F454120

General Info

Members Datasets Scaffolds Average Seq Length
491 323 982 298

Family's Representative Sequence

Representative Sequence 3300026041|Ga0207639_10018275|Ga0207639_100182754
Length 330
Sequence VSPNGSDLPRALGGTGGTPTPRRPMRRKLLQALTAGLVLATATGCTYKDFPRLGMPTPTTEEAPRILSLWQGSWAAALATGVLVWGLILCSTVFHRRSRTKVEVPPQTRYNMPIEALYTVVPLIIVSVLFYFTARDESKLLSLSDKPAHTVNVVGFQWSWGFNYIENVDGVSGDAKTDENLDAIPNKYKDAFPANAGGVYDVGTPGTRNPQTNNPGPTLWLPKGEKVRFVLTSRDVIHSFWVVPFLMKMDVIPGHTNAFEVTPNQEGTFLGKCAELCGVDHSRMLFNVKVVSPERYQQHLKELEEKGQTGYIPAGIEQTEHEKNRETNVL

Samples

Sample ID Description Type Environment
1 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
9 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
10 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
11 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
12 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
13 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
14 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
15 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
16 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
17 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
18 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
19 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
20 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
21 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
22 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
23 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
24 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
25 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
26 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
27 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
28 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
29 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
30 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
31 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
32 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
33 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
34 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
35 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
36 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
50 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
51 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
52 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
53 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
54 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
55 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
56 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
57 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
58 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
59 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
60 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
61 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
62 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
63 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
64 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
65 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
66 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
67 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
68 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
69 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
70 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
71 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
72 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
73 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
74 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
75 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
76 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
77 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
78 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
79 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
80 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
81 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
82 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
83 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
84 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
85 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
86 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
87 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
88 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
89 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
90 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
91 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
92 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
93 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
94 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
95 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
96 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
97 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
98 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
99 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
100 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
101 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
102 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
103 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
104 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
105 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
106 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
107 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
108 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
109 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
110 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
111 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
112 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
113 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
114 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
115 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
116 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
117 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
118 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
119 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
120 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
121 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
122 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
123 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
124 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
125 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
126 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
127 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
128 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
129 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
130 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
131 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
132 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
133 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
134 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
135 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
136 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
137 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
138 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
139 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
140 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
141 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
142 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
143 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
144 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
145 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
146 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
147 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
148 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
149 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
150 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
151 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
152 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
153 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
154 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
155 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
156 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
157 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
158 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
159 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
160 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
161 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
162 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
163 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
164 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
165 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
166 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
167 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
168 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
169 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
170 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
171 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
172 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
173 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
174 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
175 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
176 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
177 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
178 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
179 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
180 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
185 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
186 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
213 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
214 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
215 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
216 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
217 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
218 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
219 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
220 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
221 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
222 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
223 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
224 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
227 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
228 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
229 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
230 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
231 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
232 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
233 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
234 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
235 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
236 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
240 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
241 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
242 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
243 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
244 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
245 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
246 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
247 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
248 2643221578 Streptomyces sp. Root63 Isolate Unclassified
249 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
250 2643221647 Streptomyces sp. Root369 Isolate Unclassified
251 2643221670 Streptomyces sp. Root431 Isolate Unclassified
252 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
253 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
254 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
255 2643221714 Streptomyces sp. Root264 Isolate Unclassified
256 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
257 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
258 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
259 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
260 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
261 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
262 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
263 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
264 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
265 2808606448 Streptomyces sp. 193411 Isolate Unclassified
266 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
267 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
268 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
269 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
270 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
271 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
272 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
273 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
274 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
275 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
276 2862574272 Streptomyces sp. AcE210 Isolate Nodule
277 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
278 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
279 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
280 2867369537 Streptomyces sp. Z26 Isolate Unclassified
281 2867428634 Streptomyces sp. RP5T Isolate Unclassified
282 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
283 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
284 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
285 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
286 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
287 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
288 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
289 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
290 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
291 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
292 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
293 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
294 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
295 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
296 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
297 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
298 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
299 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
300 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
301 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
302 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
303 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
304 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
305 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
306 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
307 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
308 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
309 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
310 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
311 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
312 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
313 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
314 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
315 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
316 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
317 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
318 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
319 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
320 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
321 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
322 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
323 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 77.8
Metatranscriptomes 5.3
Isolates 16.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.63
Nodule 0.81
Rhizoplane 2.04
Rhizosphere 82.69
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207639_10018275 3300026041 Bacteria 4980
2 JGI24739J22299_10038457 3300001989 Bacteria 1608
3 JGI24739J22299_10052057 3300001989 Bacteria 1318
4 JGI24737J22298_10027406 3300001990 Bacteria 1796
5 JGI24738J21930_10021257 3300002075 Bacteria 1346
6 rootH2_10026316 3300003320 Bacteria 6364
7 rootL2_10016657 3300003322 Bacteria 3596
8 rootH1_10050320 3300003323 Bacteria 1349
9 Ga0006562J51391_1033660 3300003578 Bacteria 2153
10 Ga0068853_100100329 3300005539 Bacteria 2559
11 Ga0070665_100021611 3300005548 Bacteria 6470
12 Ga0070665_100253991 3300005548 Bacteria 1759
13 Ga0068855_100023261 3300005563 Bacteria 7423
14 Ga0068854_100013160 3300005578 Bacteria 5423
15 Ga0068856_100075861 3300005614 Bacteria 3331
16 Ga0068852_100058143 3300005616 Bacteria 3348
17 Ga0068858_100000019 3300005842 Bacteria 180988
18 Ga0081455_10198583 3300005937 Bacteria 1504
19 Ga0075367_10001041 3300006178 Bacteria 11439
20 Ga0099826_10026285 3300006948 Bacteria 4296
21 Ga0105251_10052236 3300009011 Bacteria 1946
22 Ga0105240_10092007 3300009093 Bacteria 3704
23 Ga0105241_10043263 3300009174 Bacteria 3411
24 Ga0105237_10108917 3300009545 Bacteria 2761
25 Ga0105238_10073891 3300009551 Bacteria 3403
26 Ga0105239_10047298 3300010375 Bacteria 4715
27 Ga0105239_10420026 3300010375 Bacteria 1515
28 Ga0105246_10041281 3300011119 Bacteria 3117
29 Ga0105246_10338045 3300011119 Bacteria 1229
30 Ga0157374_10271449 3300013296 Bacteria 1672
31 Ga0163163_10439645 3300014325 Bacteria 1364
32 Ga0182008_10001919 3300014497 Bacteria 13438
33 Ga0157379_10000318 3300014968 Bacteria 38448
34 Ga0182006_1070339 3300015261 Bacteria 1299
35 Ga0182007_10000425 3300015262 Bacteria 25802
36 Ga0183367_1009 3300015688 Bacteria 484598
37 Ga0163161_10196795 3300017792 Bacteria 1552
38 Ga0213875_10013445 3300021388 Bacteria 4018
39 Ga0209758_1002113 3300025297 Bacteria 21004
40 Ga0207710_10000146 3300025900 Bacteria 80814
41 Ga0207647_10008316 3300025904 Bacteria 7441
42 Ga0207647_10008945 3300025904 Bacteria 7139
43 Ga0207654_10005919 3300025911 Bacteria 6154
44 Ga0207695_10026366 3300025913 Bacteria 6487
45 Ga0207671_10000142 3300025914 Bacteria 110234
46 Ga0207694_10004417 3300025924 Bacteria 10993
47 Ga0207694_10118389 3300025924 Bacteria 2113
48 Ga0207667_10041680 3300025949 Bacteria 4881
49 Ga0207640_10110200 3300025981 Bacteria 1949
50 Ga0207703_10000036 3300026035 Bacteria 181013
51 Ga0207639_10072585 3300026041 Bacteria 2695
52 Ga0207678_10083408 3300026067 Bacteria 2734
53 Ga0207702_10048542 3300026078 Bacteria 3581
54 Ga0207674_10116306 3300026116 Bacteria 2645
55 Ga0268266_10056736 3300028379 Bacteria 3369
56 Ga0307517_10019991 3300028786 Bacteria 8559
57 Ga0307515_10017805 3300028794 Bacteria 12915
58 Ga0268256_1020619 3300030500 Bacteria 1773
59 Ga0307511_10003785 3300030521 Bacteria 15485
60 Ga0307511_10109373 3300030521 Bacteria 1768
61 Ga0307512_10004054 3300030522 Bacteria 16305
62 Ga0307512_10127602 3300030522 Bacteria 1608
63 Ga0307513_10009259 3300031456 Bacteria 12465
64 Ga0307513_10076201 3300031456 Bacteria 3479
65 Ga0307514_10014518 3300031649 Bacteria 6516
66 Ga0307514_10164774 3300031649 Bacteria 1460
67 Ga0307514_10165751 3300031649 Bacteria 1453
68 Ga0316576_10000331 3300031727 Bacteria 21224
69 Ga0316576_10000797 3300031727 Bacteria 15872
70 Ga0316576_10013105 3300031727 Bacteria 5500
71 Ga0316576_10062829 3300031727 Bacteria 2724
72 Ga0316578_10022363 3300031728 Bacteria 3524
73 Ga0307516_10016056 3300031730 Bacteria 7851
74 Ga0307516_10087539 3300031730 Bacteria 2949
75 Ga0307410_10185068 3300031852 Bacteria 1580
76 Ga0307507_10046145 3300033179 Bacteria 4275
77 Ga0307510_10041013 3300033180 Bacteria 5070
78 Ga0373923_0133237 3300035111 Bacteria 1118
79 Ga0316574_0010301 3300035398 Bacteria 5278
80 Ga0316574_0023856 3300035398 Bacteria 3656
81 Ga0316574_0053559 3300035398 Bacteria 2519
82 Ga0316582_0136414 3300036647 Bacteria 1652
83 Ga0316584_0001773 3300036712 Bacteria 13279
84 Ga0316584_0009276 3300036712 Bacteria 6822
85 Ga0395898_0025716 3300037466 Bacteria 5928
86 Ga0395898_0027471 3300037466 Bacteria 5711
87 Ga0395898_0727029 3300037466 Bacteria 934
88 Ga0436364_1073669 3300037853 Bacteria 8050
89 Ga0439436_0006868 3300041404 Bacteria 3497
90 Ga0439436_0015159 3300041404 Bacteria 2319
91 Ga0439439_0009738 3300041406 Bacteria 2291
92 Ga0439439_0020081 3300041406 Bacteria 1659
93 Ga0439466_0074501 3300041411 Bacteria 1077
94 Ga0451837_0287855 3300041494 Bacteria 1523
95 Ga0451847_0611038 3300041503 Bacteria 986
96 Ga0451853_0615988 3300041512 Bacteria 2078
97 Ga0439449_0000137 3300042007 Bacteria 24720
98 Ga0439455_0000547 3300042012 Bacteria 5312
99 Ga0439457_001245 3300042014 Bacteria 7652
100 Ga0439457_001810 3300042014 Bacteria 6312
101 Ga0439462_0032075 3300042015 Bacteria 1392
102 Ga0450894_000248 3300042131 Bacteria 9682
103 Ga0450896_001017 3300042133 Bacteria 3276
104 Ga0450898_000587 3300042134 Bacteria 4337
105 Ga0450899_000065 3300042135 Bacteria 8675
106 Ga0450900_004394 3300042136 Bacteria 1618
107 Ga0450903_000221 3300042138 Bacteria 12729
108 Ga0439458_0007923 3300042157 Bacteria 2362
109 Ga0466969_0006548 3300044656 Bacteria 6196
110 Ga0466972_0000586 3300044658 Bacteria 17695
111 Ga0466966_0024075 3300044684 Bacteria 3985
112 Ga0466966_0065910 3300044684 Bacteria 2276
113 Ga0466961_0036667 3300044693 Bacteria 3147
114 Ga0466961_0041803 3300044693 Bacteria 2939
115 Ga0466961_0073474 3300044693 Bacteria 2168
116 Ga0466961_0213432 3300044693 Bacteria 1191
117 Ga0466961_0249029 3300044693 Bacteria 1091
118 Ga0466963_0008863 3300044694 Bacteria 6036
119 Ga0466963_0035626 3300044694 Bacteria 3243
120 Ga0466971_0026988 3300044719 Bacteria 2570
121 Ga0466971_0193311 3300044719 Bacteria 959
122 Ga0466970_0020359 3300044765 Bacteria 3446
123 Ga0466970_0172119 3300044765 Bacteria 1200
124 Ga0466970_0193013 3300044765 Bacteria 1132
125 Ga0466957_0143718 3300044842 Bacteria 1539
126 Ga0466960_0001090 3300044901 Bacteria 9756
127 Ga0466959_0010326 3300045049 Bacteria 6668
128 Ga0466959_0162543 3300045049 Bacteria 1569
129 Ga0466959_0316813 3300045049 Bacteria 1067
130 Ga0466958_0041301 3300045836 Bacteria 2774
131 Ga0466967_0007067 3300045976 Bacteria 8042
132 Ga0466967_0039350 3300045976 Bacteria 4064
133 Ga0466967_0343691 3300045976 Bacteria 1443
134 Ga0495627_022583 3300046453 Bacteria 2069
135 Ga0495592_0011647 3300046454 Bacteria 6660
136 Ga0495603_0085658 3300046455 Bacteria 1844
137 Ga0495603_0200419 3300046455 Bacteria 1153
138 Ga0495590_0049821 3300046457 Bacteria 1461
139 Ga0495629_0042774 3300046459 Bacteria 3182
140 Ga0495629_0123864 3300046459 Bacteria 1800
141 Ga0495629_0134341 3300046459 Bacteria 1722
142 Ga0495638_0051816 3300046460 Bacteria 2559
143 Ga0495651_0008099 3300046462 Bacteria 8056
144 Ga0495651_0011465 3300046462 Bacteria 6808
145 Ga0495651_0022686 3300046462 Bacteria 4878
146 Ga0495651_0087712 3300046462 Bacteria 2339
147 Ga0495580_0081609 3300046472 Bacteria 2253
148 Ga0495639_0005142 3300046475 Bacteria 5620
149 Ga0495664_0000982 3300046477 Bacteria 14656
150 Ga0495664_0035020 3300046477 Bacteria 2955
151 Ga0495664_0057895 3300046477 Bacteria 2306
152 Ga0495584_0008039 3300046491 Bacteria 5483
153 Ga0495585_0062286 3300046492 Bacteria 2049
154 Ga0495594_0004182 3300046499 Bacteria 7412
155 Ga0495594_0005551 3300046499 Bacteria 6478
156 Ga0495594_0142234 3300046499 Bacteria 1361
157 Ga0495594_0173612 3300046499 Bacteria 1226
158 Ga0495596_0023948 3300046500 Bacteria 2475
159 Ga0495607_0021447 3300046501 Bacteria 4064
160 Ga0495607_0046186 3300046501 Bacteria 2559
161 Ga0495583_0057313 3300046506 Bacteria 1752
162 Ga0495606_0010155 3300046507 Bacteria 7856
163 Ga0495610_0071840 3300046512 Bacteria 1612
164 Ga0495618_0053537 3300046514 Bacteria 2551
165 Ga0495618_0133235 3300046514 Bacteria 1590
166 Ga0495618_0157018 3300046514 Bacteria 1451
167 Ga0495628_0059739 3300046516 Bacteria 2992
168 Ga0495630_0008337 3300046517 Bacteria 7439
169 Ga0495631_0028711 3300046518 Bacteria 2537
170 Ga0495631_0065528 3300046518 Bacteria 1572
171 Ga0495632_0038059 3300046519 Bacteria 2437
172 Ga0495637_0016191 3300046520 Bacteria 3488
173 Ga0495643_0010898 3300046522 Bacteria 5568
174 Ga0495648_0083232 3300046524 Bacteria 1813
175 Ga0495666_0002783 3300046526 Bacteria 8739
176 Ga0495666_0092982 3300046526 Bacteria 1423
177 Ga0495652_0001534 3300046529 Bacteria 25349
178 Ga0495652_0007058 3300046529 Bacteria 10376
179 Ga0495654_0005542 3300046530 Bacteria 7315
180 Ga0495640_0012846 3300046533 Bacteria 6389
181 Ga0495587_0024292 3300046536 Bacteria 3716
182 Ga0495609_0010287 3300046538 Bacteria 4492
183 Ga0495597_0025807 3300046542 Bacteria 2703
184 Ga0495645_0012658 3300046543 Bacteria 5949
185 Ga0495645_0087298 3300046543 Bacteria 2231
186 Ga0495622_0032696 3300046557 Bacteria 2428
187 Ga0495622_0075741 3300046557 Bacteria 1550
188 Ga0495622_0116365 3300046557 Bacteria 1222
189 Ga0495633_0011818 3300046558 Bacteria 4681
190 Ga0495667_0136087 3300046559 Bacteria 1584
191 Ga0495656_0040797 3300046615 Bacteria 1936
192 Ga0495634_0002168 3300046642 Bacteria 16508
193 Ga0495634_0017584 3300046642 Bacteria 5099
194 Ga0495611_0018071 3300046648 Bacteria 3022
195 Ga0495611_0038299 3300046648 Bacteria 2132
196 Ga0495625_0020105 3300046660 Bacteria 5160
197 Ga0495625_0057786 3300046660 Bacteria 2757
198 Ga0495625_0093517 3300046660 Bacteria 2075
199 Ga0495635_0035190 3300046663 Bacteria 3472
200 Ga0495635_0105359 3300046663 Bacteria 1926
201 Ga0495661_0038085 3300046665 Bacteria 2998
202 Ga0495588_0003644 3300046674 Bacteria 6738
203 Ga0495588_0026509 3300046674 Bacteria 2894
204 Ga0495588_0127459 3300046674 Bacteria 1342
205 Ga0495657_0019959 3300046675 Bacteria 4827
206 Ga0495657_0021195 3300046675 Bacteria 4664
207 Ga0495657_0070808 3300046675 Bacteria 2278
208 Ga0495657_0178053 3300046675 Bacteria 1306
209 Ga0495599_0059192 3300046678 Bacteria 2396
210 Ga0495623_0117145 3300046679 Bacteria 1608
211 Ga0495623_0167577 3300046679 Bacteria 1286
212 Ga0495646_0008326 3300046680 Bacteria 6595
213 Ga0495646_0039525 3300046680 Bacteria 2908
214 Ga0495658_0026713 3300046683 Bacteria 3097
215 Ga0495613_0001401 3300046689 Bacteria 18364
216 Ga0495613_0012987 3300046689 Bacteria 6188
217 Ga0495613_0015700 3300046689 Bacteria 5635
218 Ga0495613_0115706 3300046689 Bacteria 1929
219 Ga0495613_0177247 3300046689 Bacteria 1510
220 Ga0495670_0019464 3300046691 Bacteria 3345
221 Ga0495670_0062172 3300046691 Bacteria 1878
222 Ga0495670_0223168 3300046691 Bacteria 1001
223 Ga0495671_0009368 3300046692 Bacteria 5467
224 Ga0495649_0091831 3300046694 Bacteria 1617
225 Ga0495589_0043351 3300046794 Bacteria 2239
226 Ga0495589_0110681 3300046794 Bacteria 1325
227 Ga0495600_0040445 3300046809 Bacteria 3036
228 Ga0495600_0040751 3300046809 Bacteria 3025
229 Ga0495600_0040894 3300046809 Bacteria 3021
230 Ga0495600_0209219 3300046809 Bacteria 1250
231 Ga0495600_0291326 3300046809 Bacteria 1031
232 Ga0495660_0025575 3300046810 Bacteria 3351
233 Ga0495581_0006709 3300047315 Bacteria 6673
234 Ga0495581_0115709 3300047315 Bacteria 1559
235 Ga0495604_0001869 3300047317 Bacteria 17124
236 Ga0495604_0008150 3300047317 Bacteria 8294
237 Ga0495636_0085859 3300047318 Bacteria 1361
238 Ga0495636_0184235 3300047318 Bacteria 948
239 Ga0495674_0153508 3300047319 Bacteria 1930
240 Ga0495674_0204732 3300047319 Bacteria 1636
241 Ga0495676_0038934 3300047321 Bacteria 3944
242 Ga0495676_0078633 3300047321 Bacteria 2510
243 Ga0495680_0074166 3300047322 Bacteria 2584
244 Ga0495687_012319 3300047443 Bacteria 4528
245 Ga0495687_019529 3300047443 Bacteria 3322
246 Ga0495687_066454 3300047443 Bacteria 1463
247 Ga0495675_0063403 3300047444 Bacteria 2338
248 Ga0495675_0101966 3300047444 Bacteria 1795
249 Ga0495675_0227308 3300047444 Bacteria 1127
250 Ga0495685_016166 3300047447 Bacteria 2548
251 Ga0495685_025506 3300047447 Bacteria 2033
252 Ga0495685_093278 3300047447 Bacteria 997
253 Ga0495673_0074411 3300047469 Bacteria 1421
254 Ga0495681_0006049 3300047470 Bacteria 7999
255 Ga0495681_0013335 3300047470 Bacteria 4775
256 Ga0495684_0073464 3300047471 Bacteria 2598
257 Ga0495684_0144465 3300047471 Bacteria 1783
258 Ga0495686_0033410 3300047472 Bacteria 3321
259 Ga0495593_0027441 3300047673 Bacteria 3135
260 Ga0495602_0157456 3300048088 Bacteria 1777
261 Ga0495614_0004453 3300048089 Bacteria 6318
262 Ga0495614_0052299 3300048089 Bacteria 1750
263 Ga0495626_0005908 3300048091 Bacteria 7046
264 Ga0496104_0330769 3300048907 Bacteria 1437
265 Ga0496104_0569381 3300048907 Bacteria 1043
266 Ga0496106_0072533 3300048909 Bacteria 2633
267 Ga0496108_0088512 3300048911 Bacteria 2631
268 Ga0496109_0094492 3300048912 Bacteria 2767
269 Ga0496109_0245632 3300048912 Bacteria 1685
270 Ga0496110_0015461 3300048913 Bacteria 6353
271 Ga0496110_0194901 3300048913 Bacteria 1840
272 Ga0496113_0212104 3300048916 Bacteria 1542
273 Ga0496115_0042860 3300048918 Bacteria 3607
274 Ga0496119_0018941 3300048922 Bacteria 5098
275 Ga0496119_0188897 3300048922 Bacteria 1075
276 Ga0496121_0008794 3300048924 Bacteria 11768
277 Ga0496126_0000022 3300048929 Bacteria 464393
278 Ga0501306_003452 3300049127 Bacteria 1704
279 Ga0501308_001116 3300049128 Bacteria 2051
280 Ga0501309_004190 3300049129 Bacteria 1671
281 Ga0501305_013687 3300049161 Bacteria 1125
282 Ga0495678_035031 3300049459 Bacteria 2061
283 Ga0495682_0029037 3300049460 Bacteria 2048
284 Ga0501311_000504 3300049527 Bacteria 2769
285 Ga0501311_005015 3300049527 Bacteria 1433
286 Ga0501312_012853 3300049528 Bacteria 1157
287 Ga0501313_000828 3300049529 Bacteria 2375
288 Ga0501313_010890 3300049529 Bacteria 1042
289 Ga0501315_000310 3300049531 Bacteria 3156
290 Ga0501316_000288 3300049532 Bacteria 3200
291 Ga0501316_003807 3300049532 Bacteria 1487
292 Ga0501317_000711 3300049533 Bacteria 2509
293 Ga0501317_003090 3300049533 Bacteria 1629
294 Ga0501318_000189 3300049534 Bacteria 3222
295 Ga0501319_000719 3300049535 Bacteria 1693
296 Ga0501323_000462 3300049539 Bacteria 3020
297 Ga0501323_001378 3300049539 Bacteria 2136
298 Ga0501323_003362 3300049539 Bacteria 1632
299 Ga0501324_000603 3300049540 Bacteria 2033
300 Ga0501325_006720 3300049541 Bacteria 954
301 Ga0501031_0000940 3300049568 Bacteria 17600
302 Ga0501031_0027871 3300049568 Bacteria 3682
303 Ga0501032_0000349 3300049569 Bacteria 38615
304 Ga0501032_0015892 3300049569 Bacteria 5302
305 Ga0501032_0021296 3300049569 Bacteria 4508
306 Ga0501032_0035656 3300049569 Bacteria 3399
307 Ga0501032_0038583 3300049569 Bacteria 3252
308 Ga0501033_0025087 3300049570 Bacteria 4492
309 Ga0501033_0034419 3300049570 Bacteria 3800
310 Ga0501033_0040315 3300049570 Bacteria 3486
311 Ga0501033_0063754 3300049570 Bacteria 2712
312 Ga0501033_0101900 3300049570 Bacteria 2094
313 Ga0501034_0004152 3300049571 Bacteria 16221
314 Ga0501034_0067974 3300049571 Bacteria 3574
315 Ga0501034_0084523 3300049571 Bacteria 3175
316 Ga0501034_0105255 3300049571 Bacteria 2814
317 Ga0501034_0105261 3300049571 Bacteria 2814
318 Ga0501036_0016065 3300049572 Bacteria 6254
319 Ga0501036_0041292 3300049572 Bacteria 3903
320 Ga0501036_0091776 3300049572 Bacteria 2565
321 Ga0501036_0130320 3300049572 Bacteria 2123
322 Ga0501036_0364478 3300049572 Bacteria 1206
323 Ga0501037_0002432 3300049573 Bacteria 13465
324 Ga0501037_0014083 3300049573 Bacteria 5891
325 Ga0501037_0021940 3300049573 Bacteria 4727
326 Ga0501037_0056201 3300049573 Bacteria 2875
327 Ga0501038_0013851 3300049574 Bacteria 7349
328 Ga0501038_0018437 3300049574 Bacteria 6301
329 Ga0501038_0027289 3300049574 Bacteria 5082
330 Ga0501038_0043175 3300049574 Bacteria 3921
331 Ga0501038_0110630 3300049574 Bacteria 2276
332 Ga0501039_0022674 3300049575 Bacteria 4817
333 Ga0501039_0063209 3300049575 Bacteria 2868
334 Ga0501039_0090259 3300049575 Bacteria 2388
335 Ga0501040_0018234 3300049576 Bacteria 4659
336 Ga0501041_0001346 3300049577 Bacteria 13537
337 Ga0501042_0071247 3300049578 Bacteria 2486
338 Ga0501042_0083018 3300049578 Bacteria 2297
339 Ga0501043_0003089 3300049579 Bacteria 13812
340 Ga0501043_0006539 3300049579 Bacteria 9351
341 Ga0501043_0019954 3300049579 Bacteria 5260
342 Ga0501043_0027159 3300049579 Bacteria 4493
343 Ga0501046_0053039 3300049580 Bacteria 3194
344 Ga0501046_0075485 3300049580 Bacteria 2613
345 Ga0501047_0000189 3300049581 Bacteria 74827
346 Ga0501047_0004989 3300049581 Bacteria 12456
347 Ga0501047_0019611 3300049581 Bacteria 6489
348 Ga0501047_0045050 3300049581 Bacteria 4264
349 Ga0501047_0059034 3300049581 Bacteria 3704
350 Ga0501047_0083205 3300049581 Bacteria 3075
351 Ga0501047_0100238 3300049581 Bacteria 2775
352 Ga0501047_0273915 3300049581 Bacteria 1533
353 Ga0501047_0325757 3300049581 Bacteria 1375
354 Ga0501047_0534251 3300049581 Bacteria 998
355 Ga0501048_0002495 3300049582 Bacteria 14051
356 Ga0501048_0076050 3300049582 Bacteria 2369
357 Ga0501068_0005639 3300049584 Bacteria 6857
358 Ga0501069_0076348 3300049585 Bacteria 1883
359 Ga0501069_0091110 3300049585 Bacteria 1724
360 Ga0501070_0033160 3300049586 Bacteria 4320
361 Ga0501070_0046632 3300049586 Bacteria 3603
362 Ga0501070_0611039 3300049586 Bacteria 868
363 Ga0501070_0663185 3300049586 Bacteria 827
364 Ga0501071_0050757 3300049587 Bacteria 2988
365 Ga0501071_0128656 3300049587 Bacteria 1881
366 Ga0501072_0021693 3300049588 Bacteria 4981
367 Ga0501072_0318798 3300049588 Bacteria 1235
368 Ga0501074_0003000 3300049590 Bacteria 11873
369 Ga0501076_0024727 3300049592 Bacteria 4644
370 Ga0501077_0044162 3300049593 Bacteria 2832
371 Ga0501079_0040477 3300049741 Bacteria 3594
372 Ga0501080_0072016 3300049742 Bacteria 3215
373 Ga0501083_0002475 3300049744 Bacteria 12663
374 Ga0501282_001778 3300049778 Bacteria 2370
375 Ga0501035_0000922 3300049822 Bacteria 31150
376 Ga0501035_0021956 3300049822 Bacteria 5864
377 Ga0501035_0030444 3300049822 Bacteria 4919
378 Ga0501035_0046860 3300049822 Bacteria 3886
379 Ga0501035_0063862 3300049822 Bacteria 3273
380 Ga0501035_0109737 3300049822 Bacteria 2418
381 Ga0501044_0002906 3300049823 Bacteria 19500
382 Ga0501044_0011335 3300049823 Bacteria 9658
383 Ga0501044_0033174 3300049823 Bacteria 5427
384 Ga0501044_0080579 3300049823 Bacteria 3297
385 Ga0501044_0082285 3300049823 Bacteria 3257
386 Ga0501044_0088379 3300049823 Bacteria 3128
387 Ga0501044_0131875 3300049823 Bacteria 2492
388 Ga0501044_0321495 3300049823 Bacteria 1472
389 Ga0501044_0360374 3300049823 Bacteria 1372
390 Ga0501045_0028097 3300049824 Bacteria 4056
391 Ga0501045_0057849 3300049824 Bacteria 2838
392 Ga0501045_0087026 3300049824 Bacteria 2306
393 Ga0501045_0110404 3300049824 Bacteria 2039
394 nmdc:mga06z11_32367_c1 3300050494 Bacteria 2550
395 Ga0495612_0002297 3300053078 Bacteria 7875
396 Ga0495655_0037747 3300053083 Bacteria 1215
397 Ga0500640_019276 3300053095 Bacteria 2919
398 Ga0500553_068660 3300053101 Bacteria 1636
399 Ga0500560_020064 3300053107 Bacteria 1890
400 Ga0500573_0210573 3300053140 Bacteria 1026
401 Ga0500636_0120164 3300053177 Bacteria 1475
402 Ga0501084_0026069 3300054114 Bacteria 4876
403 Ga0587106_001914 3300059605 Bacteria 1953
404 Ga0587106_016679 3300059605 Bacteria 1041
405 Ga0587115_005655 3300059626 Bacteria 1415
406 Ga0587114_006307 3300059655 Bacteria 1321
407 Ga0501082_0103839 3300060353 Bacteria 2458
408 Ga0530510_0158172 3300061734 Bacteria 1675
409 2547409548 2547132111 Bacteria 8013147
410 2554258938 2554235005 Bacteria 6457341
411 2585299832 2582581312 Bacteria 7308206
412 2585306842 2582581313 Bacteria 10042643
413 2585320844 2582581314 Bacteria 11452267
414 2616694326 2616644814 Bacteria 11555299
415 2616899471 2616644941 Bacteria 8510691
416 2643897415 2643221578 Bacteria 9213798
417 2643945116 2643221587 Bacteria 7586415
418 2644265502 2643221647 Bacteria 10741251
419 2644387348 2643221670 Bacteria 6497041
420 2644408560 2643221673 Bacteria 9196637
421 2644432015 2643221677 Bacteria 7584031
422 2644435821 2643221678 Bacteria 9540101
423 2644632290 2643221714 Bacteria 9015452
424 2768644339 2767802112 Bacteria 6465194
425 2784587425 2784132148 Bacteria 8627943
426 2785344904 2784746763 Bacteria 9783172
427 2785367973 2784746768 Bacteria 10036182
428 2786669024 2786546132 Bacteria 10419719
429 2793981924 2791355406 Bacteria 11364898
430 2804844444 2802429296 Bacteria 7227771
431 2808840632 2808606359 Bacteria 9866990
432 2808919215 2808606375 Bacteria 9466072
433 2809230998 2808606448 Bacteria 8656184
434 2811847642 2808606982 Bacteria 7791042
435 2812359549 2811994879 Bacteria 9313447
436 2812481676 2811994917 Bacteria 7761064
437 2819694076 2818991463 Bacteria 7948711
438 2852638473 2852635781 Bacteria 8251373
439 2862182907 2862178590 Bacteria 8583590
440 2862288641 2862281513 Bacteria 9621493
441 2862292472 2862290372 Bacteria 7471434
442 2862384709 2862382967 Bacteria 10317375
443 2862514363 2862507626 Bacteria 9425308
444 2862582899 2862574272 Bacteria 10567477
445 2862709789 2862705112 Bacteria 6563286
446 2863406167 2863404153 Bacteria 9672205
447 2867351312 2867346516 Bacteria 7608576
448 2867370673 2867369537 Bacteria 6501581
449 2867432590 2867428634 Bacteria 9590268
450 2873156978 2873151551 Bacteria 8625867
451 2875393359 2875391855 Bacteria 7600475
452 2877682571 2877676314 Bacteria 9512378
453 2912721596 2912715099 Bacteria 9460473
454 2912725443 2912723979 Bacteria 8557534
455 2912759549 2912757875 Bacteria 7940295
456 2918503232 2918501144 Bacteria 8668083
457 2919468182 2919468124 Bacteria 9133025
458 2935395957 2935390628 Bacteria 7043367
459 2946051333 2946045630 Bacteria 8527308
460 2946066361 2946064051 Bacteria 8957905
461 2946074626 2946072368 Bacteria 8999607
462 2947231014 2947224130 Bacteria 9938529
463 2954387768 2954380949 Bacteria 10050426
464 2954675307 2954673503 Bacteria 9685905
465 2954688826 2954682443 Bacteria 9862841
466 2954698580 2954691527 Bacteria 10720516
467 2954717554 2954711539 Bacteria 10867210
468 2954727518 2954721474 Bacteria 10456478
469 2954734282 2954731030 Bacteria 10243860
470 2954746414 2954740390 Bacteria 10229294
471 2954753166 2954749733 Bacteria 10366972
472 2954765529 2954759201 Bacteria 9358192
473 2966603700 2966598605 Bacteria 7676064
474 2990049446 2990044586 Bacteria 6603797
475 2990063874 2990059506 Bacteria 9321252
476 2990088440 2990088156 Bacteria 6657676
477 2995464720 2995463766 Bacteria 8577691
478 2997458505 2997451912 Bacteria 8492419
479 3006398549 3006393351 Bacteria 6615579
480 3006489169 3006486233 Bacteria 8157040
481 3006495588 3006493962 Bacteria 8825450
482 8008489483 8008485437 Bacteria 7198341
483 8008562148 8008558824 Bacteria 10610750
484 8008580040 8008574985 Bacteria 7815457
485 8023627463 8023623736 Bacteria 8593882
486 8025414080 8025413630 Bacteria 7014048
487 8025528941 8025524527 Bacteria 7197316
488 8025534790 8025530807 Bacteria 8495698
489 8048409008 8048406513 Bacteria 8936924
490 8054167739 8054160619 Bacteria 7783213
491 8056836472 8056829672 Bacteria 9045328
492 Ga0207639_10018275
493 JGI24739J22299_10038457
494 JGI24739J22299_10052057
495 JGI24737J22298_10027406
496 JGI24738J21930_10021257
497 rootH2_10026316
498 rootL2_10016657
499 rootH1_10050320
500 Ga0006562J51391_1033660
501 Ga0068853_100100329
502 Ga0070665_100021611
503 Ga0070665_100253991
504 Ga0068855_100023261
505 Ga0068854_100013160
506 Ga0068856_100075861
507 Ga0068852_100058143
508 Ga0068858_100000019
509 Ga0081455_10198583
510 Ga0075367_10001041
511 Ga0099826_10026285
512 Ga0105251_10052236
513 Ga0105240_10092007
514 Ga0105241_10043263
515 Ga0105237_10108917
516 Ga0105238_10073891
517 Ga0105239_10047298
518 Ga0105239_10420026
519 Ga0105246_10041281
520 Ga0105246_10338045
521 Ga0157374_10271449
522 Ga0163163_10439645
523 Ga0182008_10001919
524 Ga0157379_10000318
525 Ga0182006_1070339
526 Ga0182007_10000425
527 Ga0183367_1009
528 Ga0163161_10196795
529 Ga0213875_10013445
530 Ga0209758_1002113
531 Ga0207710_10000146
532 Ga0207647_10008316
533 Ga0207647_10008945
534 Ga0207654_10005919
535 Ga0207695_10026366
536 Ga0207671_10000142
537 Ga0207694_10004417
538 Ga0207694_10118389
539 Ga0207667_10041680
540 Ga0207640_10110200
541 Ga0207703_10000036
542 Ga0207639_10072585
543 Ga0207678_10083408
544 Ga0207702_10048542
545 Ga0207674_10116306
546 Ga0268266_10056736
547 Ga0307517_10019991
548 Ga0307515_10017805
549 Ga0268256_1020619
550 Ga0307511_10003785
551 Ga0307511_10109373
552 Ga0307512_10004054
553 Ga0307512_10127602
554 Ga0307513_10009259
555 Ga0307513_10076201
556 Ga0307514_10014518
557 Ga0307514_10164774
558 Ga0307514_10165751
559 Ga0316576_10000331
560 Ga0316576_10000797
561 Ga0316576_10013105
562 Ga0316576_10062829
563 Ga0316578_10022363
564 Ga0307516_10016056
565 Ga0307516_10087539
566 Ga0307410_10185068
567 Ga0307507_10046145
568 Ga0307510_10041013
569 Ga0373923_0133237
570 Ga0316574_0010301
571 Ga0316574_0023856
572 Ga0316574_0053559
573 Ga0316582_0136414
574 Ga0316584_0001773
575 Ga0316584_0009276
576 Ga0395898_0025716
577 Ga0395898_0027471
578 Ga0395898_0727029
579 Ga0436364_1073669
580 Ga0439436_0006868
581 Ga0439436_0015159
582 Ga0439439_0009738
583 Ga0439439_0020081
584 Ga0439466_0074501
585 Ga0451837_0287855
586 Ga0451847_0611038
587 Ga0451853_0615988
588 Ga0439449_0000137
589 Ga0439455_0000547
590 Ga0439457_001245
591 Ga0439457_001810
592 Ga0439462_0032075
593 Ga0450894_000248
594 Ga0450896_001017
595 Ga0450898_000587
596 Ga0450899_000065
597 Ga0450900_004394
598 Ga0450903_000221
599 Ga0439458_0007923
600 Ga0466969_0006548
601 Ga0466972_0000586
602 Ga0466966_0024075
603 Ga0466966_0065910
604 Ga0466961_0036667
605 Ga0466961_0041803
606 Ga0466961_0073474
607 Ga0466961_0213432
608 Ga0466961_0249029
609 Ga0466963_0008863
610 Ga0466963_0035626
611 Ga0466971_0026988
612 Ga0466971_0193311
613 Ga0466970_0020359
614 Ga0466970_0172119
615 Ga0466970_0193013
616 Ga0466957_0143718
617 Ga0466960_0001090
618 Ga0466959_0010326
619 Ga0466959_0162543
620 Ga0466959_0316813
621 Ga0466958_0041301
622 Ga0466967_0007067
623 Ga0466967_0039350
624 Ga0466967_0343691
625 Ga0495627_022583
626 Ga0495592_0011647
627 Ga0495603_0085658
628 Ga0495603_0200419
629 Ga0495590_0049821
630 Ga0495629_0042774
631 Ga0495629_0123864
632 Ga0495629_0134341
633 Ga0495638_0051816
634 Ga0495651_0008099
635 Ga0495651_0011465
636 Ga0495651_0022686
637 Ga0495651_0087712
638 Ga0495580_0081609
639 Ga0495639_0005142
640 Ga0495664_0000982
641 Ga0495664_0035020
642 Ga0495664_0057895
643 Ga0495584_0008039
644 Ga0495585_0062286
645 Ga0495594_0004182
646 Ga0495594_0005551
647 Ga0495594_0142234
648 Ga0495594_0173612
649 Ga0495596_0023948
650 Ga0495607_0021447
651 Ga0495607_0046186
652 Ga0495583_0057313
653 Ga0495606_0010155
654 Ga0495610_0071840
655 Ga0495618_0053537
656 Ga0495618_0133235
657 Ga0495618_0157018
658 Ga0495628_0059739
659 Ga0495630_0008337
660 Ga0495631_0028711
661 Ga0495631_0065528
662 Ga0495632_0038059
663 Ga0495637_0016191
664 Ga0495643_0010898
665 Ga0495648_0083232
666 Ga0495666_0002783
667 Ga0495666_0092982
668 Ga0495652_0001534
669 Ga0495652_0007058
670 Ga0495654_0005542
671 Ga0495640_0012846
672 Ga0495587_0024292
673 Ga0495609_0010287
674 Ga0495597_0025807
675 Ga0495645_0012658
676 Ga0495645_0087298
677 Ga0495622_0032696
678 Ga0495622_0075741
679 Ga0495622_0116365
680 Ga0495633_0011818
681 Ga0495667_0136087
682 Ga0495656_0040797
683 Ga0495634_0002168
684 Ga0495634_0017584
685 Ga0495611_0018071
686 Ga0495611_0038299
687 Ga0495625_0020105
688 Ga0495625_0057786
689 Ga0495625_0093517
690 Ga0495635_0035190
691 Ga0495635_0105359
692 Ga0495661_0038085
693 Ga0495588_0003644
694 Ga0495588_0026509
695 Ga0495588_0127459
696 Ga0495657_0019959
697 Ga0495657_0021195
698 Ga0495657_0070808
699 Ga0495657_0178053
700 Ga0495599_0059192
701 Ga0495623_0117145
702 Ga0495623_0167577
703 Ga0495646_0008326
704 Ga0495646_0039525
705 Ga0495658_0026713
706 Ga0495613_0001401
707 Ga0495613_0012987
708 Ga0495613_0015700
709 Ga0495613_0115706
710 Ga0495613_0177247
711 Ga0495670_0019464
712 Ga0495670_0062172
713 Ga0495670_0223168
714 Ga0495671_0009368
715 Ga0495649_0091831
716 Ga0495589_0043351
717 Ga0495589_0110681
718 Ga0495600_0040445
719 Ga0495600_0040751
720 Ga0495600_0040894
721 Ga0495600_0209219
722 Ga0495600_0291326
723 Ga0495660_0025575
724 Ga0495581_0006709
725 Ga0495581_0115709
726 Ga0495604_0001869
727 Ga0495604_0008150
728 Ga0495636_0085859
729 Ga0495636_0184235
730 Ga0495674_0153508
731 Ga0495674_0204732
732 Ga0495676_0038934
733 Ga0495676_0078633
734 Ga0495680_0074166
735 Ga0495687_012319
736 Ga0495687_019529
737 Ga0495687_066454
738 Ga0495675_0063403
739 Ga0495675_0101966
740 Ga0495675_0227308
741 Ga0495685_016166
742 Ga0495685_025506
743 Ga0495685_093278
744 Ga0495673_0074411
745 Ga0495681_0006049
746 Ga0495681_0013335
747 Ga0495684_0073464
748 Ga0495684_0144465
749 Ga0495686_0033410
750 Ga0495593_0027441
751 Ga0495602_0157456
752 Ga0495614_0004453
753 Ga0495614_0052299
754 Ga0495626_0005908
755 Ga0496104_0330769
756 Ga0496104_0569381
757 Ga0496106_0072533
758 Ga0496108_0088512
759 Ga0496109_0094492
760 Ga0496109_0245632
761 Ga0496110_0015461
762 Ga0496110_0194901
763 Ga0496113_0212104
764 Ga0496115_0042860
765 Ga0496119_0018941
766 Ga0496119_0188897
767 Ga0496121_0008794
768 Ga0496126_0000022
769 Ga0501306_003452
770 Ga0501308_001116
771 Ga0501309_004190
772 Ga0501305_013687
773 Ga0495678_035031
774 Ga0495682_0029037
775 Ga0501311_000504
776 Ga0501311_005015
777 Ga0501312_012853
778 Ga0501313_000828
779 Ga0501313_010890
780 Ga0501315_000310
781 Ga0501316_000288
782 Ga0501316_003807
783 Ga0501317_000711
784 Ga0501317_003090
785 Ga0501318_000189
786 Ga0501319_000719
787 Ga0501323_000462
788 Ga0501323_001378
789 Ga0501323_003362
790 Ga0501324_000603
791 Ga0501325_006720
792 Ga0501031_0000940
793 Ga0501031_0027871
794 Ga0501032_0000349
795 Ga0501032_0015892
796 Ga0501032_0021296
797 Ga0501032_0035656
798 Ga0501032_0038583
799 Ga0501033_0025087
800 Ga0501033_0034419
801 Ga0501033_0040315
802 Ga0501033_0063754
803 Ga0501033_0101900
804 Ga0501034_0004152
805 Ga0501034_0067974
806 Ga0501034_0084523
807 Ga0501034_0105255
808 Ga0501034_0105261
809 Ga0501036_0016065
810 Ga0501036_0041292
811 Ga0501036_0091776
812 Ga0501036_0130320
813 Ga0501036_0364478
814 Ga0501037_0002432
815 Ga0501037_0014083
816 Ga0501037_0021940
817 Ga0501037_0056201
818 Ga0501038_0013851
819 Ga0501038_0018437
820 Ga0501038_0027289
821 Ga0501038_0043175
822 Ga0501038_0110630
823 Ga0501039_0022674
824 Ga0501039_0063209
825 Ga0501039_0090259
826 Ga0501040_0018234
827 Ga0501041_0001346
828 Ga0501042_0071247
829 Ga0501042_0083018
830 Ga0501043_0003089
831 Ga0501043_0006539
832 Ga0501043_0019954
833 Ga0501043_0027159
834 Ga0501046_0053039
835 Ga0501046_0075485
836 Ga0501047_0000189
837 Ga0501047_0004989
838 Ga0501047_0019611
839 Ga0501047_0045050
840 Ga0501047_0059034
841 Ga0501047_0083205
842 Ga0501047_0100238
843 Ga0501047_0273915
844 Ga0501047_0325757
845 Ga0501047_0534251
846 Ga0501048_0002495
847 Ga0501048_0076050
848 Ga0501068_0005639
849 Ga0501069_0076348
850 Ga0501069_0091110
851 Ga0501070_0033160
852 Ga0501070_0046632
853 Ga0501070_0611039
854 Ga0501070_0663185
855 Ga0501071_0050757
856 Ga0501071_0128656
857 Ga0501072_0021693
858 Ga0501072_0318798
859 Ga0501074_0003000
860 Ga0501076_0024727
861 Ga0501077_0044162
862 Ga0501079_0040477
863 Ga0501080_0072016
864 Ga0501083_0002475
865 Ga0501282_001778
866 Ga0501035_0000922
867 Ga0501035_0021956
868 Ga0501035_0030444
869 Ga0501035_0046860
870 Ga0501035_0063862
871 Ga0501035_0109737
872 Ga0501044_0002906
873 Ga0501044_0011335
874 Ga0501044_0033174
875 Ga0501044_0080579
876 Ga0501044_0082285
877 Ga0501044_0088379
878 Ga0501044_0131875
879 Ga0501044_0321495
880 Ga0501044_0360374
881 Ga0501045_0028097
882 Ga0501045_0057849
883 Ga0501045_0087026
884 Ga0501045_0110404
885 nmdc:mga06z11_32367_c1
886 Ga0495612_0002297
887 Ga0495655_0037747
888 Ga0500640_019276
889 Ga0500553_068660
890 Ga0500560_020064
891 Ga0500573_0210573
892 Ga0500636_0120164
893 Ga0501084_0026069
894 Ga0587106_001914
895 Ga0587106_016679
896 Ga0587115_005655
897 Ga0587114_006307
898 Ga0501082_0103839
899 Ga0530510_0158172
900 2547409548
901 2554258938
902 2585299832
903 2585306842
904 2585320844
905 2616694326
906 2616899471
907 2643897415
908 2643945116
909 2644265502
910 2644387348
911 2644408560
912 2644432015
913 2644435821
914 2644632290
915 2768644339
916 2784587425
917 2785344904
918 2785367973
919 2786669024
920 2793981924
921 2804844444
922 2808840632
923 2808919215
924 2809230998
925 2811847642
926 2812359549
927 2812481676
928 2819694076
929 2852638473
930 2862182907
931 2862288641
932 2862292472
933 2862384709
934 2862514363
935 2862582899
936 2862709789
937 2863406167
938 2867351312
939 2867370673
940 2867432590
941 2873156978
942 2875393359
943 2877682571
944 2912721596
945 2912725443
946 2912759549
947 2918503232
948 2919468182
949 2935395957
950 2946051333
951 2946066361
952 2946074626
953 2947231014
954 2954387768
955 2954675307
956 2954688826
957 2954698580
958 2954717554
959 2954727518
960 2954734282
961 2954746414
962 2954753166
963 2954765529
964 2966603700
965 2990049446
966 2990063874
967 2990088440
968 2995464720
969 2997458505
970 3006398549
971 3006489169
972 3006495588
973 8008489483
974 8008562148
975 8008580040
976 8023627463
977 8025414080
978 8025528941
979 8025534790
980 8048409008
981 8054167739
982 8056836472

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00116

COX2

Cytochrome C oxidase subunit II, periplasmic domain

208

291

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7w5z-assembly1.cif.gz_c2 cryo-em structure of tetrahymena thermophila mitochondrial complex iv, composite dimer model 0.8806 208 289
5tk2-assembly3.cif.gz_C crystal structure of uncharacterized cupredoxin-like domain protein from bacillus anthracis 0.8762 208 281
8gym-assembly1.cif.gz_c2 cryo-em structure of tetrahymena thermophila respiratory mega-complex mc iv2+(i+iii2+ii)2 0.8754 208 290
8bqs-assembly1.cif.gz_Db cryo-em structure of the i-ii-iii2-iv2 respiratory supercomplex from tetrahymena thermophila 0.8704 208 290
4hcf-assembly2.cif.gz_B crystal structure of uncharacterized cupredoxin-like domain protein cupredoxin_1 with copper bound from bacillus anthracis 0.8668 208 281
ID Description Score Start End Superfamily
af_A0A1D6ED90_406_498_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.9458 208 289 2.60.40.420
af_Q8I6V2_60_165_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.9449 208 289 2.60.40.420
2yevE02 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8962 139 291 2.60.40.420
af_P0ABJ1_113_282_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8474 131 292 2.60.40.420
4hcfA00 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8337 208 281 2.60.40.420
ID Description Score Start End GO Terms
AF-A0A537CA45-F1-model_v4 C-type cytochrome 0.9595 208 292 GO:0004129
GO:0005507
GO:0016020
GO:0020037
GO:0042773
AF-A7J464-F1-model_v4 cytochrome-c oxidase (EC 7.1.1.9) (Cytochrome c oxidase polypeptide II) 0.9514 208 296 GO:0004129
GO:0005507
GO:0031966
GO:0042773
AF-A0A109ZZI2-F1-model_v4 cytochrome-c oxidase (EC 7.1.1.9) (Cytochrome c oxidase polypeptide II) 0.951 208 297 GO:0004129
GO:0005507
GO:0031966
GO:0042773
AF-Q7YCT1-F1-model_v4 cytochrome-c oxidase (EC 7.1.1.9) (Cytochrome c oxidase polypeptide II) 0.9495 208 297 GO:0004129
GO:0005507
GO:0031966
GO:0042773
AF-B0F9E2-F1-model_v4 cytochrome-c oxidase (EC 7.1.1.9) (Cytochrome c oxidase polypeptide II) 0.949 208 297 GO:0004129
GO:0005507
GO:0031966
GO:0042773

Map