982_3622 | 480 |
| 110 | 3300048917 | Ga0496114_0075301 | Ga0496114_0075301_343_2019 | 480 |
| 111 | 3300048918 | Ga0496115_0087079 | Ga0496115_0087079_918_2531 | 480 |
| 112 | 3300005985 | Ga0081539_10014597 | Ga0081539_100145972 | 481 |
| 113 | 3300025915 | Ga0207693_10036361 | Ga0207693_100363612 | 481 |
| 114 | 3300005547 | Ga0070693_100021099 | Ga0070693_1000210992 | 482 |
| 115 | 3300045836 | Ga0466958_0091580 | Ga0466958_0091580_99_1706 | 483 |
| 116 | 3300048903 | Ga0496100_0035130 | Ga0496100_0035130_693_2294 | 483 |
| 117 | 3300048904 | Ga0496101_0079805 | Ga0496101_0079805_238_1839 | 483 |
| 118 | 3300048905 | Ga0496102_0143496 | Ga0496102_0143496_528_2129 | 483 |
| 119 | 3300048911 | Ga0496108_0023780 | Ga0496108_0023780_234_1835 | 483 |
| 120 | 3300048912 | Ga0496109_0128998 | Ga0496109_0128998_112_1713 | 483 |
| 121 | 3300048913 | Ga0496110_0111477 | Ga0496110_0111477_238_1839 | 483 |
| 122 | 3300025924 | Ga0207694_10092333 | Ga0207694_100923332 | 484 |
| 123 | 3300048911 | Ga0496108_0006656 | Ga0496108_0006656_3480_4991 | 484 |
| 124 | 3300005471 | Ga0070698_100060616 | Ga0070698_1000606162 | 487 |
| 125 | 3300038996 | Ga0242420_001728 | Ga0242420_001728_1150_2757 | 487 |
| 126 | 3300005434 | Ga0070709_10038585 | Ga0070709_100385851 | 491 |
| 127 | 3300044694 | Ga0466963_0000874 | Ga0466963_0000874_1860_3461 | 491 |
| 128 | 3300045836 | Ga0466958_0005213 | Ga0466958_0005213_3544_5145 | 491 |
| 129 | 3300045976 | Ga0466967_0023670 | Ga0466967_0023670_1516_3117 | 491 |
| 130 | 3300045976 | Ga0466967_0024573 | Ga0466967_0024573_1217_2818 | 491 |
| 131 | 3300047319 | Ga0495674_0018169 | Ga0495674_0018169_331_1932 | 491 |
| 132 | 3300049583 | Ga0501067_0019946 | Ga0501067_0019946_1663_3180 | 491 |
| 133 | 3300061719 | Ga0466962_0031915 | Ga0466962_0031915_89_1690 | 491 |
| 134 | 3300005434 | Ga0070709_10034633 | Ga0070709_100346333 | 492 |
| 135 | 3300013307 | Ga0157372_10203748 | Ga0157372_102037481 | 492 |
| 136 | 3300025939 | Ga0207665_10004184 | Ga0207665_100041847 | 492 |
| 137 | 3300044694 | Ga0466963_0011789 | Ga0466963_0011789_1772_3322 | 492 |
| 138 | 3300041496 | Ga0451839_0000609 | Ga0451839_0000609_659_2338 | 493 |
| 139 | 3300048904 | Ga0496101_0014782 | Ga0496101_0014782_1175_2782 | 493 |
| 140 | 3300048905 | Ga0496102_0052623 | Ga0496102_0052623_1548_3155 | 493 |
| 141 | 3300048909 | Ga0496106_0002385 | Ga0496106_0002385_9865_11472 | 493 |
| 142 | 3300048910 | Ga0496107_0082710 | Ga0496107_0082710_680_2287 | 493 |
| 143 | 3300048918 | Ga0496115_0039862 | Ga0496115_0039862_1856_3463 | 493 |
| 144 | 3300005337 | Ga0070682_100044022 | Ga0070682_1000440222 | 495 |
| 145 | 3300005338 | Ga0068868_100127106 | Ga0068868_1001271062 | 495 |
| 146 | 3300005366 | Ga0070659_100011416 | Ga0070659_1000114168 | 495 |
| 147 | 3300005436 | Ga0070713_100051010 | Ga0070713_1000510102 | 495 |
| 148 | 3300005439 | Ga0070711_100066445 | Ga0070711_1000664451 | 495 |
| 149 | 3300005441 | Ga0070700_100003216 | Ga0070700_1000032165 | 495 |
| 150 | 3300005445 | Ga0070708_100104955 | Ga0070708_1001049552 | 495 |
| 151 | 3300005530 | Ga0070679_100027957 | Ga0070679_1000279572 | 495 |
| 152 | 3300005539 | Ga0068853_100020279 | Ga0068853_1000202793 | 495 |
| 153 | 3300005544 | Ga0070686_100034604 | Ga0070686_1000346043 | 495 |
| 154 | 3300005549 | Ga0070704_100048546 | Ga0070704_1000485462 | 495 |
| 155 | 3300005577 | Ga0068857_100007342 | Ga0068857_10000734210 | 495 |
| 156 | 3300005578 | Ga0068854_100071643 | Ga0068854_1000716432 | 495 |
| 157 | 3300005617 | Ga0068859_100038228 | Ga0068859_1000382283 | 495 |
| 158 | 3300005718 | Ga0068866_10009069 | Ga0068866_100090692 | 495 |
| 159 | 3300005834 | Ga0068851_10034344 | Ga0068851_100343442 | 495 |
| 160 | 3300005985 | Ga0081539_10025465 | Ga0081539_100254652 | 495 |
| 161 | 3300006028 | Ga0070717_10136649 | Ga0070717_101366492 | 495 |
| 162 | 3300006178 | Ga0075367_10052443 | Ga0075367_100524433 | 495 |
| 163 | 3300006358 | Ga0068871_100087849 | Ga0068871_1000878492 | 495 |
| 164 | 3300006852 | Ga0075433_10024198 | Ga0075433_100241982 | 495 |
| 165 | 3300006871 | Ga0075434_100004005 | Ga0075434_10000400510 | 495 |
| 166 | 3300006881 | Ga0068865_100074585 | Ga0068865_1000745852 | 495 |
| 167 | 3300006914 | Ga0075436_100007629 | Ga0075436_1000076297 | 495 |
| 168 | 3300006931 | Ga0097620_100038228 | Ga0097620_1000382283 | 495 |
| 169 | 3300009098 | Ga0105245_10042050 | Ga0105245_100420503 | 495 |
| 170 | 3300009147 | Ga0114129_10007775 | Ga0114129_1000777512 | 495 |
| 171 | 3300009147 | Ga0114129_10153550 | Ga0114129_101535502 | 495 |
| 172 | 3300009148 | Ga0105243_10006016 | Ga0105243_1000601611 | 495 |
| 173 | 3300009174 | Ga0105241_10027922 | Ga0105241_100279224 | 495 |
| 174 | 3300013105 | Ga0157369_10118032 | Ga0157369_101180322 | 495 |
| 175 | 3300013306 | Ga0163162_10070363 | Ga0163162_100703632 | 495 |
| 176 | 3300013307 | Ga0157372_10047944 | Ga0157372_100479444 | 495 |
| 177 | 3300013308 | Ga0157375_10153491 | Ga0157375_101534912 | 495 |
| 178 | 3300025927 | Ga0207687_10043081 | Ga0207687_100430812 | 495 |
| 179 | 3300025936 | Ga0207670_10149887 | Ga0207670_101498871 | 495 |
| 180 | 3300026035 | Ga0207703_10146483 | Ga0207703_101464832 | 495 |
| 181 | 3300026075 | Ga0207708_10001598 | Ga0207708_100015984 | 495 |
| 182 | 3300026089 | Ga0207648_10129017 | Ga0207648_101290171 | 495 |
| 183 | 3300026116 | Ga0207674_10054030 | Ga0207674_100540303 | 495 |
| 184 | 3300026142 | Ga0207698_10041099 | Ga0207698_100410992 | 495 |
| 185 | 3300037312 | Ga0395899_0049216 | Ga0395899_0049216_423_1991 | 495 |
| 186 | 3300037418 | Ga0395900_0004208 | Ga0395900_0004208_8960_10528 | 495 |
| 187 | 3300037418 | Ga0395900_0078518 | Ga0395900_0078518_1245_2813 | 495 |
| 188 | 3300037466 | Ga0395898_0015020 | Ga0395898_0015020_1163_2731 | 495 |
| 189 | 3300037466 | Ga0395898_0038057 | Ga0395898_0038057_456_2024 | 495 |
| 190 | 3300037471 | Ga0395905_0004895 | Ga0395905_0004895_2735_4303 | 495 |
| 191 | 3300037471 | Ga0395905_0010536 | Ga0395905_0010536_6638_8206 | 495 |
| 192 | 3300038443 | Ga0395901_0000733 | Ga0395901_0000733_19350_20918 | 495 |
| 193 | 3300038443 | Ga0395901_0300250 | Ga0395901_0300250_75_1643 | 495 |
| 194 | 3300048903 | Ga0496100_0042249 | Ga0496100_0042249_19_1611 | 495 |
| 195 | 3300048912 | Ga0496109_0029595 | Ga0496109_0029595_927_2519 | 495 |
| 196 | 3300048916 | Ga0496113_0052273 | Ga0496113_0052273_286_1878 | 495 |
| 197 | 3300048916 | Ga0496113_0059076 | Ga0496113_0059076_130_1722 | 495 |
| 198 | 3300049583 | Ga0501067_0000728 | Ga0501067_0000728_12332_13924 | 495 |
| 199 | 3300049584 | Ga0501068_0000257 | Ga0501068_0000257_18227_19819 | 495 |
| 200 | 3300049585 | Ga0501069_0000272 | Ga0501069_0000272_3982_5574 | 495 |
| 201 | 3300050507 | nmdc:mga05p37_129850_c1 | nmdc:mga05p37_129850_c1_522_2090 | 495 |
| 202 | 3300050507 | nmdc:mga05p37_22769_c1 | nmdc:mga05p37_22769_c1_2927_4555 | 495 |
| 203 | 3300050512 | nmdc:mga0n895_117265_c1 | nmdc:mga0n895_117265_c1_579_2207 | 495 |
| 204 | 3300050512 | nmdc:mga0n895_39082_c1 | nmdc:mga0n895_39082_c1_966_2558 | 495 |
| 205 | 3300050513 | nmdc:mga0rr50_14005_c1 | nmdc:mga0rr50_14005_c1_3035_4663 | 495 |
| 206 | 3300050515 | nmdc:mga0a205_45092_c1 | nmdc:mga0a205_45092_c1_579_2207 | 495 |
| 207 | 3300061734 | Ga0530510_0004791 | Ga0530510_0004791_1549_3141 | 495 |
| 208 | 3300048908 | Ga0496105_0010350 | Ga0496105_0010350_705_2252 | 496 |
| 209 | 3300048912 | Ga0496109_0006589 | Ga0496109_0006589_4822_6369 | 496 |
| 210 | 3300048913 | Ga0496110_0018203 | Ga0496110_0018203_1800_3347 | 496 |
| 211 | 3300048916 | Ga0496113_0070893 | Ga0496113_0070893_277_1824 | 496 |
| 212 | 3300048917 | Ga0496114_0030233 | Ga0496114_0030233_2858_4405 | 496 |
| 213 | 3300005435 | Ga0070714_100068718 | Ga0070714_1000687182 | 497 |
| 214 | 3300005437 | Ga0070710_10014613 | Ga0070710_100146132 | 497 |
| 215 | 3300005439 | Ga0070711_100002446 | Ga0070711_1000024466 | 497 |
| 216 | 3300006028 | Ga0070717_10078487 | Ga0070717_100784872 | 497 |
| 217 | 3300006175 | Ga0070712_100022220 | Ga0070712_1000222202 | 497 |
| 218 | 3300025915 | Ga0207693_10008102 | Ga0207693_100081023 | 497 |
| 219 | 3300025916 | Ga0207663_10001399 | Ga0207663_1000139910 | 497 |
| 220 | 3300025929 | Ga0207664_10017207 | Ga0207664_100172074 | 497 |
| 221 | 3300046463 | Ga0495653_0045262 | Ga0495653_0045262_798_2390 | 497 |
| 222 | 3300048917 | Ga0496114_0040009 | Ga0496114_0040009_1764_3356 | 497 |
| 223 | 3300048918 | Ga0496115_0028997 | Ga0496115_0028997_554_2146 | 497 |
| 224 | 3300005434 | Ga0070709_10044191 | Ga0070709_100441912 | 498 |
| 225 | 3300005436 | Ga0070713_100044227 | Ga0070713_1000442273 | 498 |
| 226 | 3300005437 | Ga0070710_10014613 | Ga0070710_100146133 | 498 |
| 227 | 3300005439 | Ga0070711_100002446 | Ga0070711_1000024467 | 498 |
| 228 | 3300005471 | Ga0070698_100114668 | Ga0070698_1001146682 | 498 |
| 229 | 3300025898 | Ga0207692_10027984 | Ga0207692_100279842 | 498 |
| 230 | 3300025912 | Ga0207707_10152609 | Ga0207707_101526092 | 498 |
| 231 | 3300025915 | Ga0207693_10008102 | Ga0207693_100081024 | 498 |
| 232 | 3300025916 | Ga0207663_10001399 | Ga0207663_100013999 | 498 |
| 233 | 3300025928 | Ga0207700_10101072 | Ga0207700_101010722 | 498 |
| 234 | 3300025929 | Ga0207664_10017207 | Ga0207664_100172075 | 498 |
| 235 | 3300025933 | Ga0207706_10108102 | Ga0207706_101081022 | 498 |
| 236 | 3300028800 | Ga0265338_10008114 | Ga0265338_100081148 | 498 |
| 237 | 3300031251 | Ga0265327_10001182 | Ga0265327_100011829 | 498 |
| 238 | 3300039438 | Ga0436360_0126379 | Ga0436360_0126379_5174_6763 | 498 |
| 239 | 3300039438 | Ga0436360_0917953 | Ga0436360_0917953_754_2355 | 498 |
| 240 | 3300045976 | Ga0466967_0095268 | Ga0466967_0095268_188_1753 | 498 |
| 241 | 3300045976 | Ga0466967_0100070 | Ga0466967_0100070_873_2390 | 498 |
| 242 | 3300045976 | Ga0466967_0164974 | Ga0466967_0164974_31_1587 | 498 |
| 243 | 3300048917 | Ga0496114_0040009 | Ga0496114_0040009_36_1640 | 498 |
| 244 | 3300048918 | Ga0496115_0028997 | Ga0496115_0028997_2270_3874 | 498 |
| 245 | 3300005435 | Ga0070714_100129681 | Ga0070714_1001296811 | 499 |
| 246 | 3300005468 | Ga0070707_100102063 | Ga0070707_1001020632 | 499 |
| 247 | 3300005545 | Ga0070695_100066441 | Ga0070695_1000664412 | 499 |
| 248 | 3300005546 | Ga0070696_100087139 | Ga0070696_1000871392 | 499 |
| 249 | 3300005563 | Ga0068855_100195116 | Ga0068855_1001951161 | 499 |
| 250 | 3300005985 | Ga0081539_10003435 | Ga0081539_1000343521 | 499 |
| 251 | 3300013296 | Ga0157374_10006008 | Ga0157374_1000600810 | 499 |
| 252 | 3300025901 | Ga0207688_10015606 | Ga0207688_100156063 | 499 |
| 253 | 3300025915 | Ga0207693_10002338 | Ga0207693_1000233812 | 499 |
| 254 | 3300025922 | Ga0207646_10099124 | Ga0207646_100991241 | 499 |
| 255 | 3300025927 | Ga0207687_10114285 | Ga0207687_101142851 | 499 |
| 256 | 3300025949 | Ga0207667_10114985 | Ga0207667_101149851 | 499 |
| 257 | 3300026118 | Ga0207675_100084130 | Ga0207675_1000841302 | 499 |
| 258 | 3300028800 | Ga0265338_10010391 | Ga0265338_100103916 | 499 |
| 259 | 3300048909 | Ga0496106_0005194 | Ga0496106_0005194_1868_3433 | 499 |
| 260 | 3300048915 | Ga0496112_0002527 | Ga0496112_0002527_5248_6831 | 499 |
| 261 | 3300048915 | Ga0496112_0081909 | Ga0496112_0081909_1436_3010 | 499 |
| 262 | 3300005327 | Ga0070658_10038592 | Ga0070658_100385923 | 500 |
| 263 | 3300005328 | Ga0070676_10039911 | Ga0070676_100399112 | 500 |
| 264 | 3300005329 | Ga0070683_100064325 | Ga0070683_1000643252 | 500 |
| 265 | 3300005334 | Ga0068869_100007121 | Ga0068869_1000071219 | 500 |
| 266 | 3300005336 | Ga0070680_100108955 | Ga0070680_1001089552 | 500 |
| 267 | 3300005339 | Ga0070660_100001589 | Ga0070660_1000015898 | 500 |
| 268 | 3300005354 | Ga0070675_100043848 | Ga0070675_1000438484 | 500 |
| 269 | 3300005355 | Ga0070671_100111513 | Ga0070671_1001115132 | 500 |
| 270 | 3300005435 | Ga0070714_100111454 | Ga0070714_1001114542 | 500 |
| 271 | 3300005437 | Ga0070710_10033160 | Ga0070710_100331602 | 500 |
| 272 | 3300005439 | Ga0070711_100011945 | Ga0070711_1000119452 | 500 |
| 273 | 3300005439 | Ga0070711_100028307 | Ga0070711_1000283072 | 500 |
| 274 | 3300005444 | Ga0070694_100015984 | Ga0070694_1000159844 | 500 |
| 275 | 3300005458 | Ga0070681_10026888 | Ga0070681_100268882 | 500 |
| 276 | 3300005458 | Ga0070681_10114825 | Ga0070681_101148252 | 500 |
| 277 | 3300005458 | Ga0070681_10134911 | Ga0070681_101349111 | 500 |
| 278 | 3300005468 | Ga0070707_100128928 | Ga0070707_1001289281 | 500 |
| 279 | 3300005468 | Ga0070707_100156970 | Ga0070707_1001569702 | 500 |
| 280 | 3300005471 | Ga0070698_100207369 | Ga0070698_1002073691 | 500 |
| 281 | 3300005518 | Ga0070699_100037830 | Ga0070699_1000378302 | 500 |
| 282 | 3300005518 | Ga0070699_100056571 | Ga0070699_1000565713 | 500 |
| 283 | 3300005535 | Ga0070684_100013631 | Ga0070684_1000136312 | 500 |
| 284 | 3300005535 | Ga0070684_100103893 | Ga0070684_1001038932 | 500 |
| 285 | 3300005536 | Ga0070697_100055667 | Ga0070697_1000556672 | 500 |
| 286 | 3300005549 | Ga0070704_100007955 | Ga0070704_1000079551 | 500 |
| 287 | 3300005563 | Ga0068855_100009022 | Ga0068855_1000090224 | 500 |
| 288 | 3300005563 | Ga0068855_100075743 | Ga0068855_1000757435 | 500 |
| 289 | 3300005577 | Ga0068857_100084183 | Ga0068857_1000841832 | 500 |
| 290 | 3300005578 | Ga0068854_100024931 | Ga0068854_1000249312 | 500 |
| 291 | 3300005614 | Ga0068856_100014165 | Ga0068856_1000141656 | 500 |
| 292 | 3300005614 | Ga0068856_100153974 | Ga0068856_1001539742 | 500 |
| 293 | 3300005615 | Ga0070702_100035775 | Ga0070702_1000357752 | 500 |
| 294 | 3300005617 | Ga0068859_100024026 | Ga0068859_1000240263 | 500 |
| 295 | 3300005719 | Ga0068861_100042803 | Ga0068861_1000428032 | 500 |
| 296 | 3300005842 | Ga0068858_100055003 | Ga0068858_1000550033 | 500 |
| 297 | 3300006028 | Ga0070717_10014587 | Ga0070717_100145878 | 500 |
| 298 | 3300006175 | Ga0070712_100001811 | Ga0070712_1000018117 | 500 |
| 299 | 3300006237 | Ga0097621_100039775 | Ga0097621_1000397752 | 500 |
| 300 | 3300006358 | Ga0068871_100049539 | Ga0068871_1000495392 | 500 |
| 301 | 3300006871 | Ga0075434_100001151 | Ga0075434_10000115111 | 500 |
| 302 | 3300006871 | Ga0075434_100002405 | Ga0075434_10000240512 | 500 |
| 303 | 3300006871 | Ga0075434_100033254 | Ga0075434_1000332542 | 500 |
| 304 | 3300006914 | Ga0075436_100000676 | Ga0075436_10000067621 | 500 |
| 305 | 3300006914 | Ga0075436_100005473 | Ga0075436_1000054738 | 500 |
| 306 | 3300006931 | Ga0097620_100024027 | Ga0097620_1000240273 | 500 |
| 307 | 3300007076 | Ga0075435_100000660 | Ga0075435_10000066012 | 500 |
| 308 | 3300007076 | Ga0075435_100027352 | Ga0075435_1000273524 | 500 |
| 309 | 3300009093 | Ga0105240_10012061 | Ga0105240_100120619 | 500 |
| 310 | 3300009098 | Ga0105245_10059049 | Ga0105245_100590492 | 500 |
| 311 | 3300009101 | Ga0105247_10010281 | Ga0105247_100102815 | 500 |
| 312 | 3300009147 | Ga0114129_10035346 | Ga0114129_100353463 | 500 |
| 313 | 3300009551 | Ga0105238_10019112 | Ga0105238_100191122 | 500 |
| 314 | 3300009553 | Ga0105249_10053486 | Ga0105249_100534863 | 500 |
| 315 | 3300013105 | Ga0157369_10021993 | Ga0157369_100219935 | 500 |
| 316 | 3300013105 | Ga0157369_10026927 | Ga0157369_100269277 | 500 |
| 317 | 3300013105 | Ga0157369_10066984 | Ga0157369_100669842 | 500 |
| 318 | 3300013296 | Ga0157374_10049600 | Ga0157374_100496003 | 500 |
| 319 | 3300014968 | Ga0157379_10091241 | Ga0157379_100912412 | 500 |
| 320 | 3300014969 | Ga0157376_10039470 | Ga0157376_100394704 | 500 |
| 321 | 3300020082 | Ga0206353_10676799 | Ga0206353_106767991 | 500 |
| 322 | 3300025901 | Ga0207688_10090959 | Ga0207688_100909592 | 500 |
| 323 | 3300025913 | Ga0207695_10036100 | Ga0207695_100361002 | 500 |
| 324 | 3300025913 | Ga0207695_10074871 | Ga0207695_100748712 | 500 |
| 325 | 3300025915 | Ga0207693_10005822 | Ga0207693_100058229 | 500 |
| 326 | 3300025915 | Ga0207693_10033511 | Ga0207693_100335111 | 500 |
| 327 | 3300025916 | Ga0207663_10011307 | Ga0207663_100113072 | 500 |
| 328 | 3300025919 | Ga0207657_10002639 | Ga0207657_100026393 | 500 |
| 329 | 3300025919 | Ga0207657_10006634 | Ga0207657_1000663411 | 500 |
| 330 | 3300025922 | Ga0207646_10084537 | Ga0207646_100845371 | 500 |
| 331 | 3300025927 | Ga0207687_10003126 | Ga0207687_100031262 | 500 |
| 332 | 3300025927 | Ga0207687_10013143 | Ga0207687_100131432 | 500 |
| 333 | 3300025939 | Ga0207665_10015956 | Ga0207665_100159563 | 500 |
| 334 | 3300025949 | Ga0207667_10031497 | Ga0207667_100314976 | 500 |
| 335 | 3300025981 | Ga0207640_10062278 | Ga0207640_100622782 | 500 |
| 336 | 3300026035 | Ga0207703_10031423 | Ga0207703_100314235 | 500 |
| 337 | 3300026078 | Ga0207702_10003636 | Ga0207702_1000363612 | 500 |
| 338 | 3300026078 | Ga0207702_10035811 | Ga0207702_100358112 | 500 |
| 339 | 3300026116 | Ga0207674_10070902 | Ga0207674_100709023 | 500 |
| 340 | 3300026118 | Ga0207675_100042992 | Ga0207675_1000429922 | 500 |
| 341 | 3300026121 | Ga0207683_10001825 | Ga0207683_100018258 | 500 |
| 342 | 3300026121 | Ga0207683_10049189 | Ga0207683_100491892 | 500 |
| 343 | 3300028556 | Ga0265337_1009408 | Ga0265337_10094082 | 500 |
| 344 | 3300028563 | Ga0265319_1002649 | Ga0265319_10026494 | 500 |
| 345 | 3300028563 | Ga0265319_1006935 | Ga0265319_10069353 | 500 |
| 346 | 3300028577 | Ga0265318_10000065 | Ga0265318_1000006539 | 500 |
| 347 | 3300031238 | Ga0265332_10006048 | Ga0265332_100060485 | 500 |
| 348 | 3300031239 | Ga0265328_10006266 | Ga0265328_100062662 | 500 |
| 349 | 3300031240 | Ga0265320_10024573 | Ga0265320_100245731 | 500 |
| 350 | 3300031241 | Ga0265325_10001733 | Ga0265325_100017334 | 500 |
| 351 | 3300031242 | Ga0265329_10007386 | Ga0265329_100073863 | 500 |
| 352 | 3300031247 | Ga0265340_10003106 | Ga0265340_100031063 | 500 |
| 353 | 3300031251 | Ga0265327_10036338 | Ga0265327_100363382 | 500 |
| 354 | 3300031344 | Ga0265316_10007012 | Ga0265316_100070128 | 500 |
| 355 | 3300031344 | Ga0265316_10013879 | Ga0265316_100138792 | 500 |
| 356 | 3300031595 | Ga0265313_10005955 | Ga0265313_100059553 | 500 |
| 357 | 3300031711 | Ga0265314_10012798 | Ga0265314_100127983 | 500 |
| 358 | 3300031712 | Ga0265342_10005194 | Ga0265342_100051943 | 500 |
| 359 | 3300034816 | Ga0373930_0003418 | Ga0373930_0003418_213_1919 | 500 |
| 360 | 3300034820 | Ga0373959_0003187 | Ga0373959_0003187_38_1657 | 500 |
| 361 | 3300035083 | Ga0373926_0026748 | Ga0373926_0026748_68_1669 | 500 |
| 362 | 3300035088 | Ga0373940_0000244 | Ga0373940_0000244_3953_5659 | 500 |
| 363 | 3300035091 | Ga0373951_0002498 | Ga0373951_0002498_216_1922 | 500 |
| 364 | 3300035112 | Ga0373932_0001551 | Ga0373932_0001551_4182_5888 | 500 |
| 365 | 3300035114 | Ga0373939_0005788 | Ga0373939_0005788_494_2200 | 500 |
| 366 | 3300035170 | Ga0373943_0022998 | Ga0373943_0022998_822_2423 | 500 |
| 367 | 3300035172 | Ga0373955_0033245 | Ga0373955_0033245_333_1931 | 500 |
| 368 | 3300035241 | Ga0373961_0002090 | Ga0373961_0002090_3236_4942 | 500 |
| 369 | 3300035691 | Ga0373931_0000692 | Ga0373931_0000692_7308_9014 | 500 |
| 370 | 3300035692 | Ga0373935_0071147 | Ga0373935_0071147_499_2121 | 500 |
| 371 | 3300035692 | Ga0373935_0098172 | Ga0373935_0098172_260_1861 | 500 |
| 372 | 3300035725 | Ga0373947_0094799 | Ga0373947_0094799_142_1764 | 500 |
| 373 | 3300036401 | Ga0373937_0064209 | Ga0373937_0064209_1626_3227 | 500 |
| 374 | 3300037068 | Ga0373925_0004875 | Ga0373925_0004875_5339_6940 | 500 |
| 375 | 3300037418 | Ga0395900_0069122 | Ga0395900_0069122_1590_3236 | 500 |
| 376 | 3300037466 | Ga0395898_0010456 | Ga0395898_0010456_7569_9215 | 500 |
| 377 | 3300037471 | Ga0395905_0194487 | Ga0395905_0194487_143_1747 | 500 |
| 378 | 3300038443 | Ga0395901_0040707 | Ga0395901_0040707_2302_3948 | 500 |
| 379 | 3300044694 | Ga0466963_0011789 | Ga0466963_0011789_3419_5026 | 500 |
| 380 | 3300044842 | Ga0466957_0008193 | Ga0466957_0008193_2493_4094 | 500 |
| 381 | 3300044842 | Ga0466957_0008193 | Ga0466957_0008193_4191_5798 | 500 |
| 382 | 3300044901 | Ga0466960_0006573 | Ga0466960_0006573_2688_4289 | 500 |
| 383 | 3300045976 | Ga0466967_0024573 | Ga0466967_0024573_2915_4522 | 500 |
| 384 | 3300046462 | Ga0495651_0072763 | Ga0495651_0072763_119_1717 | 500 |
| 385 | 3300046473 | Ga0495582_0003879 | Ga0495582_0003879_1737_3338 | 500 |
| 386 | 3300046475 | Ga0495639_0001038 | Ga0495639_0001038_4984_6585 | 500 |
| 387 | 3300046476 | Ga0495662_0002913 | Ga0495662_0002913_6851_8452 | 500 |
| 388 | 3300046477 | Ga0495664_0026252 | Ga0495664_0026252_787_2388 | 500 |
| 389 | 3300046511 | Ga0495608_0004234 | Ga0495608_0004234_2656_4257 | 500 |
| 390 | 3300046531 | Ga0495665_0002442 | Ga0495665_0002442_5202_6803 | 500 |
| 391 | 3300046533 | Ga0495640_0014783 | Ga0495640_0014783_1570_3171 | 500 |
| 392 | 3300046559 | Ga0495667_0018535 | Ga0495667_0018535_1993_3591 | 500 |
| 393 | 3300046615 | Ga0495656_0008540 | Ga0495656_0008540_1895_3517 | 500 |
| 394 | 3300046642 | Ga0495634_0009793 | Ga0495634_0009793_1570_3171 | 500 |
| 395 | 3300046663 | Ga0495635_0018127 | Ga0495635_0018127_1737_3338 | 500 |
| 396 | 3300046674 | Ga0495588_0005968 | Ga0495588_0005968_2313_3914 | 500 |
| 397 | 3300046675 | Ga0495657_0005435 | Ga0495657_0005435_7372_8973 | 500 |
| 398 | 3300046675 | Ga0495657_0033048 | Ga0495657_0033048_1866_3464 | 500 |
| 399 | 3300046681 | Ga0495647_0002246 | Ga0495647_0002246_2482_4083 | 500 |
| 400 | 3300046683 | Ga0495658_0002914 | Ga0495658_0002914_5517_7118 | 500 |
| 401 | 3300046689 | Ga0495613_0005198 | Ga0495613_0005198_4146_5747 | 500 |
| 402 | 3300046690 | Ga0495624_0016169 | Ga0495624_0016169_1861_3462 | 500 |
| 403 | 3300046809 | Ga0495600_0011687 | Ga0495600_0011687_283_1884 | 500 |
| 404 | 3300047317 | Ga0495604_0042811 | Ga0495604_0042811_1248_2849 | 500 |
| 405 | 3300047319 | Ga0495674_0027619 | Ga0495674_0027619_1582_3183 | 500 |
| 406 | 3300047321 | Ga0495676_0029108 | Ga0495676_0029108_1496_3097 | 500 |
| 407 | 3300047321 | Ga0495676_0038917 | Ga0495676_0038917_1557_3158 | 500 |
| 408 | 3300047322 | Ga0495680_0019548 | Ga0495680_0019548_456_2057 | 500 |
| 409 | 3300047322 | Ga0495680_0020200 | Ga0495680_0020200_1564_3162 | 500 |
| 410 | 3300047322 | Ga0495680_0097278 | Ga0495680_0097278_464_2065 | 500 |
| 411 | 3300048903 | Ga0496100_0042643 | Ga0496100_0042643_620_2242 | 500 |
| 412 | 3300048904 | Ga0496101_0026413 | Ga0496101_0026413_163_1764 | 500 |
| 413 | 3300048905 | Ga0496102_0062219 | Ga0496102_0062219_1568_3190 | 500 |
| 414 | 3300048907 | Ga0496104_0001632 | Ga0496104_0001632_6747_8453 | 500 |
| 415 | 3300048907 | Ga0496104_0010570 | Ga0496104_0010570_223_1824 | 500 |
| 416 | 3300048908 | Ga0496105_0009655 | Ga0496105_0009655_1601_3307 | 500 |
| 417 | 3300048908 | Ga0496105_0012182 | Ga0496105_0012182_1835_3436 | 500 |
| 418 | 3300048908 | Ga0496105_0031394 | Ga0496105_0031394_2284_3906 | 500 |
| 419 | 3300048909 | Ga0496106_0001671 | Ga0496106_0001671_1153_2670 | 500 |
| 420 | 3300048909 | Ga0496106_0002385 | Ga0496106_0002385_11569_13170 | 500 |
| 421 | 3300048909 | Ga0496106_0003960 | Ga0496106_0003960_1796_3397 | 500 |
| 422 | 3300048909 | Ga0496106_0047503 | Ga0496106_0047503_1158_2864 | 500 |
| 423 | 3300048910 | Ga0496107_0003972 | Ga0496107_0003972_6500_8101 | 500 |
| 424 | 3300048911 | Ga0496108_0009135 | Ga0496108_0009135_495_2201 | 500 |
| 425 | 3300048911 | Ga0496108_0014119 | Ga0496108_0014119_1836_3437 | 500 |
| 426 | 3300048911 | Ga0496108_0078603 | Ga0496108_0078603_240_1847 | 500 |
| 427 | 3300048911 | Ga0496108_0133450 | Ga0496108_0133450_28_1650 | 500 |
| 428 | 3300048912 | Ga0496109_0005462 | Ga0496109_0005462_6790_8391 | 500 |
| 429 | 3300048912 | Ga0496109_0017018 | Ga0496109_0017018_605_2227 | 500 |
| 430 | 3300048912 | Ga0496109_0018491 | Ga0496109_0018491_1000_2517 | 500 |
| 431 | 3300048912 | Ga0496109_0037510 | Ga0496109_0037510_2324_3931 | 500 |
| 432 | 3300048912 | Ga0496109_0037510 | Ga0496109_0037510_625_2226 | 500 |
| 433 | 3300048912 | Ga0496109_0085755 | Ga0496109_0085755_1158_2864 | 500 |
| 434 | 3300048913 | Ga0496110_0005152 | Ga0496110_0005152_6933_8534 | 500 |
| 435 | 3300048913 | Ga0496110_0011083 | Ga0496110_0011083_711_2417 | 500 |
| 436 | 3300048913 | Ga0496110_0040528 | Ga0496110_0040528_1149_2771 | 500 |
| 437 | 3300048914 | Ga0496111_0004148 | Ga0496111_0004148_2545_4146 | 500 |
| 438 | 3300048914 | Ga0496111_0042181 | Ga0496111_0042181_987_2609 | 500 |
| 439 | 3300048914 | Ga0496111_0131031 | Ga0496111_0131031_129_1730 | 500 |
| 440 | 3300048915 | Ga0496112_0001131 | Ga0496112_0001131_12955_14556 | 500 |
| 441 | 3300048915 | Ga0496112_0060795 | Ga0496112_0060795_1935_3452 | 500 |
| 442 | 3300048915 | Ga0496112_0063065 | Ga0496112_0063065_1526_3127 | 500 |
| 443 | 3300048915 | Ga0496112_0075679 | Ga0496112_0075679_1522_3063 | 500 |
| 444 | 3300048915 | Ga0496112_0238122 | Ga0496112_0238122_41_1558 | 500 |
| 445 | 3300048916 | Ga0496113_0013448 | Ga0496113_0013448_381_1982 | 500 |
| 446 | 3300048916 | Ga0496113_0058857 | Ga0496113_0058857_448_2055 | 500 |
| 447 | 3300048917 | Ga0496114_0007338 | Ga0496114_0007338_5747_7453 | 500 |
| 448 | 3300048917 | Ga0496114_0063062 | Ga0496114_0063062_1504_3054 | 500 |
| 449 | 3300048918 | Ga0496115_0021452 | Ga0496115_0021452_385_2091 | 500 |
| 450 | 3300048918 | Ga0496115_0039862 | Ga0496115_0039862_158_1759 | 500 |
| 451 | 3300049583 | Ga0501067_0001714 | Ga0501067_0001714_8824_10425 | 500 |
| 452 | 3300049585 | Ga0501069_0016122 | Ga0501069_0016122_1649_3250 | 500 |
| 453 | 3300050512 | nmdc:mga0n895_11145_c1 | nmdc:mga0n895_11145_c1_1901_3502 | 500 |
| 454 | 3300050512 | nmdc:mga0n895_132553_c1 | nmdc:mga0n895_132553_c1_707_2422 | 500 |
| 455 | 3300050513 | nmdc:mga0rr50_5823_c1 | nmdc:mga0rr50_5823_c1_3805_5406 | 500 |
| 456 | 3300050514 | nmdc:mga08x19_16343_c1 | nmdc:mga08x19_16343_c1_1572_3173 | 500 |
| 457 | 3300050514 | nmdc:mga08x19_19252_c1 | nmdc:mga08x19_19252_c1_945_2660 | 500 |
| 458 | 3300050514 | nmdc:mga08x19_21977_c1 | nmdc:mga08x19_21977_c1_1878_3479 | 500 |
| 459 | 3300050515 | nmdc:mga0a205_19375_c1 | nmdc:mga0a205_19375_c1_731_2446 | 500 |
| 460 | 3300053077 | Ga0495601_0001410 | Ga0495601_0001410_133_1734 | 500 |
| 461 | 3300053085 | Ga0495619_0080048 | Ga0495619_0080048_50_1651 | 500 |
| 462 | 3300061734 | Ga0530510_0034431 | Ga0530510_0034431_717_2318 | 500 |
| 463 | 3300006028 | Ga0070717_10084505 | Ga0070717_100845053 | 501 |
| 464 | 3300006058 | Ga0075432_10001933 | Ga0075432_100019336 | 501 |
| 465 | 3300006844 | Ga0075428_100047206 | Ga0075428_1000472066 | 501 |
| 466 | 3300006847 | Ga0075431_100006298 | Ga0075431_1000062986 | 501 |
| 467 | 3300006914 | Ga0075436_100046651 | Ga0075436_1000466512 | 501 |
| 468 | 3300007076 | Ga0075435_100016527 | Ga0075435_1000165272 | 501 |
| 469 | 3300009094 | Ga0111539_10029793 | Ga0111539_100297932 | 501 |
| 470 | 3300025915 | Ga0207693_10003020 | Ga0207693_100030203 | 501 |
| 471 | 3300027907 | Ga0207428_10007122 | Ga0207428_100071225 | 501 |
| 472 | 3300037312 | Ga0395899_0039514 | Ga0395899_0039514_332_1915 | 501 |
| 473 | 3300041507 | Ga0451851_1018579 | Ga0451851_1018579_71_1750 | 501 |
| 474 | 3300048915 | Ga0496112_0080680 | Ga0496112_0080680_1085_2689 | 501 |
| 475 | 3300050510 | nmdc:mga06r32_22086_c1 | nmdc:mga06r32_22086_c1_1584_3191 | 501 |
| 476 | 3300050511 | nmdc:mga08y16_28819_c1 | nmdc:mga08y16_28819_c1_1553_3160 | 501 |
| 477 | 3300050512 | nmdc:mga0n895_11722_c1 | nmdc:mga0n895_11722_c1_1524_3131 | 501 |
| 478 | 3300050515 | nmdc:mga0a205_13617_c1 | nmdc:mga0a205_13617_c1_1691_3298 | 501 |
| 479 | 3300005327 | Ga0070658_10028173 | Ga0070658_100281732 | 503 |
| 480 | 3300005530 | Ga0070679_100099556 | Ga0070679_1000995562 | 503 |
| 481 | 3300025921 | Ga0207652_10079985 | Ga0207652_100799852 | 503 |
| 482 | 3300045976 | Ga0466967_0174735 | Ga0466967_0174735_337_1929 | 503 |
| 483 | 3300049571 | Ga0501034_0018101 | Ga0501034_0018101_2568_4142 | 503 |
| 484 | 3300049586 | Ga0501070_0010919 | Ga0501070_0010919_497_2071 | 503 |
| 485 | 3300049586 | Ga0501070_0029240 | Ga0501070_0029240_2551_4125 | 503 |
| 486 | 3300049589 | Ga0501073_0050892 | Ga0501073_0050892_310_1884 | 503 |
| 487 | 3300049590 | Ga0501074_0053588 | Ga0501074_0053588_264_1838 | 503 |
| 488 | 3300049590 | Ga0501074_0080473 | Ga0501074_0080473_115_1689 | 503 |
| 489 | 3300049742 | Ga0501080_0006255 | Ga0501080_0006255_404_1978 | 503 |
| 490 | 3300049742 | Ga0501080_0043232 | Ga0501080_0043232_1947_3521 | 503 |
| 491 | 3300049744 | Ga0501083_0000383 | Ga0501083_0000383_24536_26110 | 503 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7a7e-assembly1.cif.gz_A | structure of a delta-n mutant - e232start - of pa1120 (tpbb or yfin) from pseudomonas aeruginosa (pao1) comprising only the ggdef domain | 0.9469 | 354 | 502 |
| 4iob-assembly1.cif.gz_A | crystal structure of the ggdef domain of pa1120 (yfin or tpbb) from pseudomonas aeruginosa at 2.7 ang. | 0.9455 | 358 | 503 |
| 5euh-assembly2.cif.gz_B | crystal structure of the c-di-gmp-bound ggdef domain of p. fluorescens gcbc | 0.937 | 354 | 502 |
| 4urs-assembly1.cif.gz_A | crystal structure of ggdef domain from t.maritima | 0.9369 | 354 | 502 |
| 6tts-assembly1.cif.gz_A | crystal structure of the ggdef domain of dgcb from caulobacter crescentus in complex with c-di-gmp | 0.9358 | 352 | 501 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P38097_675_846_3.30.70.270 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Reverse transcriptase/Diguanylate cyclase domain | 0.9455 | 346 | 502 | 3.30.70.270 |
| 4iobA00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Reverse transcriptase/Diguanylate cyclase domain | 0.9455 | 358 | 503 | 3.30.70.270 |
| 3i5cB02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Reverse transcriptase/Diguanylate cyclase domain | 0.9406 | 354 | 503 | 3.30.70.270 |
| 5euhB00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Reverse transcriptase/Diguanylate cyclase domain | 0.937 | 354 | 502 | 3.30.70.270 |
| 4ursA00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Reverse transcriptase/Diguanylate cyclase domain | 0.9369 | 354 | 502 | 3.30.70.270 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A8DW58-F1-model_v4 | GGDEF domain-containing protein | 0.9538 | 355 | 495 |
GO:0016829
|
| AF-A0A4Q6D9T6-F1-model_v4 | deleted | 0.9476 | 343 | 500 |
|
| AF-A0A1E4QME9-F1-model_v4 | deleted | 0.9403 | 362 | 460 |
|
| AF-A0A2I2A6W6-F1-model_v4 | Diguanylate cyclase | 0.9349 | 345 | 502 |
|
| AF-A0A7W1MGI2-F1-model_v4 | deleted | 0.9344 | 360 | 502 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar